METHOD FOR THE PRODUCTION OF ERYTHROCYTE PROTEIN

DE602016095741T2Active Publication Date: 2026-07-08INST NAT DE LA SANTE & DE LA RECHERCHE MEDICALE (INSERM) +2
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
INST NAT DE LA SANTE & DE LA RECHERCHE MEDICALE (INSERM)
Filing Date
2016-10-14
Publication Date
2026-07-08

AI Technical Summary

Technical Problem

Current methods struggle to produce erythrocyte proteins like RhD, RhCE, and RhAG in sufficient quantities and native conformation for diagnostic use, particularly due to low expression yields and the need for co-expression with RhAG, and existing systems fail to preserve the structural and functional integrity of these proteins.

Method used

A cell-free production system using detergents, liposomes, or nanodiscs, particularly with a POPC-type lipid composition, allows for the synthesis of erythrocyte proteins such as RhD, RhCE, and RhAG without RhAG co-expression, optimizing the production process to achieve higher yields and maintain native conformation.

Benefits of technology

The method enables the production of erythrocyte proteins in large quantities and native form, suitable for diagnostic applications, overcoming the limitations of previous methods by ensuring proper folding and epitope recognition.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

INTRODUCTION

[0001] Blood groups are determined by a set of surface antigens that are grouped into systems based on genetic criteria. Currently, there are 35 blood group systems (ABO, Rh, Kell, Duffy, MNS, etc.) defining more than 300 erythrocyte antigens. While some have a wide tissue distribution, such as ABO, others, such as Rh (Rh), are specific to red blood cells. Some antigens carried by erythrocytes are highly immunogenic, particularly those of the Rh and Kell systems.

[0002] The Rhesus (RH) system is the most complex blood group system, being the most polymorphic and the most immunogenic in terms of transfusion. The common RH phenotype includes the major antigen RH1 (D) encoded by the RHD gene, and the antigens RH2 (C), RH3 (E), RH4 (c), and RH5 (e) encoded by the RHCE gene. Based on allelic forms, eight classic haplotypes are distinguished.

[0003] The Rh system plays a crucial role in transfusion medicine. Indeed, its antigens can, under conditions of blood group incompatibility, lead to the development of alloantibodies in recipients or pregnant women, resulting in hemolytic reactions and / or Hemolytic Disease of the Newborn (HDN). In RhD-negative pregnant women, anti-D alloimmunization corresponds to the synthesis of anti-D IgG antibodies in response to the transplacental passage of RhD-positive fetal red blood cells into the maternal circulation. Maternal anti-D antibodies crossing the placenta into the fetal circulation, in turn, cause hemolysis and anemia in the RhD-positive fetus.

[0004] Today, while the potential development of anti-D antibodies in most cases of incompatibility can generally be prevented by effective detection tests and efficient prophylaxis in RHD-negative pregnant women, situations of alloimmunization still exist. In particular, some individuals with a D-positive phenotype can develop anti-D alloantibodies directed against one or more missing epitopes, defining the "partial D" phenotypes, which are distinguished by the presence or absence of one or more D epitopes located in the extracellular loops of the RHD protein (Cartron et al., 1996). The D antigen is therefore a complex antigen, as it is composed of a mosaic of epitopes, at least nine of which (epD1 to epD9) have been identified using a battery of monoclonal antibodies (Tippett et al., 1996).

[0005] Currently, identifying plasma antibodies against Rh antigens requires the use of panels composed of test red blood cells expressing different Rh phenotypes. While most of these phenotypes are common, some correspond to rare blood groups, the availability of which can be a real problem, sometimes making it difficult to identify antibodies against these antigens. Furthermore, the use of panels carries a risk of infectious agents being present in the sample.

[0006] Within the context of transfusion safety and the identification of anti-Rh alloantibodies present in patient serum, we propose to develop new tools enabling their efficient and rapid characterization, independent of the availability of rare blood types. Thus, the production of the RhD protein, and more broadly of the Rh protein, appears as an alternative to overcome these problems in detecting alloantibodies directed against low-prevalence antigens, or even more widespread antigens.

[0007] Since the discovery of the genes encoding the RH proteins, the molecular basis of the RH phenotypes has been identified (Mouro-Chanteloup et al. 1993) and the expression of recombinant RH proteins was carried out in different heterologous systems. Furthermore, techniques for the synthesis of membrane proteins were also described. in vitro,such as the use of nanodiscs (WO2007 / 038755; WO2005 / 081743; WO2015 / 095854) to solubilize and stabilize membrane proteins. To allow the proteins expressed in vitro For nanodiscs to be synthesized in a functional conformation, the lipid composition is essential. Some nanodiscs, particularly commercial ones, do not allow for a conformation that preserves the structure and / or activity of all membrane proteins (Bernhard Frank et al. (2015)). This contrasts with the synthesis of non-erythrocyte Rh proteins (RHCG), whose expression levels have allowed, after extraction from the plasma membrane, functional reconstitution in proteoliposomes (Mouro-Chanteloup). et al.(2010), it proved difficult to obtain significant membrane expression of RHD and RHCE proteins in conformations that preserve antibody-recognized epitopes. Due to their complex oligomeric organization, these proteins can only be expressed in the presence of the associated protein RHAG (RH-Associated Glycoprotein) (Cartron et al. 1999, Mouro-Chanteloup et al. 2002) (Goossens et al., Plos one, 2013). However, it could only be expressed at 10,000 copies / cell (10% of its expression on red blood cells) in heterologous systems. Therefore, these expression levels are not compatible with the use of recombinant RH proteins as a tool for detecting antibodies in patient serum, particularly low-titer or low-affinity antibodies.

[0008] Amino acid sequences of erythrocyte proteins are specifically described in some references, for example: RhCE and RhD (WO 00 / 32632 and WO 99 / 37763), RhAG (WO 2008 / 021290), and UTB (WO 2012 / 095872) but none of these references describes an erythrocyte protein formulated in such a way as to be effectively used in diagnostics.

[0009] Therefore, there is still a need for a system leading to the expression of erythrocyte proteins in a native configuration and at levels sufficient to allow diagnostic use. DESCRIPTION The present invention is described in the set of claims.

[0010] The present invention relates to a system for producing erythrocyte proteins which makes it possible to obtain large quantities of these proteins in their native state.

[0011] While it had not previously been possible to produce erythrocyte proteins such as RhD, RhCE, RhAG and UTB, regardless of the system used, the inventors have shown that it is possible to obtain large quantities of these erythrocyte proteins in a conformation allowing them to retain the epitopes recognized by antibodies, when they are produced in vitro in the presence of detergents, liposomes or nanodiscs, preferably in the presence of nanodiscs with a POPC-type lipid composition.

[0012] The method optimized by the inventors for the cell-free production of erythrocyte proteins such as RhD, RhCE, RhAG, or UTB has made it possible to obtain novel compositions containing these proteins in greater quantities than was possible with prior art methods. Particularly surprising, this method for the cell-free production of erythrocyte proteins such as RhD has eliminated the need for the associated protein RHAG (Rh-Associated Glycoprotein) to produce RhD, contrary to prior art practice (Mouro-Chanteloup et al., Blood 2002; Goossens et al., PLOS ONE, 2013).

[0013] The present invention therefore relates to an acellular system for the production of erythrocyte proteins such as RhD, RhCE, RhAG or UTB characterized by the presence of detergents or liposomes or nanodiscs.

[0014] The term "erythrocyte protein" herein refers to a protein expressed in cells of the erythrocyte lineage. The term "erythrocyte lineage" herein refers to all cell types whose differentiation leads directly or indirectly to red blood cells, including red blood cells. The erythrocyte lineage as defined in the invention includes, among others, proerythroblasts, basophilic erythroblasts, polychromatophilic erythroblasts, acidophilic erythroblasts, reticulocytes, and red blood cells. Preferably, an erythrocyte protein as defined in the invention is a protein that is primarily expressed in the erythrocyte lineage.

[0015] The erythrocyte protein of the invention is, in particular, a membrane protein. This protein may be an integral membrane protein or a membrane-associated protein. Preferably, the erythrocyte protein of the invention is an integral membrane protein; more preferably, it is a polytopic protein; even more preferably, said polytopic protein carries blood group antigens.

[0016] Among the erythrocyte proteins that are particularly relevant to the present invention are RhD, RhCE, RhAG, and UTB proteins, and their variants. Currently, it is impossible to produce these proteins in native form in large quantities. Production of erythrocyte Rh proteins in cellular systems is possible, but with extremely low yields, entirely insufficient for diagnostic use. Furthermore, cellular production requires co-expression with RhAG for the correct targeting of certain proteins (e.g., RhD and RhCE).On the other hand, the method developed by the inventors for the production of integral polytopic proteins of the red blood cell membrane carrying blood group antigens, namely RhAG, RhD, RhCE and UTB, made it possible to obtain novel compositions comprising said proteins in greater quantities than is possible with prior art methods.

[0017] The term "RhD protein" refers to a non-glycosylated membrane protein of 417 amino acids, comprising 12 transmembrane domains, with intracytoplasmic Net C-terminal ends. The D antigen is a collection of conformation-dependent epitopes along the length of the RhD protein. Numerous monoclonal antibodies recognize these conformational epitopes of the RhD protein. These antibodies allow, among other things, verification of the correct folding of the RhD protein or the characterization of its variants (Avent and Reid, 2000). Preferably, the RhD protein has the sequence represented by SEQ ID NO. 5 (NP_001121163). Even more preferably, the RhD protein is encoded by the RHD gene, whose sequence is represented by SEQ ID NO. 1 (NM_001127691).

