Integrin α7β1 antibodies and uses thereof

Abstract

The present disclosure provides, among other things, a class of antibodies or an antigen binding fragments that bind to calf-1 or calf-2 domain of α7β1 integrin. The anti-α7β1 antibodies of the present disclosure are effective in stabilizing the α7β1 integrin in the extended closed and extended-open conformations, which enhances the binding to laminins.

Description

Integrin antibodies α 7 β 1 And its uses Bookmarks for related requests This request has priority based on U.S. Temporary Application No. 63 / 667,476, filed on July 3, 2024; and U.S. Temporary Application No. 63 / 566,145, filed on March 15, 2024; the full contents of which are included in this document for reference. Background Integrin α7β1 is a major amino acid receptor in skeletal muscle and cardiac muscle. It acts as a transmembrane linker between the basement membrane and the muscle cell membrane to maintain the functional integrity of muscle cells. Loss-of-function mutations in ITGA7 in humans lead to congenital myopathies and adult cardiomyopathy. Conversely, ITGA7 overexpression in skeletal muscle has been shown to mitigate the progression of muscular dystrophy, and ITGA7 overexpression in cardiac muscle cells protects them from ischemic / reperfusion injury. Muscular dystrophy, such as Duchenne muscular dystrophy (DMD), is a class of genetically inherited degenerative disorders characterized by progressive muscle deterioration and loss of associated functions throughout the body. Current treatments for muscular dystrophic disorders, including dystrophin disorders, focus primarily on alleviating the effects of the disease and improving quality of life, often through the use of glucocorticoids, physical therapy, or orthotics. New approaches to treating dystrophin disorders, including DMD, are needed. Invention Summary The current finding provides, among other things, antibodies to integrin α7β1 and therapeutic applications for these antibodies in the effective treatment of diseases or disorders associated with muscle membrane integrity, such as Duchenne muscular dystrophy (DMD). As described in this document, the current finding is based, in part, on the identification of antibodies to integrin α7β1 that are effective in stabilizing integrin α7β1 in both its extended-closed and extended-open configurations, thereby enhancing its binding to laminin-specific ligands. Consequently, the anti-α7β1 antibodies identified in the current finding potently increase the adhesion of muscle membranes (myelin sheaths) to the extracellular matrix, restoring some or all of the damage to the myelin sheath caused by the absence of functional dystrophin, and ultimately leading to improved mobility, increased muscle strength, and reduced fibrosis in patients with dystrophin disorders. In one respect, the current detection provides an antibody, or part of it, that binds to the antigens and binds to the calf-2 domain of α7β1 integrin, but does not compete with the 20TFT antibody, since the antibody stabilizes the extended configurations of α7β1 integrin. On one hand, the current detection provides an antigen-binding antibody or a part thereof that binds to the α7β1 integrin and competes with a reference antibody for binding to α7β1, where the reference antibody consists of HCDR1 with the sequence GFTFSSYT (serial ID: 2, HCDR1B), HCDR2 with the sequence ISIVGNYI (serial ID: 16, HCDR2B), HCDR3 with the sequence ARRKWEHDAFDI (serial ID: 32, HCDR3B), LCDR1 with the sequence SLRSYY (serial ID: 47, LCDR1B), LCDR2 with the sequence GKN (serial ID: 59, LCDR2B), and LCDR3 with the sequence TSRDNSGNHVV (serial ID: 70, LCDR3B). In one respect, the current detection provides an antigen-binding antibody or fragment that binds to the α7β1 integrin, where the antigen-binding antibody or fragment consists of (a) a means of stabilizing extended α7β1 integrin constructs, and optionally, (b) an Fc domain. In some applied models, the antibody is not the 20TFT antibody. In one respect, the current detection provides an antigen-binding antibody or fragment that binds to α7β1, where the antigen-binding antibody or fragment binds to a region consisting of positions 856-862, 867-889, 1011-1017, 897-905, or 1002-1010 of the α7 integrin amino acid sequence, and where the antigen-binding antibody or fragment acts to stabilize extended configurations of α7β1 integrin. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 856-862, 867-889, or 1011-1017 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 856-862 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 867-889 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 1011-1017 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of the M856, A857, I858, P859, Q860, Q861, and L862 residues of the α7 integrin. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of the V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, and T889 residues of the α7 integrin. In some applied models, the antibody or the antigen-binding part of it is bound to a region consisting of the residues F1011, D1102, R1103, A1104, A1105, V1106, and L1107 of the α7 integrin. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 897-905 or 1002-1010 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 897-905 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of positions 1002-1010 of the α7 integrin amino acid sequence. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of the L897, R898, T899, L900, G901, S902, A903, F904, and L905 positions of the α7 integrin. In some applied models, the antibody or its antigen-binding fragment binds to a region consisting of the V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, and S1100 positions of the α7 integrin. On one hand, the current detection provides an antibody, or part of it, that binds to the antigens and is associated with the calf-1 domain of integrin α7β1 and acts to stabilize extended integrin α7β1 constructs. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin and competes with a reference antibody for binding to the α7β1 antibody, where the reference antibody includes HCDR1 with the sequence GYSFTRYW (serial ID: 7, HCDR1G), HCDR2 with the sequence IDPSDSET (serial ID: 22, HCDR2H), HCDR3 with the sequence ARGGYFGEGWYFDV (serial ID: 38, HCDR3H), LCDR1 with the sequence QSLVHRNGNTY (serial ID: 51, LCDR1F), LCDR2 with the sequence KVS (serial ID: 63, LCDR2F), and LCDR3 with the sequence SQSTHVPWT (serial ID: 75, LCDR3G). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin and competes with a reference antibody for binding to the α7β1 antibody, where the reference antibody consists of HCDR1 with the sequence GFSLTSYG (serial ID: 9, HCDR1I), HCDR2 with the sequence IWVGGIT (serial ID: 24, HCDR2J), HCDR3 with the sequence ARDGYYGDFDV (serial ID: 40, HCDR3J), LCDR1 with the sequence QDINKF (serial ID: 53, LCDR1H), LCDR2 with the sequence YTS (serial ID: 65, LCDR2H), and LCDR3 with the sequence LQYDNLRT (serial ID: 77, LCDR3I). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, consisting of (a) a means of binding to the calf-1 domain of the α7β1 integrin, and (b) the Fc domain. In one respect, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody binds to a region consisting of positions 771-778, 793-779, or 803-805 of the α7 integrin, and where the antibody acts to stabilize the extended configurations of the α7β1 integrin. In some applied models, the region consists of the amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and / or T805 according to the amino acid numbering of human α7. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSYT (serial ID: 2, HCDR1B), HCDR2 with the sequence ISIVGNYI (serial ID: 16, HCDR2B), HCDR3 with the sequence ARRKWEHDAFDI (serial ID: 32, HCDR3B), LCDR1 with the sequence SLRSYY (serial ID: 47, LCDR1B), LCDR2 with the sequence GKN (serial ID: 59, LCDR2B), and LCDR3 with the sequence TSRDNSGNHVV (serial ID: 70, LCDR3B). On one side, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYTFTGYY (serial ID: 1, HCDR1A), HCDR2 with the sequence INPNSGGT (serial ID: 15, HCDR2A), HCDR3 with the sequence AREGANWDYYYYGMDV (serial ID: 31, HCDR3A), LCDR1 with the sequence SSNIGSKT (serial ID: 46, LCDR1A), LCDR2 with the sequence SNN (serial ID: 58, LCDR2A), and LCDR3 with the sequence AAWDDSLNGPV (serial ID: 69, LCDR3A). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSYS (serial ID: 3, HCDR1C), HCDR2 with the sequence ISTSSSYI (serial ID: 17, HCDR2C), HCDR3 with the sequence ARRAWESDAFAI (serial ID: 33, HCDR3C), LCDR1 with the sequence SLRSYY (serial ID: 47, LCDR1B), LCDR2 with the sequence GKN (serial ID: 59, LCDR2B), and LCDR3 with the sequence NSRDSSGNHVV (serial ID: 71, LCDR3C). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSYA (serial ID: 4, HCDR1D), HCDR2 with the sequence ISDSGGIA (serial ID: 18, HCDR2D), HCDR3 with the sequence VRDGY (serial ID: 34, HCDR3D), LCDR1 with the sequence QSLLDSDDGYTY (serial ID: 48, LCDR1C), LCDR2 with the sequence TLS (serial ID: 60, LCDR2C), and LCDR3 with the sequence MQRIEFPLT (serial ID: 72, LCDR3D). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSYA (serial ID: 4, HCDR1D), HCDR2 with the sequence IHYSGGTT (serial ID: 19, HCDR2E), HCDR3 with the sequence VKDGY (serial ID: 35, HCDR3E), LCDR1 with the sequence QSLLDSDDGYTY (serial ID: 48, LCDR1C), LCDR2 with the sequence TLS (serial ID: 60, LCDR2C), and LCDR3 with the sequence MQRIEFPLT (serial ID: 72, LCDR3D). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSRFW (serial ID: 5, HCDR1E), HCDR2 with the sequence TKQDGSEK (serial ID: 20, HCDR2F), HCDR3 with the sequence AREGSGAYWAFDI (serial ID: 36, HCDR3F), LCDR1 with the sequence QSLVHNDGNTY (serial ID: 49, LCDR1D), LCDR2 with the sequence KIS (serial ID: 49, LCDR1D), and LCDR3 with the sequence LQATQFPLT (serial ID: 73, LCDR3E). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GGSISSYY (serial ID: 6, HCDR1F), HCDR2 with the sequence IYTRGST (serial ID: 21, HCDR2G), HCDR3 with the sequence ARVFGGNYRFDAFHI (serial ID: 37, HCDR3G), LCDR1 with the sequence SSNIGAGYD (serial ID: 50, LCDR1E), LCDR2 with the sequence GNN (serial ID: 62, LCDR2E), and LCDR3 with the sequence QSYDSSLSGYV (serial ID: 74, LCDR3F). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYSFTRYW (serial ID: 7, HCDR1G), HCDR2 with the sequence IDPSDSET (serial ID: 22, HCDR2H), HCDR3 with the sequence ARGGYFGEGWYFDV (serial ID: 38, HCDR3H), LCDR1 with the sequence QSLVHRNGNTY (serial ID: 51, LCDR1F), LCDR2 with the sequence KVS (serial ID: 63, LCDR2F), and LCDR3 with the sequence SQSTHVPWT (serial ID: 75, LCDR3G). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYTFTSYW (serial ID: 8, HCDR1H), HCDR2 with the sequence IYPSDSYT (serial ID: 23, HCDR2I), HCDR3 with the sequence TRRANYVGAMDY (serial ID: 39, HCDR3I), LCDR1 with the sequence SSVSY (serial ID: 52, LCDR1G), LCDR2 with the sequence ATS (serial ID: 64, LCDR2G), and LCDR3 with the sequence QQWSSNPLT (serial ID: 76, LCDR3H). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFSLTSYG (serial ID: 9, HCDR1I), HCDR2 with the sequence IWVGGIT (serial ID: 24, HCDR2J), HCDR3 with the sequence ARDGYYGDFDV (serial ID: 40, HCDR3J), LCDR1 with the sequence QDINKF (serial ID: 53, LCDR1H), LCDR2 with the sequence YTS (serial ID: 65, LCDR2H), and LCDR3 with the sequence LQYDNLRT (serial ID: 77, LCDR3I). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFSLTSYG (serial ID: 9, HCDR1I), HCDR2 with the sequence IWAGGIT (serial ID: 25, HCDR2K), HCDR3 with the sequence ARDGYYGDFDV (serial ID: 40, HCDR3J), LCDR1 with the sequence QDINKY (serial ID: 54, LCDR1I), LCDR2 with the sequence YTS (serial ID: 65, LCDR2H), and LCDR3 with the sequence LQYDNLRT (serial ID: 77, LCDR3I). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFSLTSYG (serial ID: 9, HCDR1I), HCDR2 with the sequence IWAGGIT (serial ID: 25, HCDR2K), HCDR3 with the sequence ARDGYYGHFDV (serial ID: 41, HCDR3K), LCDR1 with the sequence QDINKY (serial ID: 54, LCDR1I), LCDR2 with the sequence YTS (serial ID: 65, LCDR2H), and LCDR3 with the sequence LQYDNLRA (serial ID: 78, LCDR3J). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSDA (serial ID: 10, HCDR1J), HCDR2 with the sequence ISIGGSA (serial ID: 26, HCDR2L), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDL (serial ID: 55, LCDR1J), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHNFPFT (serial ID: 79, LCDR3K). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSSA (serial ID: 11, HCDR1K), HCDR2 with the sequence ISVGGST (serial ID: 27, HCDR2M), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDY (serial ID: 56, LCDR1K), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHSFPFT (serial ID: 80, LCDR3L). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSSA (serial ID: 11, HCDR1K), HCDR2 with the sequence ISVGGST (serial ID: 27, HCDR2M), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDY (serial ID: 56, LCDR1K), LCDR2 with the sequence YSS (serial ID: 67, LCDR2J), and LCDR3 with the sequence QNGHSFPFT (serial ID: 80, LCDR3L). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSSA (serial ID: 11, HCDR1K), HCDR2 with the sequence ISVGGST (serial ID: 27, HCDR2M), HCDR3 with the sequence ARGGDYDPMDY (serial ID: 43, HCDR3M), LCDR1 with the sequence QSISDY (serial ID: 56, LCDR1K), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHSFPFT (serial ID: 80, LCDR3L). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSDA (serial ID: 10, HCDR1J), HCDR2 with the sequence ISIGGST (serial ID: 28, HCDR2N), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDL (serial ID: 55, LCDR1J), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHNFPFT (serial ID: 79, LCDR3K). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSSA (serial ID: 11, HCDR1K), HCDR2 with the sequence ISVGGSI (serial ID: 29, HCDR2O), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDY (serial ID: 56, LCDR1K), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHSFPFT (serial ID: 80, LCDR3L). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSDA (serial ID: 10, HCDR1J), HCDR2 with the sequence ISIGGST (serial ID: 28, HCDR2N), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDL (serial ID: 55, LCDR1J), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHNFPFT (serial ID: 79, LCDR3K). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSNCA (serial ID: 12, HCDR1L), HCDR2 with the sequence ISIGGST (serial ID: 28, HCDR2N), HCDR3 with the sequence ARGGDYDAMDY (serial ID: 42, HCDR3L), LCDR1 with the sequence QSISDL (serial ID: 55, LCDR1J), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHSFPFT (serial ID: 80, LCDR3L). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFTFSSDA (serial ID: 10, HCDR1J), HCDR2 with the sequence ISIGGST (serial ID: 28, HCDR2N), HCDR3 with the sequence TRGGDYDAMDY (serial ID: 44, HCDR3N), LCDR1 with the sequence QSISDL (serial ID: 55, LCDR1J), LCDR2 with the sequence YAS (serial ID: 66, LCDR2I), and LCDR3 with the sequence QNGHNFPFT (serial ID: 79, LCDR3K). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFSLSTSDMG (serial ID: 13, HCDR1M), HCDR2 with the sequence IYWDDDK (serial ID: 30, HCDR2P), HCDR3 with the sequence VRGTAVVAFYWYFDV (serial ID: 45, HCDR3O), LCDR1 with the sequence QDINNY (serial ID: 57, LCDR1L), LCDR2 with the sequence RAN (serial ID: 68, LCDR2K), and LCDR3 with the sequence LHYDDFPLT (serial ID: 81, LCDR3M). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GFSLSTSDLG (serial ID: 14, HCDR1N), HCDR2 with the sequence IYWDDDK (serial ID: 30, HCDR2P), HCDR3 with the sequence VRGTAVVAFYWYFDV (serial ID: 45, HCDR3O), LCDR1 with the sequence QDINNY (serial ID: 57, LCDR1L), LCDR2 with the sequence RAN (serial ID: 68, LCDR2K), and LCDR3 with the sequence LQYDDFPLT (serial ID: 82, LCDR3N). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYSFTRYW (serial ID: 101), HCDR2 with the sequence IDPSDSET (serial ID: 27), HCDR3 with the sequence ARGGYFGEGWYFDV (serial ID: 38); LCDR1 with the sequence QSLVHRNGNTY (serial ID: 105), LCDR2 with the sequence KVS (serial ID: 63), and LCDR3 with the sequence SQSTHVPWT (serial ID: 75). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYSFTRYW (serial ID: 101), HCDR2 with the sequence IDPSDSET (serial ID: 102), HCDR3 with the sequence ARGGYFGREWYYDV (serial ID: 103); LCDR1 with the sequence QSLVHRNGNTY (serial ID: 105), LCDR2 with the sequence EVS (serial ID: 106), and LCDR3 with the sequence SQSTHVPWT (serial ID: 75). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with the sequence GYSFTRYW (serial ID: 101), HCDR2 with the sequence IDPSDSET (serial ID: 102), HCDR3 with the sequence ARGGYFGEEWYHDV (serial ID: 104); LCDR1 with the sequence QSLVHRNGNTY (serial ID: 105), LCDR2 with the sequence EVS (serial ID: 106), and LCDR3 with the sequence AQSTQLPYT (serial ID: 107). On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 188, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 189, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 190, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 191, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 192, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 193, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 196, and LCDR3 with serial identification number: 107. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 195, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 197, and LCDR3 with serial identification number: 75. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 190, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 189, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 197, and LCDR3 with serial identification number: 107. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody or antigen-binding fragment consists of the following: i) A heavy chain variable region consisting of amino acid sequence with serial identification number: 128, and a light chain variable region consisting of amino acid sequence with serial identification number: 129; ii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 130, and a light chain variable region consisting of an amino acid sequence with serial identification number: 131; iii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 132, and a light chain variable region consisting of an amino acid sequence with serial identification number: 133; iv) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 134, and a light chain variable region consisting of an amino acid sequence with serial identification number: 135; v) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 136, and a light chain variable region consisting of an amino acid sequence with serial identification number: 137; vi) or a heavy-chain variable region consisting of amino acid sequence with serial identification number: 138, and a light-chain variable region consisting of amino acid sequence with serial identification number: 139; or vii) A heavy chain variable region consisting of amino acid sequence with serial identification number: 140, and a light chain variable region consisting of amino acid sequence with serial identification number: 141. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody or antigen-binding fragment consists of the following: i) A heavy chain consisting of an amino acid sequence with serial identification number: 118, and a light chain consisting of an amino acid sequence with serial identification number: 119; or a heavy chain consisting of an amino acid sequence with serial identification number: 120, and a light chain consisting of an amino acid sequence with serial identification number: 121; ii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 199, and a light chain variable region consisting of an amino acid sequence with serial identification number: 200; iii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 201, and a light chain variable region consisting of an amino acid sequence with serial identification number: 202; iv) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 203, and a light chain variable region consisting of an amino acid sequence with serial identification number: 204; v) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 205, and a light chain variable region consisting of an amino acid sequence with serial identification number: 206; vi) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 207, and a light chain variable region consisting of an amino acid sequence with serial identification number: 208; vii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 209, and a light chain variable region consisting of an amino acid sequence with serial identification number: 210; viii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 211; and a light chain variable region consisting of an amino acid sequence with serial identification number: 212;ix) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 213, and a light chain variable region consisting of an amino acid sequence with serial identification number: 214; ix) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 215, and a light chain variable region consisting of an amino acid sequence with serial identification number: 216; xi) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 217, and a light chain variable region consisting of an amino acid sequence with serial identification number: 218; xii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 219, and a light chain variable region consisting of an amino acid sequence with serial identification number: 220; (xiii) or a heavy-chain variable region consisting of amino acid sequence with serial identification number: 221; and a light-chain variable region consisting of amino acid sequence with serial identification number: 222; or xiv) A heavy chain variable region consisting of amino acid sequence with serial identification number: 223, and a light chain variable region consisting of amino acid sequence with serial identification number: 224. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody or antigen-binding fragment consists of the following: i) A heavy chain variable region consisting of amino acid sequence with serial identification number: 142, and a light chain variable region consisting of amino acid sequence with serial identification number: 143; ii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 144, and a light chain variable region consisting of an amino acid sequence with serial identification number: 145; iii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 146, and a light chain variable region consisting of an amino acid sequence with serial identification number: 147; iv) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 148, and a light chain variable region consisting of an amino acid sequence with serial identification number: 149; v) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 150, and a light chain variable region consisting of an amino acid sequence with serial identification number: 151; vi) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 152, and a light chain variable region consisting of an amino acid sequence with serial identification number: 153; vii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 154, and a light chain variable region consisting of an amino acid sequence with serial identification number: 155; viii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 156; and a light chain variable region consisting of an amino acid sequence with serial identification number: 157; ix) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 158, and a light chain variable region consisting of an amino acid sequence with serial identification number: 159; ix) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 160, and a light chain variable region consisting of an amino acid sequence with serial identification number: 161; xi) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 162, and a light chain variable region consisting of an amino acid sequence with serial identification number: 163; xii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 164, and a light chain variable region consisting of an amino acid sequence with serial identification number: 165; xiii) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 166; and a light chain variable region consisting of an amino acid sequence with serial identification number: 167; xiv) or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 170, and a light chain variable region consisting of an amino acid sequence with serial identification number: 171; xv) or a heavy-chain variable region consisting of amino acid sequence with serial identification number: 172, and a light-chain variable region consisting of amino acid sequence with serial identification number: 173; or xvi) A heavy chain variable region consisting of amino acid sequence with serial identification number: 186, and a light chain variable region consisting of amino acid sequence with serial identification number: 187. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody or antigen-binding fragment consists of the following: i) A heavy chain variable region consisting of an amino acid sequence with serial identification number: 108, and a light chain variable region consisting of an amino acid sequence with serial identification number: 109; ii) Or a heavy chain variable region consisting of an amino acid sequence with serial identification number: 110, and a light chain variable region consisting of an amino acid sequence with serial identification number: 111. On one hand, the current detection provides an antibody or antigen-binding fragment that binds to the α7β1 integrin, where the antibody or antigen-binding fragment consists of the following: i) A heavy chain consisting of an amino acid sequence with serial identification number: 112, and a light chain consisting of an amino acid sequence with serial identification number: 113; ii) Or a heavy chain consisting of an amino acid sequence with serial identification number: 114, and a light chain consisting of an amino acid sequence with serial identification number: 113; iii) Or a heavy chain consisting of amino acid sequence with serial identification number: 115, and a light chain consisting of amino acid sequence with serial identification number: 116; or iv) A heavy chain consisting of an amino acid sequence with serial identification number: 117, and a light chain consisting of an amino acid sequence with serial identification number: 116. In some applied models, the antibody or antigen-binding fragment has an affinity (Kd) for the α7β1 integrin or a fragment ranging from approximately 0.1 to 30 nM. In some applied models, the antibody or antigen-binding fragment has an affinity (Kd) for the α7β1 integrin or a fragment ranging from approximately 0.5 to 30 nM. In some applied models, the α7β1 integrin or a fragment consists of the α7β1 outer domain, the B1 outer domain, the α7 stem, the calf-1 domain, the calf-2 domain, or both the calf-1 and calf-2 domains. In some applied models, the α7β1 integrin or a fragment consists of the α7β1 outer domain. In some applied models, the α7β1 integrin or a fragment consists of the B1 outer domain. In some applied models, the α7β1 integrin or a fragment consists of the a7 stem. In some applied models, the α7β1 integrin, or part of it, consists of the calf-1 domain. In some applied models, the α7β1 integrin, or part of it, consists of the calf-2 domain. In some applied models, the α7β1 integrin, or part of it, consists of both the calf-1 and calf-2 domains. In some applied models, the α7β1 integrin consists of the human α7β1 integrin. In some applied models, the antibody or antigen-binding fragment has an affinity towards the human outer domain of α7β1 of approximately 3 to 6 nanomolar. In some experimental models, the antibody or antigen-binding fragment activates the α7β1 integrin at a maximum activity (Emax) of 100% to 300% compared to the 20TFT antibody. In some experimental models, the antibody or antigen-binding fragment activates the α7β1 integrin at a maximum activity (Emax) of 100% to 300% compared to the TS2 / 16 antibody. In some applied models, the EC50 value of the antibody or antigen-binding fragment is between 0.3 nM and 50 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment is approximately 0.3 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 0.3 nM and 1 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 0.3 nM and 5 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 0.3 nM and 10 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 1 nM and 5 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 1 nM and 10 nM. In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges between 5 nanomolar and 10 nanomolar.In some applied models, the EC50 value of the antibody or antigen-binding fragment ranges from 5 nM to 50 nM. In other applied models, the EC50 value of the antibody or antigen-binding fragment ranges from 10 nM to 50 nM. In some applied models, the antibody or antigen-binding fragment consists of Fab, single-chain Fv (scFv), monoclonal antibody (sdAb), VHH, one or more CDRs, variable heavy chain (VH), variable light chain (VL), bitype Fab-like antibody (bsFab), Fab bound to a monoclonal antibody (s-Fab), an antibody, or a combination thereof. In some applied models, the antibody or antigen-binding fragment consists of Fab. In some applied models, the antibody or antigen-binding fragment consists of single-chain Fv (scFv). In some applied models, the antibody or antigen-binding fragment consists of a monoclonal antibody (sdAb). In some applied models, the antibody or antigen-binding fragment consists of VHH. In some applied models, the antibody or antigen-binding fragment consists of one or more CDRs. In some applied models, the antibody or antigen-binding fragment consists of a variable heavy chain (VH). In other applied models, the antibody or antigen-binding fragment consists of a variable light chain (VL).In some applied models, the antibody or antigen-binding fragment consists of a bispecific antibody similar to a Fab (bsFab). In some applied models, the antibody or antigen-binding fragment consists of a Fab bound to a monovalent antibody (s-Fab). In some applied models, the antibody or antigen-binding fragment consists of an antibody. In some applied models, the antibody or antigen-binding fragment is a human-compatible antibody. In some applied models, the antibody or antigen-binding fragment is a human antibody. In some applied models, the antibody or antigen-binding fragment is a chimeric antibody. In some applied models, the antibody or antigen-binding fragment is derived from IgG. In some applied models, the antibody or antigen-binding fragment is derived from IgG1, IgG2, IgG3, or IgG4. In some applied models, the antibody or antigen-binding fragment is derived from IgG1. In some applied models, the antibody or antigen-binding fragment is derived from IgG2. In some applied models, the antibody or antigen-binding fragment is derived from IgG3. In some applied models, the antibody or antigen-binding fragment is derived from IgG4. In some applied models, the antibody or antigen-binding fragment consists of the Fc region. In some applied models, the Fc region contains one or more mutations. In some applied models, the current detection provides a method for treating a disease or disorder in a study participant with a defect in the α7β1 integrin. In some applied models, the method consists of giving the study participant an antibody or an antigen-binding fragment of the current detection. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of cardiomyopathy, congestive heart failure, muscular dystrophy, muscle atrophy, and loss of lean muscle mass due to activation of the GLP-1 or GIP / GLP-1 receptor in obese patients. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of cardiomyopathy. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of congestive heart failure. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of muscular dystrophy. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of muscle atrophy. In some applied models, the disease or disorder associated with α7β1 integrin dysfunction consists of muscle weakness. In some applied models, giving the antibody or antigen-binding fragment to the study participant leads to relief of one or more muscular dystrophy symptoms. In some clinical trials, administration leads to a reduction in one or more serum biomarkers of muscle fiber damage. In some clinical trials, one or more of these serum biomarkers consist of creatine kinase, LDH cytotoxin, and / or IL-6. In some clinical trials, the serum biomarker consists of creatine kinase. In some clinical trials, the serum biomarker consists of LDH cytotoxin. In some clinical trials, the serum biomarker consists of IL-6. In some clinical trials, administration reduces muscle damage, inflammation, fibrosis, necrosis, and / or atrophy. In some applied models, the antibody or antigen-binding fragment is delivered to a muscle cell. In some applied models, the muscle cell is composed of a mutation in the dystrophin gene. In some applied models, the muscle cell lacks dystrophin. In some applied models, the muscle cell is composed of non-functional dystrophin. In some applied models, muscular dystrophy consists of Duchenne muscular dystrophy, Becker muscular dystrophy, peripheral gingival muscular dystrophy, Fukuyama congenital muscular dystrophy (FCMD), or myrosinase-induced congenital muscular dystrophy type 1A (MDC1A). In some applied models, muscular dystrophy consists of Duchenne muscular dystrophy. In some applied models, muscular dystrophy consists of Becker muscular dystrophy. In some applied models, muscular dystrophy consists of peripheral gingival muscular dystrophy. In some applied models, muscular dystrophy consists of Fukuyama congenital muscular dystrophy. In some applied models, muscular dystrophy consists of myrosinase-induced congenital muscular dystrophy type 1A. In some applied models, muscle atrophy occurs due to aging, inactivity, nerve damage, or other underlying diseases, including chronic obstructive pulmonary disease, cancer-related muscle wasting, diabetes, kidney failure, and heart failure. In some applied models, a loss of lean muscle mass occurs in an obese patient treated with a glucagon-like peptide-1 receptor agonist. In some applied models, heart failure is caused by genetically inherited cardiomyopathies. In other applied models, heart failure is caused by ischemic heart disease. In some application models, the current discovery provides a pharmaceutical formulation consisting of an antibody or antigen-binding fragment and a pharmacologically acceptable carrier. In some application models, the antibody or antigen-binding fragment is administered by injection. In other application models, the antibody or antigen-binding fragment is administered orally. In some application models, the antibody or antigen-binding fragment is administered intravenously. In some application models, the antibody or antigen-binding fragment is administered intradermally. In some application models, the antibody or antigen-binding fragment is administered transdermally. In some application models, the antibody or antigen-binding fragment is administered intraocularly. In some application models, the antibody or antigen-binding fragment is administered nasally. In some application models, the antibody or antigen-binding fragment is administered intramuscularly. In some application models, the antibody or antigen-binding fragment is administered subcutaneously. In some application models, the antibody or antigen-binding fragment is administered via mucous membranes. In some applied models, the current detection provides a way to treat cardiomyopathy, congestive heart failure, or another heart muscle disorder by giving the antibody or antigen-binding fragment to a study participant. In one respect, the current discovery provides, among other things, a way to treat muscular dystrophy in a study participant who needs it, consisting of giving him a pharmaceutical formulation consisting of: an antibody that facilitates the extended open formation of integrin α7β1; and one or more physiologically acceptable carriers, excipients, or diluents. In one respect, the current discovery offers, among other things, a way to treat muscular dystrophy in a study participant who needs it. This treatment involves administering a therapeutic agent to increase α7 expression, as increased α7 expression leads to an improvement in one or more muscular dystrophy symptoms. In some applied models, the therapeutic agent consists of an antibody or an antigen-binding fragment of the current discovery. In one respect, the current discovery provides, among other things, a way to treat muscular dystrophy in a study participant who needs it, consisting of giving him a pharmaceutical formulation consisting of an antibody or antigen-binding fragment from the current discovery, the administration of which leads to an improvement in one or more of the symptoms of muscular dystrophy. In some applied models, the study participant has less muscle loss compared to a control when given the antibody or the antigen-binding fragment. In some clinical trials, participants experienced a less than 40% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 35% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 30% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 28% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 27% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 26% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment.In some clinical trials, participants experienced a less than 25% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 24% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 23% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 22% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 21% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 20% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment.In some clinical trials, participants experienced a less than 19% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 18% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 17% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 16% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 15% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 14% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment.In some clinical trials, participants experienced a less than 13% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 12% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 11% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 10% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 9% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 8% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment.In some clinical trials, participants experienced a less than 7% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 6% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 5% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 4% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 3% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment. In some clinical trials, participants experienced a less than 2% change in muscle weight compared to a control group after administration of the antibody or antigen-binding fragment.In some applied models, the study participant has a change in muscle weight of less than 1% compared to a control when given the antibody or the antigen-binding fragment. In some applied models, the control is a baseline value before giving the antibody or the part of it that binds to the antigens. In some applied models, the control is historical data. In some applied models, the control is a similar study participant who has not been given the antibody or the antigen-binding part of it. In one respect, the current discovery offers, among other things, a method for treating muscle atrophy in a study participant who requires it, consisting of administering a pharmaceutical formulation comprising: (a) an antibody that stabilizes extended integrin α7β1 constructs; and (b) one or more physiologically acceptable carriers. In some applied models, the antibody that stabilizes extended integrin α7β1 constructs consists of an antibody or an antigen-binding fragment from the current discovery. In one respect, the current discovery offers, among other things, a method for treating muscular dystrophy in a study participant who needs it, consisting of administering a pharmaceutical formulation comprising: (a) an antibody that increases α7 expression; and (b) one or more physiologically acceptable carriers. In some applied models, the antibody that increases α7 expression consists of an antibody or an antigen-binding fragment from the current discovery. Brief description of the drawings The drawings are provided for illustrative purposes only, not for the purpose of restriction. Figure 1a It shows the α7β1 integrin domains used to generate antibodies specific to the current detection. Figures 1B-1D This consists of a series of example graphs illustrating the binding affinity of example anti-α7β1 examples to various α7β1 domains, as determined by enzyme-linked immunosorbent assay (ELISA). Specifically, example antibodies Ab2, Ab8, and RefAb1 were tested for binding to the outer domain of α7β1, the stem domain, and the calf-1 domain. Figure 2 The results of the competitive enzyme-linked immunosorbent assay (ELISA) are presented as an example of the binding of Ab2 and RefAb1 to the human extracellular domain of α7β1. Figure 3 It is a series of incoming example graphs that illustrate the results of a competitive enzyme-linked immunosorbent assay (ELISA) to determine whether the incoming example human antibody against α7β1 has epitopes overlapping with Ab2, Ab8, or RefAb1. Figure 4 It shows the results of a competitive enzyme-linked immunosorbent assay (ELISA) to determine whether the incoming mouse antibody, as an example, against α7β1, has epitopes overlapping with Ab8 or RefAb1. Figure 5a It is a diagram provided as an example showing the closed curve configuration of integrin α7β1, which has a low binding affinity to laminin. Figure 5b It is a diagram presented as an example illustrating the extended-closed configuration of the α7β1 integrin, which has a low binding affinity to laminin, and how an example anti-α7β1 antibody from the current detection can bind to the α7β1 integrin to stabilize that configuration. Figure 5c It is a diagram presented as an example illustrating the extended-open configuration of the α7β integrin, which has a high binding affinity, and how an antibody presented as an example against α7β1 from the current detection can bind to the α7β1 integrin to stabilize that configuration. Figure 6 It is a crystalline structure illustrating the α7 stem and the different antibody epitopes identified in the current assay. Specifically, Ab8 binds to Calf-1, while Ab2 binds to a region within the Calf-2 domain that differs from the RefAb1 antibody epitope (20TFT). Figure 7 It