[0018] The term "RhCE protein" refers to a non-glycosylated membrane protein of 417 amino acids, comprising 12 transmembrane domains, with intracytoplasmic Net C-terminal ends. Preferably, the RhCE protein has the sequence represented by SEQ ID NO. 6 (NP_065231). Even more preferably, the RhCE protein is encoded by the RHCE gene, whose sequence is represented by SEQ ID NO. 2 (NM_020485). The RHCE gene exhibits very high homology with the RHD gene: these two genes share approximately 96% identity.

[0019] The "RhAG protein" as defined in the invention is a glycosylated membrane protein of 409 amino acids, comprising 12 transmembrane domains. This protein has ammonium transport activity. Preferably, the RhAG protein is a protein having the sequence represented by SEQ ID NO. 7 (NP_000315). Even more preferably, the RhAG protein is encoded by the RHAG gene, the sequence of which is represented by SEQ ID NO. 3 (NM_000324).

[0020] The term "UTB protein" refers to a urea transporter with 10 transmembrane domains and intracytoplasmic N- and C-terminal ends. UTB protein carries Kidd antigens. Preferably, UTB protein has the sequence represented by SEQ ID NO. 8 (NP_001122060). Even more preferably, UTB protein is encoded by the SLC14A1 gene, whose sequence is represented by SEQ ID NO. 3 (NM_001128588).

[0021] Numerous phenotypic variants are known for each of these loci, and in particular for the RHD locus (see, for example, Avent and Reid, The Rh blood group system: a review. Blood 95(2):375-387, 2000; The Blood Group Antigen FactsBook, 3rd Edition, Ed.: Marion E. Reid, Christine Lomas-Francis, Martin L. Olsson, Academic Press, 2012, ISBN: 978-0-12-415849-8).

[0022] Here, a "variant" of a given gene or protein is defined as a polynucleotide or polypeptide whose sequence shares at least 95%, preferably 97%, more preferably 98%, and even more preferably 99%, homology with the sequence of said gene or protein, respectively. These variants can arise through at least four mechanisms: (1) chromosomal rearrangements; (2) point mutations resulting in one or more amino acid changes; (3) nonsense mutations; and (4) nucleotide deletions leading to the appearance of stop codons.

[0023] Chromosomal rearrangements affecting the erythrocyte protein genes of the invention are well known. For example, the RHCE and RHD genes, which are very highly homologous (over 96% identity), are arranged in tandem, which facilitates gene rearrangements between these genes and the appearance of "hybrid genes".

[0024] Furthermore, the RHD and RHCE genes exhibit a high degree of polymorphism. Similarly, numerous variants exist for each of the RHAG and SLC14A1 genes. Many mutations in these genes have been described (see, for example: The Blood Group Antigen FactsBook, 3rd Edition, Ed.: Marion E. Reid, Christine Lomas-Francis, Martin L. Olsson, Academic Press, 2012, ISBN: 978-0-12-415849-8). The "Blood Group Antigen Gene Mutation Database" website can also be consulted. (http: / / www.ncbi.nlm.nih.gov / gv / rbc / xstcgi.fcgi?cmd=bgmut / systems _ info&system= rh) which compiles the different mutations observed in each of these genes.

[0025] The method of the invention makes it possible not only to produce each of the RhD, RhCE, and UTB proteins, but also all the variants of each of these proteins. In certain embodiments, the use of codons in the nucleotide sequence encoding the erythrocyte protein of interest is optimized for use in cell-free systems derived from organisms other than humans (for example, bacteria such as E. coli).Codon optimization refers to a process by which a nucleotide sequence encoding a polypeptide of interest is modified to optimize its expression in a particular organism, without affecting the amino acid sequence of the polypeptide itself. A codon is a sequence of three nucleotides translated into a specific amino acid in a cell. It is well known that there are sixty-four possible combinations of three-nucleotide sequences, while there are only twenty naturally occurring amino acids. Consequently, most amino acids are encoded by multiple codons. Some codons in a given species are often better translated than other codons encoding the same amino acid. Furthermore, codon usage preferences vary among species. Therefore, it has been observed that the expression of a gene in one species may not be optimal when that gene is introduced into another species.Those skilled in the art will readily understand that this problem can be overcome by exploiting the degeneracy of the genetic code. Thus, a nucleotide sequence encoding a polypeptide of interest will be modified so that said sequence now contains codons that are used efficiently in the species of interest, but without altering the sequence of the encoded polypeptide. It is possible to determine which codons are most widely used in the organism of interest. This has already been done for a large number of organisms, including those from which the most commonly used cell-free systems are derived (E. coli, rabbit, wheat). Those skilled in the art will therefore be fully capable of determining the use of codons for each organism of interest.

[0026] According to a particular embodiment, these cell-free proteins of the invention are fused to a tagging sequence to facilitate their subsequent recovery and even purification. Such sequences are well known to those skilled in the art. They include the epitopes HA, FLAG, V5, and myc, as well as chitin-binding protein (CBP), maltose-binding protein (MBP), glutathione-S-transferase (GST), and Strep tag. A six-histidine sequence can also be used. These sequences can be added to the N-terminus or C-terminus of the protein of interest.

[0027] This application describes, but does not claim, a process for synthesizing an erythrocyte protein selected from RhD, RhCE, RhAG and UTB, or a variant thereof, said process comprising the following steps: a) the contacting of a nucleic acid encoding said protein or the variant thereof with an acellular protein production system, in the presence of at least one non-ionic detergent, liposomes or nanodiscs; and b) the synthesis of said protein.

[0028] According to a first aspect, the present invention relates to a method for synthesizing an erythrocyte protein selected from RhD, RhCE, RhAG and UTB, or a variant thereof, said method comprising the following steps: a) the contacting of a nucleic acid encoding said protein or a homolog having at least 95% identity with it with an acellular protein production system, in the presence of at least one non-ionic detergent, liposomes or nanodiscs; and b) the synthesis of said protein.

[0029] For the purposes of this invention, a "cell-free protein production system" is defined as a biochemical system that enables the synthesis of a protein in the absence of a cell. The cell-free protein production system as defined in this invention therefore contains all the elements necessary for protein production in the absence of a cell. In particular, this system includes, among other things, the transcriptional and translational machinery derived from the cell.

[0030] These in vitro systems are particularly advantageous because they allow the synthesis of cytotoxic, regulatory, or unstable membrane proteins, which cannot be expressed in living organisms, and therefore not in conventional in vivo systems. In particular, cell-free systems are especially well-suited for the expression of membrane proteins such as the erythrocyte proteins of the invention. Membrane proteins are indeed very difficult to express in cells, as cell membrane expression requires intracellular trafficking and precise targeting. Most techniques applicable to soluble proteins fail to overcome insoluble aggregates, particularly during extraction and purification.In contrast, cell-free systems offer an advantage over conventional protein synthesis systems in that they allow for relatively simple modification of the protein's reaction environment, for example, by adding reagents that promote proper folding. In fact, each reaction parameter (such as pH, redox potential, ionic strength, etc.) can be modified depending on the target protein to be produced. Furthermore, in these systems, the resulting recombinant protein represents the major product of the reaction.

[0031] The template for cell-free protein synthesis can be any type of polynucleotide, RNA or DNA. Preferably, the template used is a DNA molecule. In this case, the cell-free system converts the information contained in the DNA template into protein through the coupling of transcription and translation reactions.

[0032] The coupled system, notably used in E. coli systems, continuously generates mRNA from a DNA template comprising a recognizable promoter. While an endogenous RNA polymerase can be used in this system, it is preferable to add an exogenous RNA polymerase, typically that of phage T7 or phage SP6, to the reaction mixture. The system can be used with any gene of interest. In particular, the DNA template according to the invention includes an expression cassette for expressing the erythrocyte protein of interest.

[0033] By "expression cassette" we mean here a fragment of DNA comprising a polynucleotide of interest, for example a polynucleotide encoding one of the erythrocyte proteins of the invention, functionally linked to one or more regulatory elements controlling the expression of gene sequences, such as, for example, promoter sequences and "enhancer" sequences.

[0034] A polynucleotide is "functionally linked" to regulatory elements when these different nucleic acid sequences are associated on a single nucleic acid fragment in such a way that the function of one is affected by the others. For example, a regulatory DNA sequence is "functionally linked" to a DNA sequence encoding an RNA or a protein if the two sequences are located such that the regulatory DNA sequence affects the expression of the coding DNA sequence (in other words, the coding DNA sequence is under the transcriptional control of the promoter). Coding sequences can be functionally linked to regulatory sequences in both a forward and an antisense orientation. Preferably, the coding sequences of the invention are functionally linked to the regulatory sequences in the forward orientation.

[0035] The terms "regulatory sequences" or "regulatory elements" refer to polynucleotide sequences that are necessary to affect the expression and maturation of the coding sequences to which they are ligated. Such regulatory sequences include, among others, transcription initiation and termination sequences, promoter and enhancer sequences; efficient RNA maturation signals, such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNAs; sequences that improve translational efficiency (e.g., Kozak sequences); sequences that increase protein stability; and, if necessary, sequences that increase protein secretion.

[0036] Preferably, the regulatory sequences of the invention include promoter sequences; that is, the gene encoding the erythrocyte protein of the invention is preferably functionally linked to a promoter that allows the expression of the corresponding mRNA. A gene encoding an erythrocyte protein is preferably functionally linked to a promoter when it is located downstream of the latter, thus forming an expression cassette.

[0037] The term "promoter" here refers to a nucleotide sequence, most often located upstream (5') of the coding sequence, which is recognized by RNA polymerase and other factors necessary for transcription, and thus controls the expression of said coding sequence. A "promoter" as understood here includes, in particular, minimal promoters, that is, short DNA sequences composed of a TATA box and other sequences that specify the transcription start site. A "promoter" within the meaning of the invention also includes nucleotide sequences comprising a minimal promoter and regulatory elements capable of controlling the expression of a coding sequence. For example, the promoter sequences of the invention may contain regulatory sequences such as "enhancer" sequences that can influence the level of gene expression.

[0038] Advantageously, the promoters according to the invention are those that interact with the RNA polymerase used in the cell-free system of interest. For example, promoters recognized by the RNA polymerases of SP6 and T7 phages are widely known to those skilled in the art. Thus, pIVEX vectors carrying promoters recognized by T7 RNA polymerase (Rogé and Betton, 2005) were used in the experimental section below. Vectors containing such promoters are also commercially available.

[0039] According to the invention, detergents, liposomes, or nanodiscs are added to the reaction medium, either during protein synthesis or preferably before it even begins. This lipid addition is preferably made at a rate of a few milligrams per ml of reaction medium, generally between 0.5 and 10 mg / ml.

[0040] The term "detergent" as used here refers to an amphipathic molecule containing both hydrophobic and hydrophilic groups. These molecules contain a polar hydrophilic group and a long hydrophobic carbon chain. A "nonionic detergent" is defined as a molecule containing a detergent whose hydrophilic group is uncharged. Non-ionic detergents within the meaning of the invention include, among others, alkyl polyglucosides, octaethylene glycol monododecyl ether (C12E8), Brij family detergents such as, for example, Brij 35 (C12E23 polyoxyethylene glycol dodecyl ether) or Brij 58 (C16E20 polyoxyethylene glycol dodecyl ether), Genapol, glucanids such as MEGA-8, -9, -10 octylglucoside, Pluronic F127, Triton family detergents such as Triton X-100 (C14H22O(C2H4O)n) or Triton X-114 (C24H42O6), and Tween family detergents, notably Tween 20 (polysorbate 20) and Tween 80. (Polysorbate 80).Preferably, the non-ionic detergent of the invention is chosen from Brij 35 and Brij 58. More preferably, the non-ionic detergent of the invention is Brij 35.

[0041] According to this preferred embodiment, the invention therefore relates to a process as described above, in which the contacting according to step a) is carried out in the presence of at least one non-ionic detergent selected from Brij 35 or Brij 58.

[0042] The most effective detergent concentrations for producing erythrocyte proteins according to the method of the invention vary from one detergent to another. They vary depending on the critical low micellar concentration of the detergent, that is, the concentration at which micelles form. Nevertheless, these concentrations are typically between 0.1 and 5%, more particularly between 0.1 and 1%. For example, Brij 35 and Brij 58 are typically used at 0.5%. Depending on whether the detergent is solid or liquid, % refers to a w / v or v / v ratio, respectively.

[0043] The term "liposome" here refers to an artificial vesicle formed by concentric lipid bilayers, enclosing aqueous compartments between them. Liposomes can be composed of any suitable lipid, including, but not limited to, polar lipids such as phospholipids, phosphoglycerides such as phosphatidylethanolamine, phosphatidylcholine, phosphatidylserine, cardiolipin, or combinations thereof. Other lipid compounds can also be incorporated into liposomes, such as triacylglycerols, waxes, sphingolipids, and sterols and their fatty acid esters, or combinations thereof.

[0044] Lipid vesicles correspond to lipid bilayers in the form of spheres with a diameter of approximately 100 nm, prepared using protocols known to those skilled in the art.

[0045] These lipid vesicles can be treated with detergents before being introduced into the reaction medium. In one embodiment, the lipid vesicles used are of natural origin, preferably derived from soy or eggs. Such lipids are commercially available from Avanti Polar Lipids, which is resold by Coger in France. Alternatively, the lipid vesicles can be liposomes of synthetic origin, that is, produced from synthetic lipids.

[0046] According to a preferred embodiment and in particular in the case of synthetic lipids, the liposomes implemented within the framework of the invention carry polyethylene glycol (PEG) molecules, or PEG derivatives (functionalized PEG) such as N-carbonyl-methoxy-polyethylene glycol 2000.

[0047] The term "nanodisc" as used here refers to at least one lipid bilayer stabilized by a protein scaffold. Preferably, this scaffold surrounds the lipid bilayer to form a discoidal structure.

[0048] The term "lipids" here refers to any naturally occurring fat-soluble (i.e., lipophilic) molecule. Lipids are a heterogeneous group of compounds with many essential biological functions. These compounds act as structural components of cell membranes, energy storage sources, and intermediate molecules in signaling pathways. Lipids can be defined as small hydrophobic or amphiphilic molecules that originate entirely or partially from ketoacyl or isoprene groups. For a comprehensive overview of all lipid classes, see the "Lipid Metabolites and Pathways Strategy (LIPID MAPS) classification system" (National Institute of General Medical Sciences, Bethesda, MD). Lipids can form micelles, monolayer membranes, and bilayer membranes.Lipids can self-assemble, possibly in combination with other components, to form nanodiscs. Lipids as defined in the invention include fats, waxes, phospholipids, sphingolipids (such as sphingomyelin), sterols (such as cholesterol), cerebrosides, and compounds derived from each of these lipid groups. The lipids used in the nanodiscs as defined in the invention are preferably phospholipids. A "phospholipid" as defined in the invention is a lipid containing a phosphoric acid group as a mono- or diester.The phospholipids that can be used in the nanodiscs of the invention include synthetic and natural saturated and unsaturated phospholipids, their derivatives (e.g., acyl, diethyl, and lyso), and any combination of phospholipids of different or identical classes that can promote good insertion and conformation of the expressed protein and, consequently, its recognition by ligands or antibodies. Phospholipids include, among others, phosphatidylcholine, phosphatidic acid, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylserine, phosphatidylinositol, phosphatidylinositol phosphate, cardiolipin, and their derivatives. In a preferred embodiment, the phospholipids include dioleoyl, dimyristoyl, palmitoyl-oleoyl glycero-phosphocholines (DOPC, DMPC, POPC), palmitoyl-oleoyl, dimyristoyl and dioleoyl phosphoglycerol (POPG, DMPG and DOPG).In a more preferred embodiment, the phospholipids comprise dioleoyl, dimyristoyl, palmitoyl-oleoyl glycerophosphocholines (DOPC, DMPC, POPC). According to a particularly advantageous embodiment, the phospholipids of the invention are combined with sodium cholate. According to this embodiment, the removal of this salt, for example by dialysis, makes it possible to obtain nanodiscs from the phospholipids and the protein scaffold of the invention.

[0049] The term "protein scaffold" as used herein encompasses any protein capable of assembling with an amphipathic lipid in an aqueous environment and organizing said amphipathic lipid into a bilayer. Preferably, the protein scaffold of the present invention shall be amphipathic, with one part of its structure being more or less hydrophilic and facing the aqueous solvent, and the other part more or less hydrophobic and facing the center of the hydrophobic bilayer, which is thus stabilized. The term "protein scaffold" therefore includes, but is not limited to, apolipoproteins, lipophorins, their derivatives (such as, for example, truncated sequences organized in tandem), and their fragments (i.e., peptides), such as apolipoprotein E4, fragment 22K, lipophorin III, apolipoprotein AI, and similar molecules.The protein framework can also be composed of artificial amphipathic peptides specifically designed for this purpose. In certain particular embodiments, these peptides are helical amphipathic peptides that mimic the alpha helices of an apolipoprotein, oriented perpendicular to the fatty acid chains of amphipathic lipids, particularly phospholipids. Such peptides are described in application WO 2008 / 141230 A1.

[0050] Preferably, the protein framework of the nanodiscs of the invention consists of the MSP1 protein, or a derivative thereof. MSP1 is a truncated form of apolipoprotein AI, which has the same helical amphipathic structure as the complete protein. The MSP1 protein has the sequence: GLKLLSNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKW QEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRL AARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNT Q (SEQ ID NO. 9).