consists of a series of electron microscope images of incoming antibodies, for example, anti-α7β1 bound to the α7β1 integrin, and their schematic representations. Figure 8A It is an illustrative crystal structure of the heavy chain Ab2 (in orange) and the light chain (in yellow) in a compound with calf-1 of α7 (in blue). Figure 8b It illustrates the biomolecular interactions within the Fab complex of Ab2-calf-1 for α7. The calf-1 protein is shown in blue, and with it, Ab2 HCDR1 (pink), HCDR2 (orange), HCDR3 (green), and LCDR1 (yellow). Figure 8c It shows the amino acid sequences of the α7 protein, with an explanation of the epitope residue. Figure 9 The figure shown is an example depicting a structural model of the α7β1 stem of α7, with the potential Ab2 antibody epitope depicted as spheres. The corresponding amino acid residues are identified by the serial number 180. The residues shown in purple (MAIPQQL, serial number 181; VVRGERAMQSERDVGSKVKYEVT, serial number 182; FDRAAVL, serial number 183) represent one potential epitope, while the residues shown in red (LRTLGSAFL, serial number 184; VVFSCPLYS, serial number 185) represent another potential epitope. The epitope residues were identified by hydrogen / deuterium exchange mass spectrometry. Figure 10 It is presented as an example illustrating the effect of activation conditions ( any Conditions that establish the open formation of integrin α7β1) on cell binding to incoming antibodies, as an example of anti-α7β1 from the current detection in human DMD myoblast cells. Figure 11 It is an example of an incoming form that illustrates the effect of activation conditions on cell binding to incoming mouse antibodies, for example, anti-α7β1 compared to RefAb1. Figure 12 It is a bar graph, for example, showing creatine kinase (CKM) levels, an indicator of muscle damage, after acute running on a treadmill in a mouse mdx model, with and without the use of an antibody, for example, against α7β1. Figure 13 It is an example of an incoming form that illustrates the CKM and LDH dose response when using the example incoming antibody against α7β1 Ab8. Figure 14 It illustrates the biological processes that were stimulated as a result of using an incoming antibody as an example of an antibody to α7β1. Figure 15 It illustrates the biological processes that were inhibited as a result of using an afferent antibody, for example, an antibody to α7β1. The two shapes 16a and 16b They are a series of incoming example graphs that show the increases in gene expression caused by the use of incoming example antibodies against α7β1. Figure 17 It is an example of an incoming figure showing the running scores and total running distance of B10.mdx mice after administration of the incoming example anti-α7β1 antibodies. Figure 18 It is an example afferent shape showing the distance traveled, rest time, and number of times the horizontal beam was cut for MDX mice that were given an example afferent antibody against α7β1. Figure 19A يكون عبارة عن شكل وارد كمثال يوضح التتانوس النوعي في العضلة الباسطة للأصابع الطويلة لفئران MDX المعالجة بجسم مضاد وارد كمثال لـ α7β1 وضوابط. Figure 19b يوضح التتانوس النوعي في الحجاب الحاجز لفئران MDX المعالجة بجسم مضاد وارد كمثال لـ α7β1 وضوابط. Figure 20 It is an example of an incoming form showing the results of tracking body weight in MDX mice with or without an incoming antibody given as an example anti-α7β1. Figure 21 It is an example of a figure showing the muscle fiber size of MDX mice with and without treatment with an example anti-α7β1 antibody. Figure 22A It is a series of incoming example graphs showing the results of qPCR to track fibrosis markers in MDX mice after they have been given an incoming example antibody against α7β1. Figure 22b The images provided serve as examples of immunohistochemistry for collagen 1 / III in mice treated with phosphate-buffered saline (PBS) or Ab8, as well as quantitative positive space for collagen 1 / III. A decrease in collagen indicates a reduction in scar tissue and fibrosis, a visible difference that can be observed in the histological images. Figure 23 It is a diagram included as an example of a study design to evaluate the reduction of muscle atrophy by administering an antibody included as an example anti-α7β1. Figure 24 This is a series of example graphs illustrating the weight of the gastroc muscle after administration of an example anti-α7β1 antibody to C57BL / 6j mice in VIM. The atrophy caused by disuse due to VIM results in a loss of Gastroc muscle weight, both in absolute terms and relative to body weight. Figure 25 It is a series of example incoming graphs that illustrate the expression of α7 after administration of an example incoming antibody against α7β1 to C57BL / 6j mice in VIM, compared to a mobile control. Definitions To facilitate understanding of the present invention, some terms are defined below. Further definitions of the following and other terms are provided within the specifications. The terms "alleviation" and "improvement" refer to a process by which the severity of a sign or symptom of a disorder decreases. It is important to note that the sign or symptom can be alleviated without being eliminated. Therapeutically effective doses are expected to reduce the severity of a disease sign or symptom, thereby alleviating and improving it. As used in this document, the term "affinity" refers to the binding interaction properties between a binding molecule (e.g., the α7β1 antibody) and a target (e.g., α7β1), indicating the strength of the binding interaction. In some applied models, the affinity is expressed as the dissociation constant (KD). As used in this document, the term "antibody" refers to a polypeptide containing at least one immunoglobulin variant region, for example, an amino acid sequence providing an immunoglobulin variant domain or an immunoglobulin variant domain sequence. For example, an antibody may contain one heavy-chain variant (H) region (abbreviated in this document as VH) and one light-chain variant (L) region (abbreviated in this document as VL). In another example, an antibody may contain two heavy-chain variants (H) and two light-chain variants (L). An antibody typically contains three complement mapping regions (CDRs) in the immunoglobulin light chain and three complement mapping regions (CDRs) in the immunoglobulin heavy chain. The three CDR regions in the immunoglobulin light chain, starting from the N-terminus, are called CDR1, CDR2, and CDR3, respectively. The three CDR regions in the immunoglobulin heavy chain, starting from the N end, are called CDR1, CDR2, and CDR3, respectively.The term "CDR" may be defined according to the Kabat and / or Chothia definitions, the combined definitions of Kabat and Chothia, AbM, contact, and / or concordance definitions, or according to any other well-established method of defining CDR in the field. The term "antibody" includes the antigen-binding components of antibodies (e.g., monochain antibodies, Fab, F(ab')2, Fd, Fv, and dAb fragments), as well as whole antibodies, such as intact immunoglobulins of the IgA, IgG, IgE, IgD, and IgM types (and their subtypes). The light chains of immunoglobulins may be kappa or lambda-type. As used in this document, the term "M38 antibody" refers to a mouse antibody against α7β1 that binds to S977, W978, W979, and P980 on the α7 integrin, as described in WO2022240833A1, which is included in this document for reference. In the current application, "M38" is used interchangeably with "RefAb2". As used in this document, the term "antibody 20TFT" refers to an anti-α7β1 antibody that binds to S977, W978, W979, and P980 on the α7 integrin, as described in WO 2021 / 097338 A1, which is included in this document for reference. Antibody 20TFT is a humanized antibody of M38. In the present application, "20TFT" is used interchangeably with "RefAb1". As used in this document, "EC50" refers to the median maximum effective concentration. EC50 denotes the concentration of a drug, antibody, or toxin that produces a response midway between the baseline and maximum values ​​after a specified exposure period. In simpler terms, EC50 can be defined as the concentration required to achieve 50% of the desired effect. As used in this document, the term "Fab" refers to an antibody fragment consisting of a part of an intact antibody, and consisting of the antigen-binding region or the altered region thereof. As used in this document, the term "Fc region" refers to the C-terminal region of the immunoglobulin heavy chain that includes at least one portion of the constant region. This term encompasses both native-sequence Fc regions and variable Fc regions. In one applied model, the Fc region of human IgG heavy chain extends from Cys226, or Pro230, to the carboxyl end of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise stated in this document, the numbering of amino acid residues in the Fc region or the constant region is in accordance with the European Union numbering system, also called the EU index, as described in Kabat et al., *Sequences of Proteins of Immunological Interest*, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD, 1991. As used in this document, the term "EC50" refers to the concentration required to inhibit half of the maximal biological response to ligand binding, and can be determined by a cell adhesion assay (CAA) or a solid-phase assay (SP). As used in this document, the term "similarity" refers to the relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as known in the field, by comparing the sequences of these molecules. The relationship is determined by performing the comparison. In the field, "similarity" also refers to the degree of sequence relatedness between nucleic acid or polypeptide molecules, and in some cases, between more than one nucleotide sequence or more than one amino acid sequence. It can be determined by matching the amino acid sequences. The term "similarity" also means measuring the percentage of similarity between two or more sequences by an alignment that includes gaps (if any), according to a specific mathematical model or computer program (i.e., an "algorithm"). As used in this document, the term “in vitro” refers to events that occur in an artificial environment, for example, in a test tube or reaction vessel, or in a cell culture, and so forth, rather than occurring within a multicellular organism. As used in this document, the term "in vivo" refers to events occurring within a multicellular organism, such as a human or non-human animal. In the context of cell-based systems, the term can be used to refer to events occurring within a living cell (as opposed to, for example, systems within a laboratory). The terms "integrin activator" and "α7β1 integrin activator" refer to a molecule that can bind to α7β1 integrin in a way that increases one or more of the activities associated with integrin. For example, and without limitation, an α7β1 integrin activator may increase the binding of α7β1 integrin to laminin. In some applied models, an α7β1 integrin activator is an antibody against α7β1. As used in this document, the terms “treat,” “treat,” and “cure” refer to any method used to alleviate, improve, eliminate, inhibit, prevent, delay the onset, reduce the severity, and / or decrease the occurrence of one or more symptoms or features of a particular disease, disorder, and / or condition, in whole or in part. Treatment may be given to a study participant who does not show signs of disease and / or only shows early signs of disease, with the aim of reducing the risk of disease-related morbidity. Detailed description of the invention The current finding provides, among other things, antibodies to integrin α7β1 and therapeutic applications for these antibodies in the effective treatment of diseases or disorders associated with dystrophin loss, such as Duchenne muscular dystrophy. As described in this document, the current finding is based, in part, on the identification of antibodies to integrin α7β1 that are effective in stabilizing integrin α7β1 in an extended-closed or extended-open configuration. Consequently, the anti-α7β1 antibodies identified in the current finding effectively increase muscle fiber adhesion to the extracellular matrix, restoring some or all of the muscle adhesion lost due to the absence of functional dystrophin, and ultimately leading to improved mobility, increased muscle strength, and reduced fibrosis in patients with dystrophin disorders. Integrin α 7 β 1 The dystrophin-glycoprotein complex maintains the integrity of skeletal muscle by binding laminin in the extracellular matrix to the actin cytoskeleton. Several types of human muscular dystrophy arise from defects in components of this complex. Integrin α7β1 also binds to laminin and links the extracellular matrix to the cytoskeleton. The integrin α7β1 complex plays a clear role in the development of striated and smooth muscle. Integrin α7β1 promotes myoblast adhesion and motility and is likely important in the recruitment of muscle precursors during muscle differentiation. The dystrophin-associated protein complex (DAPC) and integrin α7β1 maintain the integrity of the muscle sheath. The repeated contraction and relaxation of the sarcomere requires the efficient management of mechanical stress by the muscle sheath. Disruption of DAPC or α7β1 binding leads to impaired cell membrane-to-extracellular matrix (ECM) bonding, resulting in membrane damage due to force overload. Furthermore, a loss-of-function (LOF) mutation in dystrophin causes Duchenne muscular dystrophy (DMD), while a loss-of-function (LOF) mutation in integrin ITGA7 (The gene encoding integrin α7β1) to congenital muscular dystrophy. Integrin structure α 7 β 1 and its composition The structure and configuration of an integrin are fundamental to every aspect of its function, from adhesion to signaling. α7β1 integrins can adopt a range of configurational structures, starting with a curved-closed configuration ( Figure 5a ) and the extended-closed structure, both of which are inactive and have a low affinity for the two amino acids ( Figure 5b ), leading to the extended-open configuration ( Figure 5c It is active and has a high affinity for amines. The α7 subunit contains the β-propeller, femoral, Calf-1, and Calf-2 domains, as shown in [reference / information missing]. Figure 5c . The current detection provides, among other things, antibodies that bind to α7β1 integrin in an extended-open or extended-closed configuration, enhancing the binding of α7β1 integrin to laminin. In some applied models, the anti-α7β1 antibody binds to α7β1 integrin in an extended-closed configuration. In some applied models, the anti-α7β1 antibody binds to α7β1 integrin in an extended-open configuration. In some applied models, the anti-α7β1 antibody preserves α7β1 integrin in an extended-closed configuration. In some applied models, the anti-α7β1 antibody preserves α7β1 integrin in an extended-open configuration. The outer domain of human α7 integrin can be found in the X1 or X2 isoform. In some applied models, the outer domain of human α7 integrin has the following amino acid sequence (the signaling peptide is underlined): Serial identification number: 122 a7 ) In some applied models, the outer domain of human α7 integrin has the following amino acid sequence: Serial ID number: 123, External domain ITGA7 X2 ) In some applied models, the outer domain of human α7 integrin has the following amino acid sequence: Serial ID number: 124, External domain ITGA7 X1 ) The human α7 integrin stem has the following amino acid sequence: QGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELELEVELLLATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYLDPMAVVAE ( Serial identification number: 125, a7leg ) The Calf-1 domain of human α7 integrin has the following amino acid sequence: QSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELELEVELLLATISEQELHPVSARARVFIE ( Serial identification number: 126, calf1 ) The Calf-2 domain of human α7 integrin has the following amino acid sequence: LPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYLDPMAVVAE ( Serial identification number: 127, calf2 ) Integrin antibodies α 7 β 1 The current assay provides, among other things, an antibody or antigen-binding fragment that binds to α7β1 integrin in an extended-open or extended-closed configuration, thereby maintaining the high affinity of α7β1 integrin for laminin. Furthermore, the anti-α7β1 antibodies presented in the current assay are effective in promoting muscle cell adhesion to laminin. In some experimental models, an anti-α7β1 antibody activates α7β1 integrin. In some experimental models, an anti-α7β1 antibody inhibits the formation of active α7β1 integrin. In some experimental models, an anti-α7β1 antibody increases the expression of ITGA7 and / or integrin α7β1 activity. In some applied models, an anti-integrin α7β1 antibody increases integrin α7β1 activity. The integrin α7β1 contains multiple domains as shown in Figure 1a and Figure 5c In some applied models, an anti-integrin α7β1 antibody binds to the α7 stem. In some applied models, an anti-integrin α7β1 antibody binds to the laminin-binding domain. In some applied models, an anti-integrin α7β1 antibody binds to the Calf-1 and / or Calf-2 domains of integrin α7β1. In some applied models, an anti-integrin α7β1 antibody binds to the Calf-1 domain of integrin α7β1. In some applied models, an anti-integrin α7β1 antibody binds to the Calf-2 domain of integrin α7β1. Hatimah The current discovery is based, in part, on the identification of a novel epitope for integrin α7. Antibodies against α7β1 that bind to the epitope described herein are able to effectively stabilize the extended configuration of integrin α7β1, such that integrin α7β1 binds to laminin with high affinity and remains in its active form. Therefore, the anti-integrin α7β1 agonist antibodies described in the current discovery are effective in treating dystrophin-related diseases, such as Duchenne muscular dystrophy (DMD). In some applied models, an anti-α7β1 antibody binds to the Calf-2 domain of α7β1 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 856-862, 867-889, 1011-1017, 897-905, or 1002-1010 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 856-862 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 867-889 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 1011-1017 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 897-905 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 1002-1010 of α7 integrin.In some applied models, an anti-α7β1 integrin antibody binds to an epitope composed of the amino acids M856, A857, I858, P859, Q860, Q861, L862, V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, T889, L897, and / or R898 and / or T899 and / or L900 and / or G901 and / or S902 and / or A903 and / or F904 and / or L905 and / or V1002 and / or V1003 and / or F1004 and / or S1005 and / or C1006 and / or P1007 and / or L1008 and / or Y1009 and / or S1010 and / or F1011 and / or D1012 and / or R1013 and / or A1014 and / or A1015 and / or V1016 and / or L1017. In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids M856, A857, I858, P859, Q860, Q861, and / or L862.In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, and T889. In some applied models, an anti-integrin α7β1 antibody binds to an epitope composed of amino acids L897, R898, T899, L900, G901, S902, A903, F904, and / or L905. In some applied models, an anti-integrin α7β1 antibody binds to an epitope composed of amino acids V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, and / or S1010. In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids F1011 and / or D1012 and / or R1013 and / or A1014 and / or A1015 and / or V1016 and / or L1017. In some applied models, an anti-α7β1 integrin antibody binds to the Calf-2 domain of α7β1 integrin but does not compete with the 20TFT antibody. In other applied models, an anti-α7β1 integrin antibody binds to the Calf-2 domain of α7β1 integrin but does not bind to an epitope composed of the amino acids S977, W978, W979, and P980. In some applied models, an anti-α7β1 antibody binds to the Calf-1 domain of α7β1 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 771-778 or 793-805 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 771-778 of α7 integrin. In some applied models, an anti-α7β1 antibody binds to a region consisting of positions 793-805 of α7 integrin. In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, N796, P797, M798, K799, R800, G801, A802, Q803, V804, and T805. In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids R771 and / or A772 and / or L773 and / or D774 and / or A776 and / or E777 and / or K778 and / or E793 and / or N796 and / or K799 and / or Q803 and / or T805.In some applied models, an anti-integrin α7β1 antibody binds to an epitope consisting of the amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and T805. human anti-integrin antibodies α 7 β 1 In some applied models, the antibody against integrin α7β1 or its antigen-binding component consists of at least one, two, or three complement mapping regions (CDRs) of a variable heavy chain region with an amino acid sequence as described in Table A or a sequence highly homologous to it (e.g., a sequence homologous to it by approximately 85%, 90%, 95%, or at least 99%, and / or containing one or more substitutions, e.g., conservative substitutions). In some applied models, the antibody to integrin α7β1 or its antigen-binding fragment