[0051] Derivatives of this protein have been constructed (see, for example, Grinkova et al., 2010, WO 02 / 40501, WO 2005 / 081743, US 7,083,958 B2). Some of these derivatives include sequences that allow for easy purification of the protein and the nanodiscs in which it is incorporated. Thus, a tagging sequence can be added to the protein. Such sequences are well known to those skilled in the art. They include the epitopes HA, FLAG, V5, or myc, as well as chitin-binding protein (CBP), maltose-binding protein (MBP), glutathione-S-transferase (GST), and Strep tag, or a 6-histidine sequence. For example, a 6-histidine sequence can be fused to the N-terminus of the MSP1 protein. Some MSP1 derivatives contain a TEV protease-recognized site that has been modified to allow for complete and specific cleavage. MSP1 derivatives may also include an additional Δ(1-11) truncation at the N-terminus of MSP1.This truncation results in more stable disks, as the entire first helix is ​​not required for lipid interaction. The M1PD1 protein (SEQ ID NO. 10) thus comprises the Δ(1-11) truncation fused at its N-terminus to a His6 sequence and a TEV site. The MSP1D1 protein generates nanodiscs with a diameter of approximately 9.7 nm, which typically contain between 120 and 160 lipid molecules and two MSPs per nanodisc. Another derivative commonly used by those skilled in the art is the MSP1E3D1 protein (SEQ ID NO. 11), which incorporates the insertion of three additional helices (helices 4, 5, and 6) between helices 3 and 4 of the MSP1D1 protein. This protein therefore comprises a duplication of helices 4, 5, and 6 of the MSP1D1 protein. As a result, it generates nanodiscs that are larger than those obtained with the MSP1D1 protein: approximately 12.9 nm. These two derivatives, MSP1D1 and MSP1E3D1, are the most commonly used to generate nanodiscs.They are both commercially available (from Sigma-Aldrich or Cube Biotech, among others). Preferably, the MSP protein of the invention is a protein having a sequence selected from SEQ ID NO. 9, 10, or 11.

[0052] According to this preferred embodiment, the invention relates to a process as described above, in which the contact according to step a) is made in the presence of nanodiscs comprising an MSP protein chosen from the proteins of SEQ ID NO. 9, 10 or 11.

[0053] The invention therefore relates to a process as described above, in which the contacting according to step a) is carried out in the presence of at least one non-ionic detergent selected from Brij 35 or Brij 58, or of nanodiscs comprising an MSP protein chosen from the proteins of SEQ ID NO. 9, 10 or 11.

[0054] The inventors have shown that the use of nanodiscs makes it possible to produce the erythrocyte proteins of the invention in soluble form and in large quantities. In particular, they have shown that it is important to use an appropriate nanodisc concentration to optimize production. In this regard, a nanodisc concentration below 80 µM is particularly suitable for obtaining a large quantity of protein in soluble form. For example, nanodisc concentrations of 20 µM, 40 µM, or 60 µM allow yields to be obtained at least as good as those obtained in the presence of detergent.

[0055] The methods for generating nanodiscs using lipids, preferably phospholipids, and a protein that can form a framework are well known to those skilled in the art (see, for example, Denisov et al., 2004). We will therefore not detail them here, but we will simply note that, in addition, numerous companies offer nanodiscs (for example, Cube Biotech, Sigma Aldrich, Nanodiscs Inc.).

[0056] The basic principle of the cell-free system is the use of an organism's transcriptional and translational machinery to produce a specific recombinant protein from exogenous genetic information. The organisms from which this machinery is extracted are numerous and varied, and come from both prokaryotic and eukaryotic organisms.

[0057] Such systems have been well known to those skilled in the art for several decades (for a review, see, for example, Carlson et al., 2012). Numerous methods are available for synthesizing proteins in cell-free systems (see, for example, Cell-free protein synthesis: Methods and protocols, edited by Alexander S. Spirin and James R. Swartz, 2008, Wiley-VCH, Weinheim, Germany). It is also possible to use kits offered by many companies: Qiagen, Ambion, Promega, Invitrogen, Thermo Scientific, Roche Diagnostics, CellFree Sciences & Co., etc.

[0058] Preferably, the cell-free protein production systems of the invention comprise cell extracts. Although any organism can be used as a source of cell extracts, it is preferable to use extracts from the bacterium Escherichia coli, rabbit reticulocytes, wheat germ, or insect cells. E. coli extracts are particularly advantageous. First, those skilled in the art already have extensive experience with this system, which is by far the most popular. These extracts can be prepared easily and at low cost. They allow for very high yields at a lower energy cost than other systems. This system is readily available commercially, as several companies currently market cell-free protein expression kits using E. coli extracts: Qiagen, Promega, Invitrogen, Thermo Scientific, Roche Diagnostics, etc.

[0059] There are two ways to perform the cell-free reaction. In batch reactions, transcription and translation are carried out in a reaction volume containing all the necessary components. For various reasons, such as rapid depletion of the energy supply, degradation of components like nucleotides, and decreasing concentrations of free Mg2+ ions, the reaction in the batch system typically reaches a plateau after about 1–2 hours. Using an optimized in vitro batch expression system generally yields up to 500 µg of protein / ml, although higher values ​​can sometimes be achieved with further optimization.

[0060] In a dialysis mode, the cell-free transcription / translation reaction is carried out in a small reaction chamber which is separated by a dialysis membrane (usually 10-15 kDa cutoff) from a reservoir approximately 10-20 times larger containing low molecular weight reagents.

[0061] In the first of the dialysis-mode systems, the Continuous Flow Cell Free (CFCF) cell-free production system, the reaction medium is sequestered by an ultrafiltration membrane and continuously fed by a pump. This membrane allows the protein of interest to pass into the buffer compartment and thus be recovered while continuing to feed the reaction, enabling reactions to be carried out for several tens of hours.

[0062] In a Continuous Exchange Cell Free (CECF) cell-free production system, the reaction compartment containing the cell lysate and genetic information is separated by a dialysis membrane from a nutrient compartment containing cofactors, amino acids, buffers, and other components. The dialysis membrane allows waste molecules to exit while permitting the entry of components necessary for the reaction to proceed, driven by the concentration gradient resulting from the synthesis activity. This configuration significantly increases reaction time and protein production levels. Yields of up to 5 mg / ml in the reaction volume have been reported for the E. coli system using this method, both with a commercial system (RTS, Roche Applied Science) and in-house systems.

[0063] The cell-free system of the invention is a batch or dialysis-mode system. Preferably, this system is a dialysis-mode system. More preferably, this system is a continuous exchange cell-free production system.

[0064] The advantage of the cell-free system is that it offers the possibility of precisely controlling the reaction parameters. Besides extracts, cell-free protein production systems include several components whose concentration can be critical to reaction efficiency.

[0065] Divalent magnesium ions (Mg²⁺) are essential in a large number of biological reactions. In this case, the inventors have shown that a magnesium concentration between 14 and 22 mM, preferably between 16 and 20 mM, allows for significant yields of erythrocyte proteins. The cell-free protein production system according to the invention thus comprises a magnesium concentration between 14 and 22 mM, preferably between 16 and 20 mM.

[0066] Other salts, particularly those of biological relevance such as manganese, may also be added. Potassium is usually present at a concentration of at least about 50 mM and no more than about 250 mM. Ammonium may be present, usually at a concentration below 200 mM, but more commonly below about 100 mM. The reaction is typically maintained in the pH range of about 5 to 10 and a temperature of about 20–50°C; more commonly, in the pH range of about 6–9 and a temperature of about 25–40°C. Advantageously, the reaction is carried out at pH 7.5. Furthermore, a temperature of 20°C is particularly advantageous for this reaction. These ranges may be extended for specific conditions of interest.

[0067] Conversely, adding exogenous cofactors for oxidative phosphorylation activation is unnecessary. Compounds such as nicotinamide adenine dinucleotide (NADH), NAD+, or acetyl-coenzyme A can be used to supplement protein synthesis yields but are not required. The addition of oxalic acid, an inhibitor of phosphoenolpyruvate synthetase (Pps) metabolism, can be beneficial in increasing protein yields but is not necessary.

[0068] The erythrocyte proteins obtainable according to the process of the invention are membrane proteins. It is important that the membrane proteins produced in the cell-free system be correctly folded and functional. In particular, it is important to avoid the formation of aggregates. In this regard, the inventors have shown that a reaction time of between 2 and 24 hours, preferably between 6 and 12 hours, and more preferably around 8 hours, maximizes the yield while avoiding aggregates.

[0069] According to a particular embodiment, the process of the invention includes a step for recovering the produced protein. This step can be facilitated by the use of a tagging sequence. In another particular embodiment, this sequence is fused to the erythrocyte protein of interest. It should be noted that, when the erythrocyte protein obtainable according to the process of the invention is produced in the presence of nanodiscs, it may be advantageous to fuse the protein composing the nanodiscs to a tagging sequence and use it to recover the protein of the invention.

[0070] The isolation (or purification) of the erythrocyte protein obtainable according to the process of the invention can be carried out by any means known to those skilled in the art. Examples include differential precipitation or ultracentrifugation. It may also be advantageous to purify the fragments of interest by ion-exchange chromatography, affinity chromatography, molecular sieving, or isofocusing. All these techniques are described in Voet D and Voet JG, Techniques for the Purification of Proteins and Nucleic Acids, Chapter 6, Biochemistry, 2nd edition. Preferably, the protein of interest can be recovered by immunoprecipitation using, for example, antibodies directed against that protein. Alternatively, the protein of interest can, if necessary, be isolated by affinity chromatography using the labeling sequence.