consists of at least one, two, or three complement mapping regions (CDRs) of a variable light-chain region with an amino acid sequence as described in [reference]. Table A or a sequence highly homologous to it (e.g., a sequence homologous to it by at least 85%, 90%, 95%, or 99%, and / or containing one or more substitutions, e.g., conservative substitutions). In one applied model, the antibody to integrin α7β1 or its antigen-binding fragment consists of at least one, two, three, four, five, or six complement mapping regions (CDRs) of the heavy and light chain variants with an amino acid sequence as described in Table A or a sequence that is highly homologous to it (for example, a sequence that is at least approximately 85%, 90%, 95% or 99% homologous to it, and / or contains one or more substitutions, for example, conservative substitutions). In some applied models, the antibody or its antigen-binding component is a human antibody against α7β1. In other applied models, the antibody or its antigen-binding component consists of selected complement mapping regions (CDRs) of Table A Unless otherwise stated, the complement mapping regions (CDRs) sequences described in the present application follow the IMGT numbering system. Table A. Areas for assigning complements ( CDRs The examples given are human antibodies against [antibody type]. α 7 β 1 . antibody HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Ab1 GYTFTGYY (Serial Identification Number: 1, HCDR1A) INPNSGGT (Serial Identification Number: 15, HCDR2A) AREGANWDYYYYGMDV (Serial Identification Number: 31, HCDR3A) SSNIGSKT (Serial ID number: 46, LCDR1A) SNN (Serial ID number: 58, LCDR2A) AAWDDSLNGPV (Serial ID Number: 69, LCDR3A) Ab2 GFTFSSYT (Serial Identification Number: 2, HCDR1B) ISIVGNYI (Serial Identification Number: 16, HCDR2B) ARRKWEHDAFDI (Serial Identification Number: 32, HCDR3B) SLRSYY (Serial ID number: 47, LCDR1B) GKN (Serial Identification Number: 59, LCDR2B) TSRDNSGNHVV (Serial ID Number: 70, LCDR3B) Ab3 GFTFSSYS (Serial Identification Number: 3, HCDR1C) ISTSSSYI (Serial Identification Number: 17, HCDR2C) ARRAWESDAFAI (Serial Identification Number: 33, HCDR3C) SLRSYY (Serial ID number: 47, LCDR1B) GKN (Serial Identification Number: 59, LCDR2B) NSRDSSGNHVV (Serial Identification Number: 71, LCDR3C) Ab4 GFTFSSYA (Serial Identification Number: 4, HCDR1D) ISDSGGIA (Serial Identification Number: 18, HCDR2D) VRDGY (Serial Identification Number: 34, HCDR3D) QSLLDSDDGYTY (Serial ID number: 48, LCDR1C) TLS (Serial Identification Number: 60, LCDR2C) MQRIEFPLT (Serial ID number: 72, LCDR3D) Ab5 GFTFSSYA (Serial Identification Number: 4, HCDR1D) IHYSGGTT (Serial Identification Number: 19, HCDR2E) VKDGY (Serial Identification Number: 35, HCDR3E) QSLLDSDDGYTY (Serial ID: 48, LCDR1C) TLS (Serial Identification Number: 60, LCDR2C) MQRIEFPLT (Serial ID number: 72, LCDR3D) Ab6 GFTFSRFW (Serial Identification Number: 5, HCDR1E) TKQDGSEK (Serial Identification Number: 20, HCDR2F) AREGSGAYWAFDI (Serial Identification Number: 36, HCDR3F) QSLVHNDGNTY (Serial ID number: 49, LCDR1D) KIS (Serial ID Number: 61, LCDR2D) LQATQFPLT (Serial Identification Number: 73, LCDR3E) Ab7 GGSISSYY (Serial Identification Number: 6, HCDR1F) IYTRGST (Serial Identification Number: 21, HCDR2G) ARVFGGNYRFDAFHI (Serial Identification Number: 37, HCDR3G) SSNIGAGYD (Serial ID number: 50, LCDR1E) GNN (Serial Identification Number: 62, LCDR2E) QSYDSSLSGYV (Serial Identification Number: 74, LCDR3F) In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 1 (HCDR1A), HCDR2 with serial identification number 15 (HCDR2A), and HCDR3 with serial identification number 31 (HCDR3A). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 46 (LCDR1A), LCDR2 with serial identification number 58 (LCDR2A), and LCDR3 with serial identification number 69 (LCDR3A). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 1 (HCDR1A), HCDR2 with serial identification number: 15 (HCDR2A), HCDR3 with serial identification number: 31 (HCDR3A), LCDR1 with serial identification number: 46 (LCDR1A), LCDR2 with serial identification number: 58 (LCDR2A), and LCDR3 with serial identification number: 69 (LCDR3A). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 1 (HCDR1A), HCDR2 with serial identification number: 15 (HCDR2A), HCDR3 with serial identification number: 31 (HCDR3A), LCDR1 with serial identification number: 46 (LCDR1A), LCDR2 with serial identification number: 58 (LCDR2A), and LCDR3 with serial identification number: 69 (LCDR3A). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 (serial identification number: HCDR1B), HCDR2 (serial identification number: 16, HCDR2B), and HCDR3 (serial identification number: 32, HCDR3B). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 (serial identification number: 47, LCDR1B), LCDR2 (serial identification number: 59, LCDR2B), and LCDR3 (serial identification number: 70, LCDR3B). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: HCDR1B, HCDR2 with serial identification number: 16 (HCDR2B), HCDR3 with serial identification number: 32 (HCDR3B), LCDR1 with serial identification number: 47 (LCDR1B), LCDR2 with serial identification number: 59 (LCDR2B), and LCDR3 with serial identification number: 70 (LCDR3B). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: HCDR1B, HCDR2 with serial identification number: 16 (HCDR2B), HCDR3 with serial identification number: 32 (HCDR3B), LCDR1 with serial identification number: 47 (LCDR1B), LCDR2 with serial identification number: 59 (LCDR2B), and LCDR3 with serial identification number: 70 (LCDR3B). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 3 (HCDR1C), HCDR2 with serial identification number 17 (HCDR2C), and HCDR3 with serial identification number 33 (HCDR3C). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 47 (LCDR1B), LCDR2 with serial identification number 59 (LCDR2B), and LCDR3 with serial identification number 71 (LCDR3C). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 3 (HCDR1C), HCDR2 with serial identification number: 17 (HCDR2C), HCDR3 with serial identification number: 33 (HCDR3C), LCDR1 with serial identification number: 47 (LCDR1B), LCDR2 with serial identification number: 59 (LCDR2B), and LCDR3 with serial identification number: 71 (LCDR3C). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 3 (HCDR1C), HCDR2 with serial identification number: 17 (HCDR2C), HCDR3 with serial identification number: 33 (HCDR3C), LCDR1 with serial identification number: 47 (LCDR1B), LCDR2 with serial identification number: 59 (LCDR2B), and LCDR3 with serial identification number: 71 (LCDR3C). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 4 (HCDR1D), HCDR2 with serial identification number 18 (HCDR2D), and HCDR3 with serial identification number 34 (HCDR3D). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 48 (LCDR1C), LCDR2 with serial identification number 60 (LCDR2C), and LCDR3 with serial identification number 72 (LCDR3D). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 4 (HCDR1D), HCDR2 with serial identification number: 18 (HCDR2D), HCDR3 with serial identification number: 34 (HCDR3D), LCDR1 with serial identification number: 48 (LCDR1C), LCDR2 with serial identification number: 60 (LCDR2C), and LCDR3 with serial identification number: 72 (LCDR3D). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 4 (HCDR1D), HCDR2 with serial identification number: 18 (HCDR2D), HCDR3 with serial identification number: 34 (HCDR3D), LCDR1 with serial identification number: 48 (LCDR1C), LCDR2 with serial identification number: 60 (LCDR2C), and LCDR3 with serial identification number: 72 (LCDR3D). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 4 (HCDR1D), HCDR2 with serial identification number 19 (HCDR2E), and HCDR3 with serial identification number 35 (HCDR3E). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 48 (LCDR1C), LCDR2 with serial identification number 60 (LCDR2C), and LCDR3 with serial identification number 72 (LCDR3D). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 4 (HCDR1D), HCDR2 with serial identification number: 19 (HCDR2E), HCDR3 with serial identification number: 35 (HCDR3E), LCDR1 with serial identification number: 48 (LCDR1C), LCDR2 with serial identification number: 60 (LCDR2C), and LCDR3 with serial identification number: 72 (LCDR3D). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 4 (HCDR1D), HCDR2 with serial identification number: 19 (HCDR2E), HCDR3 with serial identification number: 35 (HCDR3E), LCDR1 with serial identification number: 48 (LCDR1C), LCDR2 with serial identification number: 60 (LCDR2C), and LCDR3 with serial identification number: 72 (LCDR3D). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 5 (HCDR1E), HCDR2 with serial identification number 20 (HCDR2F), and HCDR3 with serial identification number 36 (HCDR3F). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 49 (LCDR1D), LCDR2 with serial identification number 61 (LCDR2D), and LCDR3 with serial identification number 73 (LCDR3E). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 5 (HCDR1E), HCDR2 with serial identification number: 20 (HCDR2F), HCDR3 with serial identification number: 36 (HCDR3F), LCDR1 with serial identification number: 49 (LCDR1D), LCDR2 with serial identification number: 61 (LCDR2D), and LCDR3 with serial identification number: 73 (LCDR3E). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 5 (HCDR1E), HCDR2 with serial identification number: 20 (HCDR2F), HCDR3 with serial identification number: 36 (HCDR3F), LCDR1 with serial identification number: 49 (LCDR1D), LCDR2 with serial identification number: 61 (LCDR2D), and LCDR3 with serial identification number: 73 (LCDR3E). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 6 (HCDR1F), HCDR2 with serial identification number 21 (HCDR2G), and HCDR3 with serial identification number 37 (HCDR3G). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 50 (LCDR1E), LCDR2 with serial identification number 62 (LCDR2E), and LCDR3 with serial identification number 74 (LCDR3F). In some applied models, the antibody or the antigen-binding part thereof consists of HCDR1 with serial identification number: 6 (HCDR1F), HCDR2 with serial identification number: 21 (HCDR2G), HCDR3 with serial identification number: 37 (HCDR3G), LCDR1 with serial identification number: 50 (LCDR1E), LCDR2 with serial identification number: 62 (LCDR2E), and LCDR3 with serial identification number: 74 (LCDR3F).In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 6, HCDR2 with serial identification number: 21 (HCDR2G), HCDR3 with serial identification number: 37 (HCDR3G), LCDR1 with serial identification number: 50 (LCDR1E), LCDR2 with serial identification number: 62 (LCDR2E), and LCDR3 with serial identification number: 74 (LCDR3F). In some applied models, the antibody against integrin α7β1 or its antigen-binding fragment consists of complement-coding regions (CDRs) that differ in one or more amino acids from the CDRs shown in Table A In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 5 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table A In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 4 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table A In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 3 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table A In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than two amino acids from any of the complement-coding regions (CDRs) shown in Table A In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than one amino acid from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table A. In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from GYTFTGYY (serial identification number: 1, HCDR1A), HCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from INPNSGGT (serial identification number: 15, HCDR2A), HCDR3 consisting of an amino acid sequence that differs by no more than four amino acids from AREGANWDYYYYGMDV (serial identification number: 31, HCDR3A), LCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from SSNIGSKT (serial identification number: 46, LCDR1A), and LCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from SNN (serial identification number: 58, LCDR2A). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from AAWDDSLNGPV (serial identification number: 69, LCDR3A). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSYT (serial identification number: 2, HCDR1B); HCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from ISIVGNYI (serial identification number: 16, HCDR2B); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARRKWEHDAFDI (serial identification number: 32, HCDR3B); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from SLRSYY (serial identification number: 47, LCDR1B); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from GKN (serial identification number: 59, LCDR2B). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from TSRDNSGNHVV (serial identification number: 70, LCDR3B). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSYS (serial ID: 3, HCDR1C); HCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from ISTSSSYI (serial ID: 17, HCDR2C); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARRAWESDAFAI (serial ID: 33, HCDR3C); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from SLRSYY (serial ID: 47, LCDR1B); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from GKN (serial ID: 59, LCDR2B). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from NSRDSSGNHVV (serial identification number: 71, LCDR3C). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSSYA (serial ID: 4, HCDR1D); HCDR2, which has an amino acid sequence differing by no more than one amino acid from ISDSGGIA (serial ID: 18, HCDR2D); HCDR3, which has an amino acid sequence differing by no more than four amino acids from VRDGY (serial ID: 34, HCDR3D); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSLLDSDD (serial ID: 48, LCDR1C); LCDR2, which has an amino acid sequence differing by no more than one amino acid from TLS (serial ID: 60, LCDR2C); and LCDR3, which has a sequence... An amino acid that differs by no more than 4 amino acids from MQRIEFPLT (Serial Identification Number: 72, LCDR3D). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSYA (serial identification number: 4, HCDR1D); HCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from IHYSGGTT (serial identification number: 19, HCDR2E); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from VKDGY (serial identification number: 35, HCDR3E); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from QSLLDSDDGYTY (serial identification number: 48, LCDR1C); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from TLS (serial identification number: 60, LCDR2C). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from MQRIEFPLT (serial identification number: 72, LCDR3D). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSRFW (serial ID: 5, HCDR1E); HCDR2, which has an amino acid sequence differing by no more than one amino acid from TKQDGSEK (serial ID: 20, HCDR2F); HCDR3, which has an amino acid sequence differing by no more than four amino acids from AREGSGAYWAFDI (serial ID: 36, HCDR3F); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSLVHNDGNTY (serial ID: 49, LCDR1D); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from KIS (serial ID: 61). LCDR2D), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from LQATQFPLT (serial identification number: 73, LCDR3E). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GGSISSYY (serial ID: 6, HCDR1F); HCDR2, which has an amino acid sequence differing by no more than one amino acid from IYTRGST (serial ID: 21, HCDR2G); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARVFGGNYRFDAFHI (serial ID: 37, HCDR3G); LCDR1, which has an amino acid sequence differing by no more than two amino acids from SSNIGAGYD (serial ID: 50, LCDR1E); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from GNN (serial ID: 62). LCDR2E), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from QSYDSSLSGYV (serial identification number: 74, LCDR3F). Table B. Sequences VH and VL Listed as an example of human anti-integrin antibodies α 7 β 1 . antibody sequence VH sequence VL Ab1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREGANWDYYYYGMDVWGQGTTVTVSS (الرقم التعريفي التسلسلي: 128، VH1) QSVLTQPPSASGTPGQRVTISCSGSSSNIGSKTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGPVFGGGTKLTVL (الرقم التعريفي التسلسلي: 129، VL1) Ab2 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMNWVRQAPGKGLEWVSSISIVGNYIYYADSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRKWEHDAFDIWGQGTMVTVSS (الرقم التعريفي التسلسلي: 130، VH2) SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADFYCTSRDNSGNHVVFGGGTKLTVL (الرقم التعريفي التسلسلي: 131، VL2) Ab3 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISTSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRAWESDAFAIWGQGTMVTVSS (الرقم التعريفي التسلسلي132، VH3) SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL (الرقم التعريفي التسلسلي133، VL3) Ab4 EVQLLESGGGLEQPGGSLRLSCAASGFTFSSYAMNWVRQGLGKGLEWVSAISDSGGIAYYADSVKGRFTISRDNSKNTLYLQMDSLRGEDTAVYYCVRDGYWGQGTLVTVSS (الرقم التعريفي التسلسلي134، VH4) DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFSLKISRVEAEDAGIYYCMQRIEFPLTFGGGTKVEIK (الرقم التعريفي التسلسلي: 135، VL4) Ab5 EVQLLESGGGLVQPGGSLRLSCVASGFTFSSYAMTWVRQAPGKGLEWVSAIHYSGGTTNYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCVKDGYWGQGTLVTVSS (الرقم التعريفي التسلسلي: 136، VH5) DIMMTQTPLSLPVSPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFPLTFGGGTKVEIK (الرقم التعريفي التسلسلي: 137، VL5) Ab6 EVQLVESGGGLVQPGGSLRLSCAASGFTFSRFWMSWVRQAPGKGLEWVANTKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRADDTAVYYCAREGSGAYWAFDIWGQGTMVTVSS (الرقم التعريفي التسلسلي: 138، VH6) DIVMTQTPLSSPVTLGQPASISCRSSQSLVHNDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQATQFPLTFGGGTKVEIK (الرقم التعريفي التسلسلي: 139، VL6) Ab7 QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPAGKGLEWIGRIYTRGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARVFGGNYRFDAFHIWSQGTMVTVSS (Serial ID: 140, VH7) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL (Serial ID: 141, VL7) In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 128 (VH1).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 128 (VH1).In some applied models, the α7β1 antibody or its antigen-binding component consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 antibody or its antigen-binding component consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the α7β1 antibody or its antigen-binding component consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 128 (VH1). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 128 (VH1).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 128 (VH1). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 130 (VH2).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 130 (VH2).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 130 (VH2). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 130 (VH2).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 130 (VH2). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 132 (VH3).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 132 (VH3).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 132 (VH3). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 132 (VH3).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 132 (VH3). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 134 (VH4).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 134 (VH4).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 134 (VH4). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 134 (VH4).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 134 (VH4). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 136 (VH5).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 136 (VH5).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 136 (VH5). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 136 (VH5).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 136 (VH5). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 138 (VH6).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 138 (VH6).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 138 (VH6). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 138 (VH6).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 138 (VH6). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 140 (VH7).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 140 (VH7).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 140 (VH7). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of at least 99% homologous amino acid sequence with the serial identification number: 140 (VH7).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 140 (VH7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 129 (VL1).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 129 (VL1).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 129 (VL1). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 129 (VL1).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 129 (VL1). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 131 (VL2).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 94% homologous with the serial identification number: 131 (VL2).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 131 (VL2). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 131 (VL2).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 131 (VL2). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 133 (VL3).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 94% homologous amino acids with the serial identification number: 133 (VL3).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 133 (VL3). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 133 (VL3).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 133 (VL3). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 135 (VL4).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 94% homologous amino acids with the serial identification number: 135 (VL4).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 135 (VL4). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 135 (VL4).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 135 (VL4). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 137 (VL5).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 94% homologous amino acids with the serial identification number: 137 (VL5).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 137 (VL5). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 137 (VL5).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 137 (VL5). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 139 (VL6).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 94% homologous amino acids with the serial identification number: 139 (VL6).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 139 (VL6). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 139 (VL6).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 139 (VL6). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 141 (VL7).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 92% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 93% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 94% homologous amino acids with the serial identification number: 141 (VL7).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 97% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 141 (VL7). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 141 (VL7).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 141 (VL7). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 128 (VH1), and a light chain variable region consisting of an amino acid sequence with serial identification number: 129 (VL1). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 130 (VH2), and a light chain variable region consisting of an amino acid sequence with serial identification number: VL2. In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 132 (VH3), and a light chain variable region consisting of an amino acid sequence with serial identification number: 133 (VL3). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy-chain variable region consisting of an amino acid sequence with serial identification number: 134 (VH4), and a light-chain variable region consisting of an amino acid sequence with serial identification number: 135 (VL4). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 136 (VH5), and a light chain variable region consisting of an amino acid sequence with serial identification number: 137 (VL5). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 138 (VH6), and a light chain variable region consisting of an amino acid sequence with serial identification number: 139 (VL6). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 140 (VH7), and a light chain variable region consisting of an amino acid sequence with serial identification number: 141 (VL7). Table H. Heavy and light chain sequences provided as an example of human anti-integrin antibodies α 7 β 1 . antibody Heavy chain sequence Light chain sequence Ab28 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMNWVRQAPGKGLEWVSSISIVGNYIYYADSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRKWEHDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHYTQKSLSLSPG (الرقم التعريفي التسلسلي: 118) SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADFYCTSRDNSGNHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS (الرقم التعريفي التسلسلي: 119) Ab29 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMNWVRQAPGKGLEWVSSISIVGNYIYYADSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARRKWEHDAFDIWGQG TMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK THTCPPCPAPEEAAGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (Serial ID: 120) SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADFYCTSRDNSGNHVVFGGGTKLTV LGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS (Serial ID: 121) In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 80% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 83% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 85% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 87% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 90% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, The antibody to integrin α7β1 consists of a heavy chain consisting of a sequence of at least 92% homologous amino acids with the sequence identification number: 118.In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 93% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 94% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 95% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 97% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 98% homology to an amino acid sequence and the sequence identification number: 118. In some applied models, The antibody to integrin α7β1 consists of a heavy chain consisting of a sequence of at least 99% homologous amino acids with the sequence identification number: 118.In some applied models, the anti-integrin α7β1 antibody consists of a heavy chain made up of a homologous amino acid sequence with the serial identification number: 118. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 80% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 83% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 85% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 87% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 90% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, The antibody to integrin α7β1 consists of a heavy chain consisting of a sequence of at least 92% homologous amino acids with the serial identification number: 120.In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 93% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 94% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 95% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 97% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, the α7β1 integrin antibody consists of a heavy chain with at least 98% homology to an amino acid sequence and the sequence identification number: 120. In some applied models, The antibody to integrin α7β1 consists of a heavy chain consisting of a sequence of at least 99% homologous amino acids with the sequence identification number: 120.In some applied models, the anti-integrin α7β1 antibody consists of a heavy chain made up of a homologous amino acid sequence with the serial identification number: 120. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 80% homology to the amino acid sequence and the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 83% homology to the amino acid sequence and the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 85% homology to the amino acid sequence and the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 87% homology to the amino acid sequence and the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 90% homology to the amino acid sequence and the sequence identification number: 119. In some applied models, The α7β1 integrin antibody consists of a light chain consisting of a sequence of at least 92% homologous amino acids with the serial identification number: 119.In some applied models, the α7β1 integrin antibody consists of a light chain with at least 93% homology to an amino acid sequence with the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 94% homology to an amino acid sequence with the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 95% homology to an amino acid sequence with the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 97% homology to an amino acid sequence with the sequence identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 98% homology to an amino acid sequence with the sequence identification number: 119. In some applied models, The anti-integrin α7β1 antibody consists of a light chain consisting of a sequence of at least 99% homologous amino acids with the sequence identification number: 119.In some applied models, the anti-integrin α7β1 antibody consists of a light chain made up of a homologous amino acid sequence with the serial identification number: 119. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 80% homology to the amino acid sequence and the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 83% homology to the amino acid sequence and the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 85% homology to the amino acid sequence and the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 87% homology to the amino acid sequence and the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 90% homology to the amino acid sequence and the sequence identification number: 121. In some applied models, The α7β1 integrin antibody consists of a light chain consisting of a sequence of at least 92% homologous amino acids with the sequence identification number: 121.In some applied models, the α7β1 integrin antibody consists of a light chain with at least 93% homology to an amino acid sequence with the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 94% homology to an amino acid sequence with the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 95% homology to an amino acid sequence with the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 97% homology to an amino acid sequence with the sequence identification number: 121. In some applied models, the α7β1 integrin antibody consists of a light chain with at least 98% homology to an amino acid sequence with the sequence identification number: 121. In some applied models, The α7β1 integrin antibody consists of a light chain consisting of a sequence of at least 99% homologous amino acids with the sequence identification number: 121.In some applied models, the anti-integrin α7β1 antibody consists of a light chain made up of a homologous amino acid sequence with the serial identification number: 121. In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain consisting of an amino acid sequence with serial identification number: 118, and a light chain consisting of an amino acid sequence with serial identification number: 119. In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain consisting of an amino acid sequence with serial identification number: 120, and a light chain consisting of an amino acid sequence with serial identification number: 121. mouse antibody against α 7 β 1 In some applied models, the antibody or its antigen-binding component is a murine antibody against α7β1. In other applied models, the antibody or its antigen-binding component consists of selected complement mapping regions (CDRs) from Table C . Table C. Areas for assigning complements ( CDRs The examples given are mouse antibodies against α 7 β 1 . antibody HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Ab8 GYSFTRYW (Serial Identification Number: 7, HCDR1G) IDPSDSET (Serial Identification Number: 22, HCDR2H) ARGGYFGEGWYFDV (Serial Identification Number: 38, HCDR3H) QSLVHRNGNTY (Serial ID number: 51, LCDR1F) KVS (Serial ID number: 63, LCDR2F) SQSTHVPWT (Serial ID Number: 75, LCDR3G) Ab9 GYTFTSYW (Serial Identification Number: 8, HCDR1H) IYPSDSYT (Serial Identification Number: 23, HCDR2I) TRRANYVGAMDY (Serial Identification Number: 39, HCDR3I) SSVSY (Serial Identification Number: 52, LCDR1G) ATS (Serial ID number: 64, LCDR2G) QQWSSNPLT (Serial ID Number: 76, LCDR3H) Ab10 GFSLTSYG (Serial Identification Number: 9, HCDR1I) IWVGGIT (Serial Identification Number: 24, HCDR2J) ARDGYYGDFDV (Serial Identification Number: 40, HCDR3J) QDINKF (Serial ID number: 53, LCDR1H) YTS (Serial ID number: 65, LCDR2H) LQYDNLRT (Serial ID number: 77, LCDR3I) Ab11 GFSLTSYG (Serial Identification Number: 9, HCDR1I) IWAGGIT (Serial Identification Number: 25, HCDR2K) ARDGYYGDFDV (Serial Identification Number: 40, HCDR3J) QDINKY (Serial ID number: 54, LCDR1I) YTS (Serial ID number: 65, LCDR2H) LQYDNLRT (Serial ID number: 77, LCDR3I) Ab12 GFSLTSYG (Serial Identification Number: 9, HCDR1I) IWAGGIT (Serial Identification Number: 25, HCDR2K) ARDGYYGHFDV (Serial Identification Number: 41, HCDR3K) QDINKY (Serial ID number: 54, LCDR1I) YTS (Serial ID number: 65, LCDR2H) LQYDNLRA (Serial Identification Number: 78, LCDR3J) Ab13 GFTFSSDA (Serial Identification Number: 10, HCDR1J) ISIGGSA (Serial Identification Number: 26, HCDR2L) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDL (Serial identification number: 55, LCDR1J) YAS (Serial ID number: 66, LCDR2I) QNGHNFPFT (Serial ID number: 79, LCDR3K) Ab14 GFTFSSSA (Serial Identification Number: 11, HCDR1K) ISVGGST (Serial Identification Number: 27, HCDR2M) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDY (Serial ID number: 56, LCDR1K) YAS (Serial ID Number: 66, LCDR2I) QNGHSFPFT (Serial ID Number: 80, LCDR3L) Ab15 GFTFSSSA (Serial Identification Number: 11, HCDR1K) ISVGGST (Serial Identification Number: 27, HCDR2M) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDY (Serial ID number: 56, LCDR1K) YSS (Serial ID number: 67, LCDR2J) QNGHSFPFT (Serial ID Number: 80, LCDR3L) Ab16 GFTFSSSA (Serial Identification Number: 11, HCDR1K) ISVGGST (Serial Identification Number: 27, HCDR2M) ARGGDYDPMDY (Serial Identification Number: 43, HCDR3M) QSISDY (Serial ID number: 56, LCDR1K) YAS (Serial ID number: 66, LCDR2I) QNGHSFPFT (Serial ID Number: 80, LCDR3L) Ab17 GFTFSSDA (Serial Identification Number: 10, HCDR1J) ISIGGST (Serial Identification Number: 28, HCDR2N) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDL (Serial identification number: 55, LCDR1J) YAS (Serial ID number: 66, LCDR2I) QNGHNFPFT (Serial ID number: 79, LCDR3K) Ab18 GFTFSSSA (Serial Identification Number: 11, HCDR1K) ISVGGSI (Serial Identification Number: 29, HCDR2O) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDY (Serial ID number: 56, LCDR1K) YAS (Serial ID number: 66, LCDR2I) QNGHSFPFT (Serial ID Number: 80, LCDR3L) Ab20 GFTFSNCA (Serial Identification Number: 12, HCDR1L) ISIGGST (Serial Identification Number: 28, HCDR2N) ARGGDYDAMDY (Serial Identification Number: 42, HCDR3L) QSISDL (Serial identification number: 55, LCDR1J) YAS (Serial ID number: 66, LCDR2I) QNGHSFPFT (Serial ID Number: 80, LCDR3L) Ab21 GFTFSSDA (Serial Identification Number: 10, HCDR1J) ISIGGST (Serial Identification Number: 28, HCDR2N) TRGGDYDAMDY (Serial Identification Number: 44, HCDR3N) QSISDL (Serial identification number: 55, LCDR1J) YAS (Serial ID number: 66, LCDR2I) QNGHNFPFT (Serial ID number: 79, LCDR3K) Ab22 GFSLSTSDMG (Serial Identification Number: 13, HCDR1M) IYWDDDK (Serial Identification Number: 30, HCDR2P) VRGTAVVAFYWYFDV (Serial Identification Number: 45, HCDR3O) QDINNY (Serial Identification Number: 57, LCDR1L) RAN (Serial ID number: 68, LCDR2K) LHYDDFPLT (Serial ID number: 81, LCDR3M) Ab23 GFSLSTSDLG (Serial Identification Number: 14, HCDR1N) IYWDDDK (Serial Identification Number: 30, HCDR2P) VRGTAVVAFYWYFDV (Serial Identification Number: 45, HCDR3O) QDINNY (Serial Identification Number: 57, LCDR1L) RAN (Serial ID number: 68, LCDR2K) LQYDDFPLT (Serial ID number: 82, LCDR3N) In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 7 (HCDR1G), HCDR2 with serial identification number 22 (HCDR2H), and HCDR3 with serial identification number 38 (HCDR3H). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 51 (LCDR1F), LCDR2 with serial identification number 63 (LCDR2F), and LCDR3 with serial identification number 75 (LCDR3G). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 7 (HCDR1G), HCDR2 with serial identification number: 22 (HCDR2H), HCDR3 with serial identification number: 38 (HCDR3H), LCDR1 with serial identification number: 51 (LCDR1F), LCDR2 with serial identification number: 63 (LCDR2F), and LCDR3 with serial identification number: 75 (LCDR3G). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 8 (HCDR1H), HCDR2 with serial identification number 23 (HCDR2I), and HCDR3 with serial identification number 39 (HCDR3I). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 52 (LCDR1G), LCDR2 with serial identification number 64 (LCDR2G), and LCDR3 with serial identification number 76 (LCDR3H). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 8 (HCDR1H), HCDR2 with serial identification number: 23 (HCDR2I), HCDR3 with serial identification number: 39 (HCDR3I), LCDR1 with serial identification number: 52 (LCDR1G), LCDR2 with serial identification number: 64 (LCDR2G), and LCDR3 with serial identification number: 76 (LCDR3H). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 9 (HCDR1I), HCDR2 with serial identification number 24 (HCDR2J), and HCDR3 with serial identification number 40 (HCDR3J). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 53 (LCDR1H), LCDR2 with serial identification number 65 (LCDR2H), and LCDR3 with serial identification number 77 (LCDR3I). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 9 (HCDR1I), HCDR2 with serial identification number: 24 (HCDR2J), HCDR3 with serial identification number: 40 (HCDR3J), LCDR1 with serial identification number: 53 (LCDR1H), LCDR2 with serial identification number: 65 (LCDR2H), and LCDR3 with serial identification number: 77 (LCDR3I). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 9 (HCDR1I), HCDR2 with serial identification number 25 (HCDR2K), and HCDR3 with serial identification number 40 (HCDR3J). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 54 (LCDR1I), LCDR2 with serial identification number 65 (LCDR2H), and LCDR3 with serial identification number LCDR3I. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 9 (HCDR1I), HCDR2 with serial identification number: 25 (HCDR2K), HCDR3 with serial identification number: 40 (HCDR3J), LCDR1 with serial identification number: 54 (LCDR1I), LCDR2 with serial identification number: 65 (LCDR2H), and LCDR3 with serial identification number: 77 (LCDR3I). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 9 (HCDR1I), HCDR2 with serial identification number 25 (HCDR2K), and HCDR3 with serial identification number 41 (HCDR3K). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 54 (LCDR1I), LCDR2 with serial identification number 65 (LCDR2H), and LCDR3 with serial identification number 78 (LCDR3J). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 9 (HCDR1I), HCDR2 with serial identification number: 25 (HCDR2K), HCDR3 with serial identification number: 41 (HCDR3K), LCDR1 with serial identification number: 54 (LCDR1I), LCDR2 with serial identification number: 65 (LCDR2H), and LCDR3 with serial identification number: 78 (LCDR3J). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 10 (HCDR1J), HCDR2 with serial identification number HCDR2L, and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 55 (LCDR1J), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 79 (LCDR3K). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 10 (HCDR1J), HCDR2 with serial identification number: 26 (HCDR2L), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 55 (LCDR1J), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 79 (LCDR3K). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 11 (HCDR1K), HCDR2 with serial identification number 27 (HCDR2M), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 56 (LCDR1K), LCDR2 with serial identification number 66 (LCDR2I), LCDR3 with serial identification number 80, and LCDR3L. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 11 (HCDR1K), HCDR2 with serial identification number: 27 (HCDR2M), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 56 (LCDR1K), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 80 (LCDR3L). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 11 (HCDR1K), HCDR2 with serial identification number 27 (HCDR2M), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 56 (LCDR1K), LCDR2 with serial identification number 67 (LCDR2J), and LCDR3 with serial identification number 80 (LCDR3L). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 11 (HCDR1K), HCDR2 with serial identification number: 27 (HCDR2M), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 56 (LCDR1K), LCDR2 with serial identification number: 67 (LCDR2J), and LCDR3 with serial identification number: 80 (LCDR3L). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 11 (HCDR1K), HCDR2 with serial identification number 27 (HCDR2M), and HCDR3 with serial identification number 43 (HCDR3M). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 56 (LCDR1K), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 80 (LCDR3L). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 11 (HCDR1K), HCDR2 with serial identification number: 27 (HCDR2M), HCDR3 with serial identification number: 43 (HCDR3M), LCDR1 with serial identification number: 56 (LCDR1K), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 80 (LCDR3L). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 10 (HCDR1J), HCDR2 with serial identification number 28 (HCDR2N), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 55 (LCDR1J), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 79 (LCDR3K). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 10 (HCDR1J), HCDR2 with serial identification number: 28 (HCDR2N), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 55 (LCDR1J), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 79 (LCDR3K). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 11 (HCDR1K), HCDR2 with serial identification number 29 (HCDR2O), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 56 (LCDR1K), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 80 (LCDR3L). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 11 (HCDR1K), HCDR2 with serial identification number: 29 (HCDR2O), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 56 (LCDR1K), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 80 (LCDR3L). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 10 (HCDR1J), HCDR2 with serial identification number 28 (HCDR2N), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 55 (LCDR1J), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 79 (LCDR3K). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 10 (HCDR1J), HCDR2 with serial identification number: 28 (HCDR2N), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 55 (LCDR1J), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 79 (LCDR3K). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 12 (HCDR1L), HCDR2 with serial identification number 28 (HCDR2N), and HCDR3 with serial identification number 42 (HCDR3L). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 55 (LCDR1J), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 80 (LCDR3L). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 12 (HCDR1L), HCDR2 with serial identification number: 28 (HCDR2N), HCDR3 with serial identification number: 42 (HCDR3L), LCDR1 with serial identification number: 55 (LCDR1J), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 80 (LCDR3L). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 10 (HCDR1J), HCDR2 with serial identification number 28 (HCDR2N), and HCDR3 with serial identification number 44 (HCDR3N). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 55 (LCDR1J), LCDR2 with serial identification number 66 (LCDR2I), and LCDR3 with serial identification number 79 (LCDR3K). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 10 (HCDR1J), HCDR2 with serial identification number: 28 (HCDR2N), HCDR3 with serial identification number: 44 (HCDR3N), LCDR1 with serial identification number: 55 (LCDR1J), LCDR2 with serial identification number: 66 (LCDR2I), and LCDR3 with serial identification number: 79 (LCDR3K). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 13 (HCDR1M), HCDR2 with serial identification number 30 (HCDR2P), and HCDR3 with serial identification number 45 (HCDR3O). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 57 (LCDR1L), LCDR2 with serial identification number 68 (LCDR2K), and LCDR3 with serial identification number 81 (LCDR3M). In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 13 (HCDR1M), HCDR2 with serial identification number: 30 (HCDR2P), HCDR3 with serial identification number: 45 (HCDR3O), LCDR1 with serial identification number: 57 (LCDR1L), LCDR2 with serial identification number: 68 (LCDR2K), and LCDR3 with serial identification number: 81 (LCDR3M). In some experimental models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number 14 (HCDR1N), HCDR2 with serial identification number 30 (HCDR2P), and HCDR3 with serial identification number 29 (HCDR2O). In other experimental models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number 57 (LCDR1L), LCDR2 with serial identification number 68 (LCDR2K), and LCDR3 with serial identification number 82 (LCDR3N). In some applied models, the antibody or its antigen-binding fragment competes with a reference antibody, which consists of HCDR1 with serial identification number 14 (HCDR1N), HCDR2 with serial identification number 30 (HCDR2P), HCDR3 with serial identification number 29 (HCDR2O), LCDR1 with serial identification number 57 (LCDR1L), LCDR2 with serial identification number 68 (LCDR2K), and LCDR3 with serial identification number 82 (LCDR3N). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of complement-coding regions (CDRs) containing one or more amino acids different from the CDRs described in [reference to specific models]. Table C In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 5 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table C In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 4 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table C In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 3 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table C In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than 2 amino acids from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table C In some applied models, the antibody against α7β1 integrin, or its antigen-binding component, consists of a complement-coding region (CDR) that differs by no more than one amino acid from any of the complement-coding regions (CDRs) described in [reference to specific models / models]. Table C . In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GYSFTRYW (serial ID: 7, HCDR1G); HCDR2, which has an amino acid sequence differing by no more than two amino acids from IDPSDSET (serial ID: 22, HCDR2H); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGYFGEGWYFDV (serial ID: 38, HCDR3H); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSLVHRNGNTY (serial ID: 51, LCDR1F); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from KVS (serial ID: 63). LCDR2F), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from SQSTHVPWT (serial identification number: 75, LCDR3G). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GYTFTSYW (serial identification number: 8, HCDR1H); HCDR2, which consists of an amino acid sequence that differs by no more than two amino acids from IYPSDSYT (serial identification number: 23, HCDR2I); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from TRRANYVGAMDY (serial identification number: 39, HCDR3I); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from SSVSY (serial identification number: 52, LCDR1G); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from ATS (serial identification number: 64, LCDR2G). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from QQWSSNPLT (serial identification number: 76, LCDR3H). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from GFSLTSYG (serial identification number: 2, HCDR1I), HCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from IWVGGIT (serial identification number: 24, HCDR2J), HCDR3 consisting of an amino acid sequence that differs by no more than four amino acids from ARDGYYGDFDV (serial identification number: 40, HCDR3J), LCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from QDINKF (serial identification number: 53, LCDR1H), and LCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from YTS (serial identification number: 65, LCDR2H). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from LQYDNLRT (serial identification number: 77, LCDR3I). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFSLTSYG (serial identification number: 2, HCDR1I); HCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from IWAGGIT (serial identification number: 25, HCDR2K); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARDGYYGDFDV (serial identification number: 40, HCDR3J); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from QDINKY (serial identification number: 54, LCDR1I); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from YTS (serial identification number: 65, LCDR2H). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from LQYDNLRT (serial identification number: 77, LCDR3I). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from GFSLTSYG (serial identification number: 9, HCDR1I), HCDR2 consisting of an amino acid sequence that differs by no more than two amino acids from IWAGGIT (serial identification number: 25, HCDR2K), HCDR3 consisting of an amino acid sequence that differs by no more than four amino acids from ARDGYYGHFDV (serial identification number: 41, HCDR3K), LCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from QDINKY (serial identification number: 54, LCDR1I), and LCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from YTS (serial identification number: 65, LCDR2H). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from LQYDNLRA (serial identification number: 78, LCDR3J). In some applied models, the α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSSDA (serial ID: 10, HCDR1J); HCDR2, which has an amino acid sequence differing by no more than two amino acids from ISIGGSA (serial ID: 26, HCDR2L); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGDYDAMDY (serial ID: 42, HCDR3L); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSISDL (serial ID: 55, LCDR1J); LCDR2, which has an amino acid sequence differing by no more than one amino acid from YAS (serial ID: 66, LCDR2I); and LCDR3. It consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHNFPFT (serial identification number: 79, LCDR3K). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSSA (serial identification number: 11, HCDR1K); HCDR2, which consists of an amino acid sequence that differs by no more than two amino acids from ISVGGST (serial identification number: 27, HCDR2M); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARGGDYDAMDY (serial identification number: 42, HCDR3L); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from QSISDY (serial identification number: 56, LCDR1K); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from YAS (serial identification number: 66, LCDR2I). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHSFPFT (serial identification number: 80, LCDR3L). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from GFTFSSSA (serial identification number: 11, HCDR1K), HCDR2 consisting of an amino acid sequence that differs by no more than two amino acids from ISVGGST (serial identification number: 27, HCDR2M), HCDR3 consisting of an amino acid sequence that differs by no more than four amino acids from ARGGDYDAMDY (serial identification number: 42, HCDR3L), LCDR1 consisting of an amino acid sequence that differs by no more than two amino acids from QSISDY (serial identification number: 56, LCDR1K), and LCDR2 consisting of an amino acid sequence that differs by no more than one amino acid from YSS (serial identification number: 67, LCDR2J). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHSFPFT (serial identification number: 80, LCDR3L). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSSA (serial identification number: 11, HCDR1K); HCDR2, which consists of an amino acid sequence that differs by no more than two amino acids from ISVGGST (serial identification number: 27, HCDR2M); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARGGDYDPMDY (serial identification number: 43, HCDR3M); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from QSISDY (serial identification number: 56, LCDR1K); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from YAS (serial identification number: 66, LCDR2I). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHSFPFT (serial identification number: 80, LCDR3L). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSSDA (serial ID: 10, HCDR1J); HCDR2, which has an amino acid sequence differing by no more than two amino acids from ISIGGST (serial ID: 28, HCDR2N); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGDYDAMDY (serial ID: 42, HCDR3L); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSISDL (serial ID: 55, LCDR1J); LCDR2, which has an amino acid sequence differing by no more than one amino acid from YAS (serial ID: 66, LCDR2I); and LCDR3. It consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHNFPFT (serial identification number: 79, LCDR3K). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from GFTFSSSA (serial identification number: 11, HCDR1K); HCDR2, which consists of an amino acid sequence that differs by no more than two amino acids and one amino acid from ISVGGSI (serial identification number: 29, HCDR2O); HCDR3, which consists of an amino acid sequence that differs by no more than four amino acids from ARGGDYDAMDY (serial identification number: 42, HCDR3L); LCDR1, which consists of an amino acid sequence that differs by no more than two amino acids from QSISDY (serial identification number: 56, LCDR1K); and LCDR2, which consists of an amino acid sequence that differs by no more than one amino acid from YAS (serial identification number: 66, LCDR2I). LCDR3 consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHSFPFT (serial identification number: 80, LCDR3L). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GYSFTRYW (serial ID: 7, HCDR1G); HCDR2, which has an amino acid sequence differing by no more than two amino acids from IDPSDSET (serial ID: 22, HCDR2H); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGYFGEGWYFDV (serial ID: 38, HCDR3H); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSLVHRNGNTY (serial ID: 51, LCDR1F); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from KVS (serial ID: 63). LCDR2F), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from SQSTHVPWT (serial identification number: 75, LCDR3G). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSSDA (serial ID: 10, HCDR1J); HCDR2, which has an amino acid sequence differing by no more than two amino acids from ISIGGST (serial ID: 28, HCDR2N); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGDYDAMDY (serial ID: 42, HCDR3L); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSISDL (serial ID: 55, LCDR1J); LCDR2, which has an amino acid sequence differing by no more than one amino acid from YAS (serial ID: 66, LCDR2I); and LCDR3. It consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHNFPFT (serial identification number: 79, LCDR3K). In some applied models, the α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSNCA (serial ID: 12, HCDR1L); HCDR2, which has an amino acid sequence differing by no more than two amino acids from ISIGGST (serial ID: 28, HCDR2N); HCDR3, which has an amino acid sequence differing by no more than four amino acids from ARGGDYDAMDY (serial ID: 42, HCDR3L); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSISDL (serial ID: 55, LCDR1J); LCDR2, which has an amino acid sequence differing by no more than one amino acid from YAS (serial ID: 66, LCDR2I); and LCDR3. It consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHSFPFT (serial identification number: 80, LCDR3L). In some applied models, the α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFTFSSDA (serial ID: 10, HCDR1J); HCDR2, which has an amino acid sequence differing by no more than two amino acids from ISIGGST (serial ID: 28, HCDR2N); HCDR3, which has an amino acid sequence differing by no more than four amino acids from TRGGDYDAMDY (serial ID: 44, HCDR3N); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QSISDL (serial ID: 55, LCDR1J); LCDR2, which has an amino acid sequence differing by no more than one amino acid from YAS (serial ID: 66, LCDR2I); and LCDR3. It consists of an amino acid sequence that differs by no more than 4 amino acids from QNGHNFPFT (serial identification number: 79, LCDR3K). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFSLSTSDMG (serial ID: 13, HCDR1M); HCDR2, which has an amino acid sequence differing by no more than two amino acids from IYWDDDK (serial ID: 30, HCDR2P); HCDR3, which has an amino acid sequence differing by no more than four amino acids from VRGTAVVAFYWYFDV (serial ID: 45, HCDR3O); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QDINNY (serial ID: 57, LCDR1L); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from RAN (serial ID: 68). LCDR2K), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from LHYDDFPLT (serial identification number: 81, LCDR3M). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of HCDR1, which has an amino acid sequence differing by no more than two amino acids from GFSLSTSDLG (serial ID: 14, HCDR1N); HCDR2, which has an amino acid sequence differing by no more than two amino acids from IYWDDDK (serial ID: 30, HCDR2P); HCDR3, which has an amino acid sequence differing by no more than four amino acids from VRGTAVVAFYWYFDV (serial ID: 45, HCDR3O); LCDR1, which has an amino acid sequence differing by no more than two amino acids from QDINNY (serial ID: 57, LCDR1L); and LCDR2, which has an amino acid sequence differing by no more than one amino acid from RAN (serial ID: 68). LCDR2K), and LCDR3 consist of an amino acid sequence that differs by no more than 4 amino acids from LQYDDFPLT (serial identification number: 82, LCDR3N). Table D. Sequences VH and VL Listed as an example of anti-integrin mouse antibodies α 7 β 1 . antibody sequence VH sequence VL Ab8 QVPLQQSGPQLVRPGASVKISCKASGYSFTRYWMHWVKQRPGQGLDWIGKIDPSDSETRLNQEFRDKATLTVDKSSSTAYLQLSSPTSEDSAVYYCARGGYFGEGWYFDVWGAGTTVTVSS (Serial ID: 142, VH8) DVVMTQIPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK (Serial ID: 143, VL8) Ab22 QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSDMGVSWIRQPSGKGLEWLAHIYWDDDKRYSPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCVRGTAVVAFYWYFDVWGAGTTVTVSS (Serial ID: 144, VH22) DIKMTQSPSSMYASLGERVTITCKASQDINNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLHYDDFPLTFGAGTKVELK (Serial Identification Number: 145, VL22) Ab23 QVTLKESGPGILQPSQTLSLTCSCSGFSLSTSDLGVSWIRQPSGKGLEWLAHIYWDDDKRYSPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCVRGTAVVAFYWYFDVWGAGTTVTVSS (Serial ID: 146, VH23) DIKMTQSPSSMYASLGERVTITCKASQDINNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKVELK (Serial Identification Number: 147, VL23) Ab10 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWVGGITHYNSALMSRLSISKDNSKSQVFLKMNSLQTDDIAMYYCARDGYYGDFDVWGAGTTVTVSS (الرقم التعريفي التسلسلي: 148، VH10) DIQMTQSPSSLSASLGGKVTITCTASQDINKFIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIK (الرقم التعريفي التسلسلي: 149، VL10) Ab11 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWAGGITHYNSALMSRLSISKDNSKSQVFLKMNSPQTDDIAMYYCARDGYYGDFDVWGAGTTVTVSS (الرقم التعريفي التسلسلي: 150، VH11) DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLVPEDIATYYCLQYDNLRTFGGGTKLEIK (الرقم التعريفي التسلسلي: 151، VL11) Ab12 QVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWAGGITHYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMFYCARDGYYGHFDVWGAGTTVTVSS (الرقم التعريفي التسلسلي: 152، VH12) DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGQGPRLLIDYTSTLQPGIPSRFSGSGSGRDYSFTISNLEPEDIATYFCLQYDNLRAFGGGTKLEIK (الرقم التعريفي التسلسلي: 153، VL12) Ab9 QVQLQQPGAELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCTRRANYVGAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 154، VH9) QIVLSQSPAILSASPGEKVTMTCRASSSVSYMYWYQQKPGSSPKPWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWSSNPLTFGAGTKLELK (الرقم التعريفي التسلسلي: 155، VL9) Ab13 EVKLVESGGGLVKPGGSLKLSCAASGFTFSSDAMSWVRQTPEKSLEWVASISIGGSAFYPESVRGRFTISRDNARNILYLQMSSLRSEDTAMYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 156، VH13) DIVMTQSPATLSVTPGDRVSLSCRASQSISDLLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYFCQNGHNFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 157، VL13) Ab14 EVKLVESGGGLVKPGGSLKLSCAASGFTFSSSAMSWVRQTPEKRLEWVASISVGGSTFYPDSVKGRFTISRDNARKILYLQMSSLRSEDTAMYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 158، VH14) DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWFQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 159، VL14) Ab15 EVKLVESGGGLVKPGGSLKLSCAASGFTFSSSAMSWVRQTPEKRLEWVASISVGGSTFYPDSVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 160، VH15) DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWFQQKSHESPRLLIKYSSQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 161، VL15) Ab16 EVKLVESGGGLVKPGGSLKLSCAASGFTFSSSAMSWVRQTPEKRLEWVASISVGGSTFYADSVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCARGGDYDPMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 162، VH16) DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWFQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 163، VL16) Ab17 EVKLVESGGGLVKPGGSLKLSCAASGFTFSSDAMSWVRQTPEKRLEWVASISIGGSTFYPESVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 164، VH17) DIVMTQSPATLSVTPGDRVSLSCRASQSISDLLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYFCQNGHNFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 165، VL17) Ab18 EVKVVESGGGLVKPGGSLKLSCATSGFTFSSSAMSWVRQTPERRLEWVASISVGGSIFYPDSVKGRFTISRENARNILYLQMSSLRSEDTAMYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 166، VH18) DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWFQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 167، VL18) Ab20 EVKLVESGGGLVKPGGSLKLSCAASGFTFSNCAMSWVRQTPEKRLEWVASISIGGSTFYPDSVKGRFTISRDNGRNILYLQMSSLRSEDTALYYCARGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 170، VH20) DIVMTQFPDTLSVTPGDRVSLSCRASQSISDLLHWYQQKSHESPRLLIKYASQSISEIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 171، VL20) Ab21 EVKLVESGGGLVKPGGSLKLSCEASGFTFSSDAMSWVRQTPEKRLEWVASISIGGSTFYPESVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCTRGGDYDAMDYWGQGTSVTVSS (الرقم التعريفي التسلسلي: 172، VH21) DIVMTQSPATLSVTPGDRVSLSCRASQSISDLLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYFCQNGHNFPFTFGSGTKLEIK (الرقم التعريفي التسلسلي: 173، VL21) In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 142 (VH8).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 142 (VH8). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of at least 99% homologous amino acid sequence with the serial identification number: 142 (VH8).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 142 (VH8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 154 (VH9).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 154 (VH9). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of at least 99% homologous amino acid sequence with the serial identification number: 154 (VH9).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 154 (VH9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 148 (VH10).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 148 (VH10). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 148 (VH10).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 148 (VH10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 150 (VH11).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 150 (VH11). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 150 (VH11).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 150 (VH11). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 152 (VH12).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 152 (VH12). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 152 (VH12).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 152 (VH12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 156 (VH13).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 156 (VH13). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 156 (VH13).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 156 (VH13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 158 (VH14).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 158 (VH14). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 158 (VH14).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 158 (VH14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 160 (VH15).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 160 (VH15). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 160 (VH15).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 160 (VH15). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 162 (VH16).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 162 (VH16). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 162 (VH16).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 162 (VH16). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 164 (VH17).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 164 (VH17). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable heavy chain region consisting of at least 99% homologous amino acid sequence with the serial identification number: 164 (VH17).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 164 (VH17). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the anti-integrin α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 166 (VH18).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 166 (VH18). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 166 (VH18).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 166 (VH18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 170 (VH20).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 170 (VH20). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of at least 99% homologous amino acid sequence with the serial identification number: 170 (VH20).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 170 (VH20). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 172 (VH21).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 172 (VH21). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 172 (VH21).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 172 (VH21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 144 (VH22).In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 144 (VH22). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 144 (VH22).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 144 (VH22). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the α7β1 antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 146 (VH23).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable heavy chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 146 (VH23). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 146 (VH23).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable heavy chain region consisting of an amino acid sequence homologous to the serial identification number: 146 (VH23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 143 (VL8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 134 (VL8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 143 (VL8). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 143 (VL8).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 143 (VL8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 143 (VL8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 143 (VL8). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 143 (VL8).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 143 (VL8). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 155 (VL9).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 155 (VL9). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 155 (VL9).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 155 (VL9). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 149 (VL10).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 149 (VL10). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 149 (VL10).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 149 (VL10). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 151 (VL11).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 151 (VL11). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 151 (VL11).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 151 (VL11). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 153 (VL12).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 153 (VL12). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 153 (VL12).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 153 (VL12). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 157 (VL13).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 157 (VL13). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 157 (VL13).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 157 (VL13). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 159 (VL14).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 159 (VL14). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 159 (VL14).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 159 (VL14). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 161 (VL15).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the VL15 sequence number: 161. In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 161 (VL15).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 161 (VL15). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 163 (VL16).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the VL16 sequence number: 163. In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 163 (VL16).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 163 (VL16). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 165 (VL17).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 165 (VL17). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with serial identification number: 165 (VL17).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 165 (VL17). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 167 (VL18).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 167 (VL18).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 167 (VL18).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 167 (VL18). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 167 (VL18).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 167 (VL18). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 169 (VL19).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 169 (VL19). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of at least 99% homologous amino acid sequence with the serial identification number: 169 (VL19).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 169 (VL19). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 171 (VL20).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 171 (VL20). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 171 (VL20).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 171 (VL20). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 173 (VL21).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 173 (VL21). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 73 (VL21).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 173 (VL21). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 145 (VL22).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 145 (VL22). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 145 (VL22).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 145 (VL22). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 80% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 83% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 85% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence that is at least 87% homologous with the serial identification number: 147 (VL23).In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 90% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 95% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the α7β1 integrin antibody or its antigen-binding fragment consists of a variable light-chain region with at least 98% homology to an amino acid sequence and the sequence identification number: 147 (VL23). In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of a sequence of at least 99% homologous amino acids with the serial identification number: 147 (VL23).In some applied models, the antibody to integrin α7β1 or its antigen-binding component consists of a variable light-chain region consisting of an amino acid sequence homologous to the serial identification number: 147 (VL23). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 142 (VH8), and a light chain variable region consisting of an amino acid sequence with serial identification number: 143 (VL8). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 154 (VH9), and a light chain variable region consisting of an amino acid sequence with serial identification number: 155 (VL9). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 149 (VH10), and a light chain variable region consisting of an amino acid sequence with serial identification number: 149 (VL10). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 150 (VH11), and a light chain variable region consisting of an amino acid sequence with serial identification number: 151 (VL11). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 152 (VH12), and a light chain variable region consisting of an amino acid sequence with serial identification number: 153 (VL12). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 156 (VH13), and a light chain variable region consisting of an amino acid sequence with serial identification number: 157 (VL13). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 158 (VH14), and a light chain variable region consisting of an amino acid sequence with serial identification number: 159 (VL14). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 160 (VH15), and a light chain variable region consisting of an amino acid sequence with serial identification number: 161 (VL15). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 162 (VH16), and a light chain variable region consisting of an amino acid sequence with serial identification number: 163 (VL16). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 164 (VH17), and a light chain variable region consisting of an amino acid sequence with serial identification number: 165 (VL17). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 166 (VH18), and a light chain variable region consisting of an amino acid sequence with serial identification number: 167 (VL18). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 170 (VH20), and a light chain variable region consisting of an amino acid sequence with serial identification number: 171 (VL20). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 172 (VH21), and a light chain variable region consisting of an amino acid sequence with serial identification number: 173 (VL21). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 144 (VH22), and a light chain variable region consisting of an amino acid sequence with serial identification number: 145 (VL22). In some applied models, the anti-α7β1 antibody or its antigen-binding component consists of a heavy chain variable region consisting of an amino acid sequence with serial identification number: 146 (VH23), and a light chain variable region consisting of an amino acid sequence with serial identification number: 147 (VL23). Humanized antibodies with enhanced anti-integrin affinity α7β1 In some applied models, the antibody against integrin α7β1 or its antigen-binding component consists of at least one, two, or three complement mapping regions (CDRs) of a variable heavy chain region with an amino acid sequence as described in Table E or a sequence highly homologous to it (e.g., a sequence homologous to it by approximately 85%, 90%, 95%, or at least 99%, and / or containing one or more substitutions, e.g., conservative substitutions). In some applied models, the antibody to integrin α7β1 or its antigen-binding fragment consists of at least one, two, or three complement mapping regions (CDRs) of a variable light-chain region with an amino acid sequence as described in [reference]. Table E or a sequence highly homologous to it (e.g., a sequence homologous to it by at least 85%, 90%, 95%, or 99%, and / or containing one or more substitutions, e.g., conservative substitutions). In one applied model, the antibody to integrin α7β1 or its antigen-binding fragment consists of at least one, two, three, four, five, or six complement mapping regions (CDRs) of the heavy and light chain variants with an amino acid sequence as described in Table E or a sequence that is highly homologous to it (for example, a sequence that is at least approximately 85%, 90%, 95% or 99% homologous to it, and / or contains one or more substitutions, for example, conservative substitutions). In some applied models, the antibody or its antigen-binding fragment is a humanized antibody to α7β1. In other applied models, the antibody or its antigen-binding fragment consists of selected complement mapping regions (CDRs) from Table E Unless otherwise stated, the complement mapping region (CDR) sequences described in the present application follow the IMGT numbering system. Table E. Areas for assigning complements ( CDRs The examples given are of human-compatible antibodies that have been improved in terms of antibody affinity for α 7 β 1 . antibody HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Ab-P GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 27) ARGGYFGEGWYFDV (Serial Identification Number: 38) QSLVHRNGNTY (Serial Identification Number: 105) KVS (Serial Identification Number: 63) SQSTHVPWT (Serial Identification Number: 75) Ab24 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGREWYYDV (Serial Identification Number: 103) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial ID: 75, LCDR3G) Ab25 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGREWYYDV (Serial Identification Number: 103) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial ID: 75, LCDR3G) Ab26 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEEWYHDV (Serial Identification Number: 104) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSTQLPYT (Serial Identification Number: 107) Ab27 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEEWYHDV (Serial Identification Number: 104) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSTQLPYT (Serial Identification Number: 107) Ab30 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEGWYHDV (Serial Identification Number: 188) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSIQVPWT (Serial Identification Number: 198) Ab31 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGRQWYFDV (Serial Identification Number: 189) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial Identification Number: 75) Ab32 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEQWYHDV (Serial Identification Number: 190) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial Identification Number: 75) Ab33 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGVGWYNDV (Serial Identification Number: 191) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial Identification Number: 75) Ab34 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGETWYHDV (Serial Identification Number: 192) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) SQSTHVPWT (Serial Identification Number: 75) Ab35 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGENWYHDV (Serial Identification Number: 193) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSIQVPWT (Serial Identification Number: 198) Ab36 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEKWYHDV (Serial Identification Number: 194) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSTQLPYT (Serial Identification Number: 107) Ab37 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEKWYHDV (Serial Identification Number: 194) QSLVHRNGNTY (Serial Identification Number: 105) GVS (Serial Identification Number: 196) AQSTQLPYT (Serial Identification Number: 107) Ab38 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEEWYNDV (Serial Identification Number: 195) QSLVHRNGNTY (Serial Identification Number: 105) KVS (Serial Identification Number: 63) SQSTHVPWT (Serial Identification Number: 75) Ab39 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEEWYHDV (Serial Identification Number: 104) QSLVHRNGNTY (Serial Identification Number: 105) KVS (Serial Identification Number: 63) SQSTHVPWT (Serial Identification Number: 75) Ab40 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEEWYHDV (Serial Identification Number: 104) QSLVHRNGNTY (Serial Identification Number: 105) EGS (Serial Identification Number: 197) SQSTHVPWT (Serial Identification Number: 75) Ab41 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGEQWYHDV (Serial Identification Number: 190) QSLVHRNGNTY (Serial Identification Number: 105) EVS (Serial Identification Number: 106) AQSIQVPWT (Serial Identification Number: 198) Ab42 GYSFTRYW (Serial Identification Number: 101) IDPSDSET (Serial Identification Number: 102) ARGGYFGRQWYFDV (Serial Identification Number: 189) QSLVHRNGNTY (Serial Identification Number: 105) EGS (Serial Identification Number: 197) AQSTQLPYT (Serial Identification Number: 107) In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 27, and HCDR3 with serial identification number: 38. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 27, HCDR3 with serial identification number: 38, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 27, HCDR3 with serial identification number: 38, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75.In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 103. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 103, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 103, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 104. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 188. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 188, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 188, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 189. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 189, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 189, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 190. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 190, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 190, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 191. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 191, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 191, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 192. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 192, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 192, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 193. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 193, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 193, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 198. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 194. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 106, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 194. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 196, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 196, and LCDR3 with serial identification number: 107. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 194, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 196, and LCDR3 with serial identification number: 107. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 195. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 195, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 195, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 104. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or the antigen-binding part of it competes with a reference antibody, where the reference antibody consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 63, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, and HCDR3 with serial identification number: 104. In some applied models, the antibody or its antigen-binding component consists of LCDR1 with serial identification number: 105, LCDR2 with serial identification number: 197, and LCDR3 with serial identification number: 75. In some applied models, the antibody or its antigen-binding component consists of HCDR1 with serial identification number: 101, HCDR2 with serial identification number: 102, HCDR3 with serial identification number: 104, LCDR1 with serial identification number: 105, LCDR2 wit...