[0071] It can be particularly useful in certain applications to couple the erythrocyte protein of interest to a solid support: for example, to detect antibodies against alloantigens carried by the protein in a subject's serum. The coupling of said protein can be direct or indirect. The protein is coupled directly when it interacts with the solid support without the intermediary of another protein. This is the case, for example, when coupling is achieved via antibodies directed against the protein of interest. It is also the case when the protein of interest is itself fused to a tagging sequence. Indirect coupling, as defined in the invention, means coupling mediated by another protein, for example, by the MSP or by a fusion between an MSP protein and a tagging sequence.In this case, the other protein is coupled to the solid substrate, and the protein of interest is itself coupled to the substrate only to the extent that it interacts with the other protein. Thus, for example, the protein of interest is indirectly coupled to a solid substrate when expressed in nanodiscs in which the MSP protein is bound to said solid substrate. This coupling mode can be advantageous because it avoids disrupting the three-dimensional organization of the protein of interest.

[0072] According to this particular embodiment, the process of the invention includes an additional step of fixing the erythrocyte protein, or its variant, and / or the MSP protein to a solid support. Advantageously, a compound that interacts specifically with the erythrocyte protein, or its variant, and / or the MSP protein is grafted onto said solid support. This compound is, for example, an antibody directed against the erythrocyte protein of interest or against the MSP protein. Preferably, this compound is recognized by the tagging sequence present in the erythrocyte protein, or its variant, and / or the MSP protein. This compound may be an antibody recognizing a specific epitope, such as the HA, FLAG, V5, or myc epitopes. It may also be a sugar (chitin or maltose, for example) or a metabolite (such as glutathione) that is bound by a protein (CBP, MBP, and GST, respectively).This compound can also be a peptide, possibly genetically modified, which is recognized and bound by a specific peptide sequence: for example, the Strep-Tactin peptide is derived from streptavidin through genetic modification and is bound by a specific sequence, the Strep-tag. Finally, this compound can be a divalent ion such as Ni2+, which is bound by a sequence of six histidines. The methods for coupling these compounds to solid supports are well known to those skilled in the art. Therefore, they will not be detailed here.

[0073] The solid support that can be used in the present invention is not limited in any way, as long as it is a solid support or made of an insoluble material (for example, a material that can be separated from a reaction mixture by filtration, precipitation, magnetic separation or any other suitable technique).

[0074] The materials that constitute said solid support include, but are not limited to, cellulose, Teflon™, nitrocellulose, agarose, dextran, chitosan, polystyrene, polyacrylamide, polyester, polycarbonate, polyamide, polypropylene, nylon, polydivinylidene difluoride, latex, silica, glass, fiberglass, gold, platinum, silver, copper, iron, stainless steel, ferrite, silicon wafer, polyethylene, polyethyleneimine, polylactic acid, resins, polysaccharides, proteins (e.g., albumin), carbon, and combinations thereof.

[0075] The solid support can have any shape, including but not limited to that of a sphere, magnetic sphere, thin film, microtube, filter, plate, microplate, carbon nanotube, sensor chip, etc. Flat solid supports such as films or thin plates can also include wells, channels, filter bottoms, or other features, as is known in the art. In fact, the solid support can be any surface to which the compound recognized by the labeling sequence can bind. The solid support according to the invention includes, among other things, microtiter plates, spheres, discs, chips, slides, and any other suitable support.

[0076] In one embodiment of the present invention, the solid support consists of magnetic beads having a spherical diameter of between approximately 25 nm and approximately 1 mm. In a preferred embodiment, the magnetic beads have a diameter of between approximately 50 nm and approximately 10 µm. The size of the magnetic beads can be chosen according to the intended use.

[0077] According to another embodiment of the present invention, the solid support consists of beads made of highly cross-linked spherical agarose (for example, Sepharose). Preferably, said beads have a diameter of between approximately 24 µm and approximately 165 µm. In a more preferred embodiment, said beads have a diameter of between approximately 24 µm and approximately 44 µm. The size of these highly cross-linked spherical agarose beads can be chosen according to the intended use.

[0078] Solid supports with a hydrophobic surface include, among others, polystyrene latex beads, such as those commercially available from Polysciences, Warrington, PA or Spherotech, Liberville, IL.

[0079] Examples of impregnated silica (SiO2) or solid-supported silica (SiO2) include superparamagnetic silica beads available from Polysciences, Warrington, PA. M-280, commercially available from Dynal Biotech, is another option.

[0080] Magnetic beads having a hydrophilic surface can be used in the method of the present invention. Examples of such magnetic beads include commercially available Biomag® carboxyl beads from Polysciences, Warrington, PA, or MC02N LAST / 2928 beads from Bangs Laboratory, Inc., Fishers, IN. M-270, commercially available from Dynal Biotech, etc., can also be used.

[0081] Also described herein is an erythrocyte protein expressed in a nanodisc, a liposome or a non-ionic detergent, or a homolog having at least 95% identity with it, said protein or its variant being capable of being obtained by the above process.

[0082] The erythrocyte protein is selected from RhD, RhCE, RhAG, and UTB, or a variant thereof, said protein or its variant being obtainable by the above process, and is coupled to a solid support. Advantageously, the erythrocyte protein according to the invention is selected from RhD, RhCE, RhAG, and UTB, or a homolog having at least 95% identity therein, said protein or its homolog being obtainable by the process according to the invention, and is coupled to a solid support. The erythrocyte protein thus obtained is correctly folded, unlike the prior art of extracting proteins from red blood cells without preserving the conformation. The inventors have indeed shown that the RhD protein produced by the process of the invention is recognized by conformational antibodies commonly used to characterize the native endogenous protein.Advantageously, the erythrocyte protein obtained by the process of the invention is functional.

[0083] Furthermore, a composition comprising an erythrocyte protein selected from RhD, RhCE, RhAG, and UTB, or a variant thereof, is described here. Preferably, the concentration of the protein in this composition is greater than 0.01 mg / ml, more preferably greater than 0.1 mg / ml, even more preferably greater than 0.5 mg / ml, and even more preferably greater than 1 mg / ml.

[0084] The use of liposomes or nanodiscs in the process of the invention generates particles, proteoliposomes, or nanodiscs of lipids and proteins, comprising both the erythrocyte protein of interest and lipids. The invention therefore relates, in another aspect, to a composition comprising an erythrocyte protein selected from RhD, RhCE, RhAG, and UTB, or a variant thereof, and one or more lipids. Preferably, the concentration of the protein in this composition is greater than 0.01 mg / ml, more preferably greater than 0.1 mg / ml, even more preferably greater than 0.5 mg / ml, and still more preferably greater than 1 mg / ml.

[0085] In yet another aspect, the invention relates to a composition comprising an erythrocyte protein selected from RhD, RhCE, RhAG, and UTB, or a variant thereof, and an MSP protein selected from SEQ ID proteins NO. 9, 10, or 11. Such a composition is obtained, in particular, when nanodiscs are used in the process of the invention. Preferably, the composition of the invention also comprises lipids. Preferably, the concentration of the erythrocyte protein in such a composition is greater than 0.01 mg / ml, more preferably greater than 0.1 mg / ml, even more preferably greater than 0.5 mg / ml, and still more preferably greater than 1 mg / ml.

[0086] An erythrocyte protein selected from RhD, RhCE, RhAG, and UTB, or a variant thereof, characterized in that said protein is coupled to a solid support, is also described here. The coupling of said protein may be direct or indirect, as explained above.

[0087] The proteins obtainable according to the process of the invention are particularly important because they can be easily used in a test for detecting anti-erythrocyte alloantibodies. These are antibodies directed against antigens present on the surface of erythrocytes and can induce their hemolysis. Anti-erythrocyte alloantibodies are produced against foreign erythrocyte antigens. Immunization occurs, for example, during a blood transfusion, during pregnancy, or at birth. If such IgG antibodies cross the placental barrier, they can induce accelerated destruction of the infant's erythrocytes or block fetal erythropoiesis.

[0088] According to this new aspect of the invention, the object of this invention is the use of an erythrocyte protein formulated in the form of a proteoliposome or of a composition comprising such an erythrocyte protein in an alloantibody detection test.

[0089] The presence of such alloantibodies in a biological sample from a subject includes, in particular, bringing said sample into contact with an erythrocyte protein or a composition including an erythrocyte protein as described above, followed by the detection, where appropriate, of the interaction between the erythrocyte protein and antibodies directed against it.

[0090] The term "subject" herein means a mammal, preferably a person such as, for example, a pregnant woman or a transfused patient. As used herein, the term "biological sample" or "sample" refers to a whole organism or a subset of its tissues, cells, or parts thereof. Furthermore, "biological sample" refers to a homogenate, lysate, or extract prepared from a whole organism or a subset of its tissues, cells, or components, or a fraction or part thereof. Preferably, a "biological sample" according to the invention is any tissue that can contain alloantibodies. "Biological sample" thus includes, for example, humoral samples such as blood, bone marrow fluid, and lymphatic fluid, and solid samples such as lymph nodes, blood vessels, bone marrow, brain, spleen, and skin.More preferably, the biological sample of the invention is a sample of blood, plasma, or bone marrow.