Claims

What is claimed is:  1. An antibody or an antigen-binding fragment that binds to calf-2 domain of α7β1 integrin but does not compete with the 20TFT antibody, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

2. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes for binding with a reference antibody for binding to α7β1 integrin,wherein the reference antibody comprises a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32), a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70).

3. An antibody or an antigen-binding fragment that binds α7β1 integrin comprising:(a) a means for stabilizing the extended conformations of the α7β1 integrin; and optionally,(b) an Fc domain.

4. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody binds to region comprising positions 856-862, 867-889, 1011-1017, 897-905 or 1002-1010 of the amino acid sequence of integrin α7, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

5. An antibody or an antigen-binding fragment that binds to calf-1 domain of α7β1 integrin, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

6. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes with a reference antibody for binding to α7β1 integrin, wherein the reference antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38), a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

7. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes with a reference antibody for binding to α7β1 integrin,wherein the reference antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40), a LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

8. An antibody or an antigen-binding fragment that binds α7β1 integrin comprising:(a) a means for binding to calf-1 domain of α7β1 integrin; and (b) an Fc domain.

9. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody binds to a region comprising positions 771-778, 793-805 of the amino acid sequence of integrin α7, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

10. The antibody or an antigen-binding fragment of claim 9, wherein the region comprises amino acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, N796, P797, M798, K799, R800, G801, A802, Q803, V804, and / or T805.

11. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), and a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70).

12. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GYTFTGYY (SEQ ID NO: 1), a HCDR2 of sequence INPNSGGT (SEQ ID NO: 15), and a HCDR3 of sequence AREGANWDYYYYGMDV (SEQ ID NO: 31); and a LCDR1 of sequence SSNIGSKT (SEQ ID NO: 46), a LCDR2 of sequence SNN (SEQ ID NO: 58), and a LCDR3 of sequence AAWDDSLNGPV (SEQ ID NO: 69).

13. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHVV (SEQ ID NO: 71).

14. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence ISDSGGIA (SEQ ID NO: 18), and a HCDR3 of sequence VRDGY (SEQ ID NO: 34); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

15. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

16. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSRFW (SEQ ID NO: 5), a HCDR2 of sequence TKQDGSEK (SEQ ID NO: 20), and a HCDR3 of sequence AREGSGAYWAFDI (SEQ ID NO: 36); and a LCDR1 of sequence QSLVHNDGNTY (SEQ ID NO: 49), a LCDR2 of sequence KIS (SEQ ID NO: 61), and a LCDR3 of sequence LQATQFPLT (SEQ ID NO: 73).

17. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GGSISSYY (SEQ ID NO: 6), a HCDR2 of sequence IYTRGST (SEQ ID NO: 21), and a HCDR3 of sequence ARVFGGNYRFDAFHI (SEQ ID NO: 37); and a LCDR1 of sequence SSNIGAGYD (SEQ ID NO: 50), a LCDR2 of sequence GNN (SEQ ID NO: 62), and a LCDR3 of sequence QSYDSSLSGYV (SEQ ID NO: 74).

18. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), and a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

19. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GYTFTSYW (SEQ ID NO: 8), a HCDR2 of sequence IYPSDSYT (SEQ ID NO: 23), and a HCDR3 of sequence TRRANYVGAMDY (SEQ ID NO: 39); and a LCDR1 of sequence SSVSY (SEQ ID NO: 52), a LCDR2 of sequence ATS (SEQ ID NO: 64), and a LCDR3 of sequence QQWSSNPLT (SEQ ID NO: 76).

20. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), and a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40); and a LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

21. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40); and a LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

22. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGHFDV (SEQ ID NO: 41); and a LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRA (SEQ ID NO: 78).

23. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGSA (SEQ ID NO: 26), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 178); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

24. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

25. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YSS (SEQ ID NO: 67), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

26. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDPMDY (SEQ ID NO: 43); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

27. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

28. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGSI (SEQ ID NO: 29), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

29. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHVV (SEQ ID NO: 71); ora HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

30. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSNCA (SEQ ID NO: 12), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

31. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence TRGGDYDAMDY (SEQ ID NO: 44); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

32. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLSTSDMG (SEQ ID NO: 13), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45); and a LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LHYDDFPLT (SEQ ID NO: 81).

33. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLSTSDLG (SEQ ID NO: 14), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45); and a LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LQYDDFPLT (SEQ ID NO: 82).

34. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen-binding fragment comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGREWYYDV (SEQ ID NO: 103); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO:75).

35. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen-binding fragment comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGEEWYHDV (SEQ ID NO: 104); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence AQSTQLPYT (SEQ ID NO: 107).

36. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

37. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

38. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

39. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

40. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

41. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

198.

42. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

107.

43. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO:

107.

44. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO:

75.

45. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO:

75.

46. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO:

75.

47. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

198.

48. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO:

107.

49. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 128, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 129;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 131; %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 132, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 133; %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 134, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 135; %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 136, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 137; %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 138, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 139; or%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 140, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

141.

50. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

131.

51. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 118, and a light chain comprising an amino acid sequence of SEQ ID NO: 119; or ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 120, and a light chain comprising an amino acid sequence of SEQ ID NO: 121.

52. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 143;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 144, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 145;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 146, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 147;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 148, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 149;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 150, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 151;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 152, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 153;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 154, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 155;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 156, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 157;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 158, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 159;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 160, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 161;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 162, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 163;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 164, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 165;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 166, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 167;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 170, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 171; or%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 172, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 173; or %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 186, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 187.

53. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 143.

54. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 108, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 109;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 110, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 111; %3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 199, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 200;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 201, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 202;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 203, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 204;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 205, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 206;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 207, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 208;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 209, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 210;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 211, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 212;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 213, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 214;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 215, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 216;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 217, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 218;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 219, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 220;%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 221, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 222; or%3) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 223, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 224.

55. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises:i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 112, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 114, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; iii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 115, and a light chain comprising an amino acid sequence of SEQ ID NO: 116; oriv) a heavy chain comprising an amino acid sequence of SEQ ID NO: 117, and a light chain comprising an amino acid sequence of SEQ ID NO: 116.

56. The antibody or antigen-binding fragment of any one of the preceding claims, wherein the antibody or antigen binding fragment has an affinity (Kd) to α7β1 integrin or a fragment thereof of between about 0.1 to 300 nM.

57. The antibody or antigen-binding fragment of claim 56, wherein the α7β1 integrin or a fragment thereof is α7β1 ectodomain, β1 ectodomain, α7 leg, calf-1 domain, calf-2 domain, or calf-1 and calf-2 domains.

58. The antibody or antigen-binding fragment of claim 56, wherein the α7β1 integrin is a human α7β1 integrin.

59. The antibody or antigen-binding fragment of claim 58, wherein the antibody has an affinity to a human α7β1 ectodomain of about 3 to 6 nM.

60. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof activates α7β1 integrin with a maximal efficacy or Emax of between about 100% to 300% as compared to the 20TFT or TS2 / 16 antibody.

61. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof has EC50 value of between 0.3 nM to 50 nM.

62. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof specifically binds α7β1 integrin and does not bind α6β1 integrin or α3β1integrin.

63. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a Fab, a single chain Fv (scFv), a single domain antibody (sdAb), a VHH, a variable heavy chain (VH), a variable light chain (VL), a Fab-like bispecific antibody (bsFab), a single- domain antibody-linked Fab (s-Fab), or a combination thereof.

64. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a humanized antibody.

65. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a human antibody.

66. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a chimeric antibody.

67. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is an IgG.

68. The antibody or antigen binding fragment thereof of claim 54, wherein the antibody or antigen binding fragment thereof is derived from IgG1, IgG2, IgG3, or IgG4.

69. The antibody or antigen binding fragment thereof of any one of preceding claims, wherein the antibody or antigen binding fragment thereof contains a Fc region.

70. The antibody or antigen binding fragment thereof of claim 69, wherein the Fc region contains one or more mutations.

71. A method of treating a disease or disorder in a subject associated with a α7β1 integrin defect, comprising administering to the subject the antibody or antigen binding fragment thereof of any one of the preceding claims.

72. The method of claim 71, wherein the disease or disorder associated with a α7β1 integrin defect is selected from a list comprising cardiomyopathy, congestive heart failure and muscular dystrophy.

73. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscular dystrophy.

74. The method of any one of claims 71-73, wherein the administration is to a muscle cell, wherein the muscle cell comprises a mutation in a dystrophin gene.

75. The method of claim 74, wherein the muscle cell lacks dystrophin or comprises a non-functional dystrophin.

76. The method of any one of claims 73-75, wherein the muscular dystrophy is Duchenne muscular dystrophy, Becker muscular dystrophy, limb girdle muscular dystrophy, Fukuyama congenital muscular dystrophy (FCMD) or merosin deficient congenital muscular dystrophy type lA (MDC1A).

77. The method of claim 76, wherein the muscular dystrophy is Duchenne muscular dystrophy.

78. The method of claim 76, wherein the muscular dystrophy is Becker muscular dystrophy.

79. The method of any one of claims 73-78, wherein the administration reduces one or more serum biomarkers of muscle fiber damage.

80. The method of claim 79, wherein the one or more biomarkers is creatine kinase, LDH cytotox, and / or IL-6.

81. The method of any one of claims 73-80, wherein the administration reduces muscle damage, inflammation, fibrosis, necrosis and / or atrophy.

82. The method of any one of claim 73-81, wherein the administration increases muscle cell adhesion.

83. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in an increase in expression of α7.

84. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscle atrophy.

85. The method of claim 84, wherein the subject has reduced muscle loss as compared to a control upon administration of the antibody or the binding fragment thereof.

86. The method of claim 84, wherein the subject has less than 20% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof.

87. The method of claim 85 or 86, wherein the control is a baseline value prior to administration of the antibody or the binding fragment thereof.

88. The method of claim 85 or 86, wherein the control is historical data.

89. The method of claim 85 or 86, wherein the control is a comparable subject to which the antibody or antigen binding fragment thereof was not administered.

90. A pharmaceutical composition comprising the antibody or antigen binding fragment thereof of any one of claims 1-70, and a pharmaceutically acceptable carrier.

91. The pharmaceutical composition of claim 90, wherein the composition is for parenteral or oral administration.

92. The pharmaceutical composition of claim 90, wherein the composition is for administration by a route selected from intravenous, intradermal, transdermal, intraocular, intranasal, intramuscular, subcutaneous, and transmucosal.

93. A method of treating cardiomyopathy, congestive heart failure or other cardiac muscle disorder by administering to a subject in need thereof the antibody or antigen binding fragment thereof of any one of claims 1-70.

94. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for stabilizing the extended conformations of the α7β1 integrin; andb) one or more physiologically acceptable carriers, excipients or diluents.

95. The antibody or antigen binding fragment thereof of any one of claims 1-70, wherein the antibody or the antigen-binding fragment binds to the α7β1 integrin as measured by the Surface Plasmon Resonance (SPR) assay as described in Example 4.

96. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for stabilizing the extended conformations of the α7β1 integrin; andb) one or more physiologically acceptable carriers, excipients or diluents.

97. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for increasing α7 expression; and b) one or more physiologically acceptable carriers, excipients or diluents.

Images