[0091] The interaction between the erythrocyte protein of interest and the corresponding alloantibodies is detected by any means known to those skilled in the art. In particular, they may use well-known technologies such as immunoprecipitation, immunohistochemistry, western blot, dot blot, ELISA or ELISPOT, protein microarrays, antibody microarrays, or tissue microarrays coupled with immunohistochemistry.Other techniques that can be used include FRET or BRET techniques, microscopy or histochemistry methods, including confocal microscopy and electron microscopy, methods based on the use of one or more excitation wavelengths and a suitable optical method, such as an electrochemical method (voltammetry and amperometry techniques), the atomic force microscope, and radio frequency methods, such as multipolar, confocal and non-confocal resonance spectroscopy, fluorescence detection, luminescence, chemiluminescence, absorbance, reflectance, transmittance, and birefringence or refractive index (e.g., by surface plasmon resonance, ellipsometry, resonant mirror method, etc.).), flow cytometry, radioisotope or magnetic resonance imaging, SDS-PAGE analysis; HPLC-Mass spectrophotometry, liquid chromatography / mass spectrophotometry / mass spectrometry (LC-MS / MS). All these techniques are well known to those skilled in the art and it is not necessary to detail them here.

[0092] The invention will be described more precisely by means of the examples below. FIGURE CAPTIONS

[0093] Figure 1 . Detection of the RHD protein by Western blot. Total proteins from the different syntheses were separated by centrifugation into soluble and insoluble fractions. The RHD protein was detected using the LOR15C9 antibody and an anti-human secondary antibody conjugated to HRP (1 / 1000). Molecular weight markers (kDa) are indicated on the left and right. Figure 2 .Purification of the protein produced in the presence of 0.5% Brij 35 using HA agarose. Western blot analysis of the purification steps using an anti-HA antibody (1 / 2000) (A) and analysis of the eluate by silver nitrate staining (B). The SM fraction corresponds to the in vitro synthesis product of the RHD protein, NR: Fraction not retained by the resin, E: Eluate, LE: Elution wash, and MW: Molecular weight marker (kDa). Figure 3 Detection of RHD and MSP proteins by Western blot. Analysis of RHD protein synthesis products in the presence of nanodiscs or Brij 35. (A) RHD protein was detected by the LOR 15C9 antibody and an anti-human secondary antibody coupled to HRP (1 / 1000). (B) MSP protein was detected by an anti-His antibody coupled to HRP (1 / 1000). MW corresponds to the molecular weight marker (kDa). Figure 4 .Detection of RHD and MSP proteins by Western blot. Analysis of soluble and insoluble fractions of RHD protein production in the presence of 50 µM nanodiscs (N1, N2) or in the presence of 0.5% Brij 35. (A) Detection of RHD protein by the LOR 15C9 antibody and an anti-human secondary antibody coupled to HRP (1 / 800). (B) Detection of MSP protein from the nanodiscs by an anti-His antibody coupled to HRP (1 / 10,000). MW corresponds to the molecular weight marker (kDa). Figure 5 .Detection of RHD and MSP proteins by Western blot. Analysis of the different steps of the purification of RHD protein produced in the presence of 40 µM nanodiscs (IP Anti-RHD Cter), and comparison with the elution fractions of RHD proteins produced in the presence of 20 and 60 µM (IP Anti-HA). (A) Detection of RHD protein by the LOR 15C9 antibody and an anti-human HRP-coupled secondary antibody (1 / 800). (B) Detection of MSP protein from the nanodiscs by an anti-His HRP-coupled antibody (1 / 10,000). The SM fraction corresponds to the in vitro synthesis product of the RHD protein, NR: the fraction not retained by the resin, L1, L2, L3, the fractions of the different washes, E 20 / 40 / 60: the elution fractions, MW, molecular weight marker (kDa). Figure 6 .DetectionRHD and MSP proteins by Western blot. Analysis of fractions 1-11 of the sucrose gradient: (A) Detection of RHD protein by the LOR 15C9 antibody and an anti-human secondary antibody coupled to HRP (1 / 800). (B) MSP protein from the nanodiscs is detected by an anti-His antibody coupled to HRP (1 / 10,000). MW corresponds to the molecular weight marker (kDa). P Ctrl: RHD protein produced in the presence of Brij 35; N Ctrl: nanodiscs alone. Figure 7 .Demonstration of RHD protein recognition by different antibodies: Flow cytometry analysis was performed on red blood cells incubated with different antibodies. (A)(B) Quantitative analysis of recognition by anti-ep D2 and anti-ep D5 antibodies of Rh-negative red blood cells used as a negative control. (C)(D) Quantitative analysis of recognition of Rh-positive red blood cells by anti-ep D2 and anti-ep D5 antibodies. (E)(F) Selection of the studied populations and subpopulations. EXAMPLES Materials and methods I. Equipment

[0094] The RTS 100 Kit E. coliHY stored at -20°C is supplied by 5 PRIME. The MSP1E3D1-His_POPC nanodiscs (500 µM) stored at -80°C are from Cube Biotech. The ELISA plates used are Nunc MaxiSorp 96-well type (Dutscher) and the FACS plates from Corning. The protein A sepharose 4B resin is from GE Healthcare Life Sciences. The agarose HA resin and the detergents (C12E8, Brij35, Brij58) at 20% and stored at -20°C are from Sigma-Aldrich.

[0095] The rabbit polyclonal antibody MPC8 recognizes residues 408–416 of the C-terminal region of the RHD protein (Apoil et al., 1997), while the LOR 15C9 antibody is a monoclonal antibody (Apoil et al., 1997) that recognizes residues 320–331 and 350–354 of the RHD protein. Secondary antibodies coupled to HRP (Horse Radish Peroxidase) against human IgG were obtained from PARIS (Western blot) and Jackson (ELISA). A murine anti-Penta-His antibody conjugated to HRP is provided with the Qiagen RGS·His HRP Conjugate Kit. A goat anti-human IgG antibody is coupled to R-Phycoerythrin (PE) (Beckman).

[0096] A custom pIVEX-HA vector was developed for the expression of the RHD protein in a cell-free system. It was generated by substituting the His tag of the pIVEX2.3d (5 PRIME) vector with an HA tag, resulting in a protein fused to a C-terminal HA tag. II. Methods II.1. Cell-free expression of the protein

[0097] The principle of expression in vitro The protein synthesis process involves introducing plasmid DNA containing the open reading frame, encoding the protein of interest, into a reaction medium containing the elements necessary for protein synthesis. All the transcriptional and translational machinery is provided by the S30 cell lysate. of E. coli.

[0098] Two types of systems were used. The first system, where all components are mixed in a single compartment (batch method), is used for screening different expression conditions. The second system is the CECF. (Continuous Exchange Cell Free)(Shirokov et al., 2007), where protein synthesis takes place in a compartment separated from a reservoir by a semi-permeable membrane, allowing for the dilution of waste products and the provision of substrates. The CECF system has been used for large-scale protein production because protein expression is continuous, lasting up to 24 hours, with a higher yield compared to batch systems. II.1.A Protein expression in the "Batch" system

[0099] The experimental protocol developed by 5PRIME allows for the synthesis of the protein on a small scale in a volume of 50 µl in the RTS 100 kit. E. coliHY. The RTS 100 kit and the MSP1E3D1-His_POPC nanodiscs (500 µM) or the 20% detergent (C 12 E 8, Brij 35, Brij 58) are thawed on ice. The reaction mixture (E. coli lysate 12 µl; energy mix 10 µl; amino acids 12 µl; methionine 1 µl; reconstitution buffer 5 µl) required for the production of the RhD protein in the presence of nanodiscs is prepared in an Eppendorf tube at room temperature. The 50 µl mixture is then incubated with stirring in an Eppendorf thermomixer at 30°C, 750 rpm for 5 hours.

[0100] After expression, the mixture is centrifuged for 10 minutes at 22000g at 4°C to separate the soluble fraction (the supernatant) from the insoluble fraction (the pellet). II.1.B Protein Expression in CECF system

[0101] The CECF system was used for protein production in the presence of detergent or nanodiscs in a large volume (1-2 ml). The reactions were carried out in the proportions indicated in the appendix. II.2. Purification II.2.A Immunoprecipitation with HA agarose

[0102] To immunoprecipitate the RHD-HA protein produced in the presence of detergent (condition 1) or nanodiscs (condition 2) (Table 1) 1 ml of the soluble fraction of the production in vitrois added to 250 µl (1 CV) of anti-HA agarose beads pre-washed with buffer A1 or A2. The tube is incubated under rotation at 4°C overnight. The unretained fraction is then recovered by centrifugation at 2000 g for 10 minutes at 4°C. Subsequently, several washes are performed with buffer A1 or A2 (18 CV) and then buffer B1 or B2 (28 CV). To perform the washes, the tubes are centrifuged at 5200 g for 5 minutes at 4°C, and the supernatant is removed. After the last wash, the beads to which the proteins are bound are resuspended and incubated under rotation for 4 hours at 4°C in 325 µl of elution buffer C1 or C2. The eluate is recovered after centrifugation for 15 min at 18000g 4° C. II.2.B Immunoprecipitation with protein A sepharose 4B

[0103] On ice, in an Eppendorf tube, 30 µl of the soluble fraction of the production in vitrois diluted 1 / 5 in buffer A 3 (Table 3) and then incubated overnight at 4°C on the wheel with 10 µl of purified MPC8 antibody (1.5 mg / ml). The resulting complex is then incubated for 1 hour at 4°C on the wheel with 50 µl of protein A sepharose 4B resin previously washed with buffer A 3.

[0104] The unretained fraction is recovered after centrifugation at 15,000 g for 5 minutes at 4°C with a slight deceleration. The pellet is then washed three times by centrifugation with 1 ml of buffer A3, followed by two washes with buffer B3, and a final wash with buffer C3. To elute the protein, the resin is heated for 5 minutes at 100°C with 50 µl of 2X Laemmli solution. After centrifugation at 15,000 g for 5 minutes, the eluate is collected. Table 1. Buffers used for the purification of RHD protein. Agarose HA Protein A Sepharose 4B Protein in the presence of detergent Protein in the presence of nanodiscs Protein in the presence of nanodiscs Stamps A1, A2, A3 10 mM Hepes, 150 mM NaCl, pH 6.8 (C12E8 0.3%) 50 mM TrisHCl, 150 mM NaCl, pH 7.4 PBS, BSA 0.5%, 5 mM EDTA Buffers B1, B2, B3 10 mM Hepes, 50 mM K2SO4, pH 6.8 (C12E8 0.3%) 20 mM Tris HCl, 100 mM NaCl, pH 7.4 PBS, BSA 0.5%, 5 mM EDTA, 10 mMNaCl Buffers C1, C2, C3 TpB + HA peptide (5mg / 1300µl) glycerol 1% pH 6.8 TpB, HA peptide (5 mg / 1300µl) pH 6.8 PBS, 5 mM EDTA II.3. Sucrose gradient

[0105] The synthetic product was loaded onto a discontinuous sucrose gradient (5-10-15-20-30% in PBS), followed by ultracentrifugation at 210,000 g for 18 h at 4°C, using the conditions described by T. H. Bayburt. et al, 2007. The 0.5 ml fractions were collected from top to bottom and analyzed by Western-Blot. II.4. Electrophoresis

[0106] Samples are denatured in loading buffer (5 mM Tris-HCl, 8.56% sucrose, 1% SDS, 5% β-mercaptoethanol) and loaded onto a 10% denaturing polyacrylamide gel or a 4-12% Bis-Tris polyacrylamide gradient gel (Invitrogen). Proteins are separated according to their molecular weights at 180 V by electrophoresis in the migration buffer (25 mM Tris-HCl, 192 mM Glycine, 0.1% SDS or 50 mM MOPS, 50 mM Tris-HCl, 0.1% SDS, 1 mM EDTA). II.5. Silver nitrate stain

[0107] After incubation in a fixation buffer (50% methanol, 12% acetic acid, 0.05% formaldehyde) with stirring for 1 hour, followed by several rinses in 50% ethanol, the gel is treated with a 1% sodium thiosulfate solution for 1 minute. After several rinses in water, it is incubated for 20 minutes in the staining mixture (0.2% AgNO₃, 0.075% formaldehyde). After two rinses in water, a developing solution (0.05% formaldehyde, 0.04% thiosulfate, 6% Na₂CO₃) causes the proteins to appear on the gel. The reaction is stopped by a 10% acetic acid solution for 30 minutes. II.6. Western-Blot

[0108] Once the migration is complete, the proteins are transferred onto a nitrocellulose membrane (Amersham) for 2 hours at 30V in a transfer buffer (12.5 mM Tris-HCl, 96 mM Glycine, 20% Ethanol). II.6.A RHD protein detection

[0109] After transfer, the membrane is washed once with PBS alone and then saturated in a 5% milk-containing PBS solution for 1 hour at room temperature with shaking. The membrane is then incubated with the primary antibody LOR 15C9 overnight at 4°C on a rotary plate.

[0110] After several washes in 0.1% PBS-Tween20, the membrane is incubated for 1 hour in the presence of the murine anti-human IgG secondary antibody coupled to HRP diluted 1 / 800th in 5% milk PBS with shaking. After several washes in 0.1% PBS-Tween20 and then in PBS alone, the enzymatic reaction is revealed by chemiluminescence (GE Healthcare Life Sciences). II.6.B Detection of the MSP protein from nanodiscs

[0111] The MSP protein of the nanodiscs, which carries a Poly-Histidine Tag, is revealed by Western-Blot using the Anti-His antibody conjugated to HRP (Qiagen).

[0112] After transfer, the membrane is rinsed twice with TBS alone and then blocked for 1 hour at room temperature in the blocking solution prepared extemporaneously according to the protocol provided with the kit. After two washes in 0.05% TBS-Tween20 at room temperature and a final wash in TBS alone, the membrane is incubated for 1 hour at room temperature with the anti-Penta-His-HRP antibody diluted 1 / 10000 in the blocking solution. After several washes in 0.05% TBS-Tween20 and then in TBS alone, the enzymatic reaction is revealed by chemiluminescence. II.7. Flow Cytometry

[0113] Recognition of the RHD protein by different human anti-epD monoclonal antibodies is revealed by indirect labeling on red blood cells.

[0114] For this purpose, 0.5 µL of red blood cell pellet (5 x 10⁶ cells) is suspended in 1 ml of 0.2% PBS-BSA and then distributed into the different wells of a plate, at a ratio of 5 x 10⁵ cells per well. The plate is centrifuged for 3 minutes at 100 g at 4°C, and then the supernatant is removed.

[0115] After the first wash, the red blood cells are incubated for 1 hour at 4°C with antibodies against the RHD protein. The cells are then washed twice in 0.2% BSA PBS and incubated in the dark for 1 hour at 4°C with an anti-human IgG antibody coupled to R-Phycoerythrin (PE) diluted 1 / 100th in 0.2% BSA PBS. After three washes in 0.2% BSA PBS, the cells are resuspended in 200 µl of PBS and analyzed by flow cytometry (BD FCS Canto II, BD Biosciences).

[0116] The results are analyzed using the FlowJo software. II.8. ELISA Test

[0117] To reveal the interaction between the different antibodies and the protein of interest, a sandwich ELISA test was performed.

[0118] The MPC8 capture antibody is incubated in PBS wells at a concentration of 1 ng / µl per well. Capture is performed overnight at room temperature. After several washes in PBS, the wells are saturated with 5% milk PBS and then rinsed with PBS.

[0119] The RHD protein produced in vitro In the presence of nanodiscs, the solution is then added to the wells for 45 minutes at 37°C. After rinsing with PBS, the human anti-RHD antibodies to be tested are incubated with this complex for 45 minutes at 37°C; the excess is removed by successive washes.

[0120] The complexes formed are detected using an anti-human IgG antibody (1 / 50,000 in PBS), exhausted against mouse and rabbit IgG and coupled to HRP. The mixture is incubated at 37°C for 30 minutes. After washing, the enzyme-bound complex is revealed by adding TMB (Bio-Rad) to the wells. The reaction is stopped with a 0.1N H₂SO₄ solution, and the absorbance is measured at a wavelength of 450 nm. Results I. RHD protein expression and solubility test in the presence of detergent

[0121] We studied the compatibility of different detergents with the production of the RHD protein in the translation system in vitro.

[0122] Three non-ionic detergents were used: C12E8, Brij 35, and Brij 58. These detergents were chosen based on their non-denaturing properties on membrane proteins. The concentrations used were selected taking into account their low critical micelle concentration (CMC, the concentration at which micelles form): 0.11% for Brij 35, 0.0086% for Brij 58, and 0.006% for C12E8. A Western blot analysis of the batch production of the RHD protein was performed in the presence of the three detergents (C12E8 0.5%, Brij 35 0.5%, Brij 58 0.5%). Figure 1The study showed the presence of the protein only in the soluble fractions for reactions containing Brij 35 or Brij 58. For the reaction containing C12E8, only a weak signal was detected in the insoluble fraction, whereas in the absence of the detergent, the protein was predominantly found in the pellet (the insoluble fraction). Therefore, C12E8 is not conducive to the expression of the RHD protein during synthesis. in vitro. Brij 35 has proven to be the most compatible detergent for the production of RHD protein. Therefore, it is the detergent chosen for larger-scale protein production. I.1. Large-scale production and purification of RHD protein in the presence of detergent

[0123] Once optimal expression and solubility conditions are established, large-scale production in 2 mL reaction volume is performed using the CECF system in the presence of the chosen detergent (Brij 35 0.5%). The soluble fraction is purified based on the recognition, by an Agarose-HA resin, of the HA tag fused to the protein. Elution is achieved through competition with the HA peptide. The entire purification process is carried out by substituting Brij 35 with C 12 E 8 0.3%, a detergent previously used successfully by the team for the purification and functional reconstitution in liposomes of the RHCG protein (Mouro-Chanteloup et al., 2010), a non-erythrocyte homologous RH protein.

[0124] The results illustrated on la figure 2The results indicate that the soluble RHD protein is found primarily in the eluate and the elution wash. It is also observed that some of the protein is not bound to the resin and is found in the non-retained fraction (NR). Analysis of the silver nitrate eluate shows that it contains only the RHD protein. The reaction time selected for the production of the soluble RHD protein is 8 hours because beyond 16 hours there is a risk of RHD protein aggregation. II. RHD protein expression and solubility assay in the presence of nanodiscs

[0125] We studied the effect of nanodiscs on the expression level of the RHD protein. The protein is produced in the presence of different concentrations of nanodiscs (e.g. MSP1E3D1-His_POPC (20, 40, 60, 80 µM).

[0126] The synthesis products of each production are analyzed by Western blot. As with the protein produced in the presence of 0.5% Brij 35, the majority of the protein produced in the presence of nanodiscs is located in the soluble fractions. ( Figure 3 ). The presence of nanodiscs at concentrations of 20, 40, and 60 µM allows for synthesis yields as high as those achieved with Brij 35. Conversely, a high concentration of nanodiscs (80 µM) results in decreased synthesis. As expected, the signal intensity of the MSP protein in the soluble fraction increases with the nanodisc concentration. It is also noted that the migration profiles of the soluble and insoluble fractions differ; this difference is attributed to the presence of polymers in the lysate. of E. coli as indicated in the protocol provided with the RTS 100 kit. II.1 Large-scale production of the RHD protein in the presence of nanodiscs (CECF)

[0127] Two large-scale production runs were carried out in a final volume of 1 ml using nanodiscs at a concentration of 50 µM. Based on small-scale expression tests, this concentration appears adequate for the production of the RHD protein with good yield. A control run in the presence of 0.5% Brij 35 was performed in parallel. Western blot analysis of the synthesis products shows that the RHD protein produced is primarily in the soluble fraction, along with the nanodiscs. A greater deposition of the nanodiscs is observed in the insoluble fraction, suggesting the formation of aggregates. ( Figure 4 ). III. Different approaches to purifying the RHD protein produced in the presence of nanodiscs

[0128] As with production in the presence of detergent, the protein produced in the presence of nanodiscs is found in the soluble fraction, which also contains several bacterial lysate proteins. of E. coli.Purification is therefore necessary, as is the separation of filled nanodiscs (into which the protein has been inserted) from empty nanodiscs. Two approaches have been used to purify the RHD protein inserted into nanodiscs. The first approach consists of immunoprecipitating the RHD protein using two protocols; the second approach is sucrose gradient ultracentrifugation of the synthesis product (Bayburt et al., 2007).

[0129] The first immunoprecipitation method tested involves retaining the RHD protein fused to an HA tag with an HA agarose resin. Elution is carried out in the presence of HA peptide, which detaches the RHD protein by competition.

[0130] In the second protocol, the protein is immunoprecipitated using a protein A sepharose 4B resin. Production in vitroThe complex is then incubated with a rabbit anti-Rh polyclonal antibody (MPC8), and the complex is further incubated with Sepharose 4B protein A resin, which binds the antibody complex to the protein. Finally, the protein is eluted by heating in the presence of Laemmli buffer.

[0131] In the elution fractions of both protocols, the nanodiscs were co-eluted with the RHD protein, although there was a low yield with losses during the different purification steps as observed by Western blot. ( Figure 5 ). According to the results of the immunoprecipitations, the RHD protein and the nanodiscs are found in the eluate, which would indicate an insertion of the protein into the nanodiscs.

[0132] This result was also confirmed by a sucrose gradient analysis of the synthesis product. Samples from the first 11 fractions were collected from top to bottom and then analyzed by Western blot.( Figure 6 ). We observe that the RHD protein and the MSP protein of the nanodiscs are in the same fractions 6-11, which correspond to a concentration of 10-15% of sucrose, while the empty nanodiscs which are in the minority are found in the higher fractions (4-5). IV. Immunological analysis of RHD protein antigens produced in the presence of nanodiscs

[0133] In order to verify the conformation of the translated protein in vitro In the presence of nanodiscs, we aim to develop a sandwich ELISA assay using conformational monoclonal antibodies (anti-ep D) directed against the nine D epitopes, according to the Tippett classification. These antibodies recognize the protein only in its native form, and therefore their reactivity depends on its conformation. The non-conformational antibody LOR15C9 is also used in this assay as a positive control. IV.1. Antibody testing by flow cytometry

[0134] Prior to the development of this ELISA test, supernatants from different laboratories containing anti-ep D antibodies of unknown concentration were analyzed by flow cytometry on red blood cells expressing the RHD protein.

[0135] Several dilutions were tested (pure, 1 / 4, 1 / 16) and RHD (-) red blood cells were used as a negative control ( Figure 7 AB).

[0136] The results show that conformational and non-conformational antibodies recognize different epitopes of the RHD protein depending on their concentrations. ( Figure 7 C). The analysis was performed on single-cell subpopulations to eliminate clumped cells. The results also show a high degree of homogeneity within the sample studied. ( Figure 7 EF). V. Development of the ELISA test

[0137] After determining the dilution at which the antibodies will be used to perform an ELISA test, other parameters such as the choice of capture antibody and plaque blocking must also be optimized.

[0138] As capture antibodies, we have the choice between anti-HA and MPC8. However, anti-HA can only be used on crude fractions and not on the protein purified by immunoprecipitation with HA agarose. Indeed, the presence of the HA peptide in the elution fraction can greatly decrease the sensitivity of the test. Therefore, MPC8 was chosen as the capture antibody, which can be used with all crude or purified fractions.

[0139] Different dilutions of the product synthesized in the presence of 40 µM nanodiscs were used for a first ELISA test (1 / 40, 1 / 80, 1 / 160) in duplicate, with the different conditions developed previously, using the LOR15C9 antibody as the primary antibody at 1 / 32 (Table 2) and a conjugated anti-human antibody. Control wells were prepared in the absence of the LOR 15C9 primary protein or antibody.

[0140] On Table 2, The signal intensity in the test wells increases with the protein concentration. This intensity is greater than that of the control wells despite the background noise. Table 2. Results of the ELISA test of different dilutions of the synthesis product of the RHD protein inserted into nanodiscs. Well Controls Test wells Protein (-) Ac l area< (-) Protein 1 / 40 Protein 1 / 80 Protein 1 / 160 DO 450 nm 0,129 0,143 0,2 0,247 0,214 0,208 0,124 0,143 Bibliographical references

[0141] Apoil, P. A., M. E. Reid, G. Halverson, I. Mouro, Y. Colin, F. Roubinet, J. P. Cartron, and A. Blancher.1997. A human monoclonal anti-D antibody which detects a nonconformation-dependent epitope on the RhD protein by immunoblot. Br J Haematol 98: 365-374. Avent, N.D., and M.E. Reid. 2000, The Rh blood group system: a review. Blood 95(2):375-387, Bayburt, T. H., A. J. Leitz, G. Xie, D. D. Oprian, and S. G. Sligar. 2007. Transducin activation by nanoscale lipid bilayers containing one and two rhodopsins. J Biol Chem 282:14875-14881 .Carlson, E.D., R. Gan, C.E. Hodgman, and M.C. Jewett. 2012 Cell-Free Protein Synthesis: Applications Come of Age, Biotechnol Adv. 30(5): 1185-1194. Cartron, J. P. 1999. RH blood group system and molecular basis of Rh-deficiency. Baillieres Best Pract Res Clin Haematol 12:655-689. Cartron, J. P., C. Rouillac, C. Le Van Kim, I. Mouro, and Y. Colin. 1996. Tentative model for the mapping of D epitopes on the RhD polypeptide. Transfus Clin Biol 3:497-503. Denisov, I. G., Y. V. Grinkova, A. A. Lazarides, and S. G. Sligar. 2004. Directed self-assembly of monodisperse phospholipid bilayer Nanodiscs with controlled size. J Am Chem Soc 126:3477-3487. Goossens D, da Silva N, Metral S, Cortes U, Callebaut I, Picot J, Mouro-Chanteloup I, Cartron JP. 2013. Mice expressing RHAG and RHD human blood group genes. PLoS One 8(11):e80460.Grinkova, Y.V., I.G. Denisov, and S.G. Sligar. 2010 Engineering extended membrane scaffold proteins for self-assembly of soluble nanoscale lipid bilayers.Protein Eng Des Sel. 23(11): 843-848. Mouro-Chanteloup, I., S. Cochet, M. Chami, S. Genetet, N. Zidi-Yahiaoui, A. Engel, Y. Colin, O. Bertrand, and P. Ripoche. 2010. Functional reconstitution into liposomes of purified human RhCG ammonia channel. PLoS One 5:e8921. Mouro-Chanteloup, I., A. M. D'Ambrosio, P. Gane, C. Le Van Kim, V. Raynal, D. Dhermy, J. P. Cartron, and Y. Colin. 2002. Cell-surface expression of RhD blood group polypeptide is posttranscriptionally regulated by the RhAG glycoprotein. Blood 100:1038-1047. Mouro, I., Y. Colin, B. Cherif-Zahar, J. P. Cartron, and C. Le Van Kim. 1993. Molecular genetic basis of the human Rhesus blood group system. Nat Genet 5:62-65. Rogé, J., and J.M. Betton. 2005 Use of pIVEX plasmids for protein overproduction in Escherichia coli, Microb Cell Fact. 4: 18. Shirokov, V. A., A. Kommer, V. A. Kolb, and A. S. Spirin. 2007. Continuous-exchange protein-synthesizing systems. Methods Mol Biol 375:19-55. Tippett, P., C. Lomas-Francis, and M. Wallace.1996. The Rh antigen D: partial D antigens and associated low incidence antigens. Vox Sang 70:123-131.

Claims

1. A method of synthesizing an erythrocyte protein selected from RhD, RhCE, RhAG and UTB, or a variant thereof, said method comprising the steps of: a) contacting a nucleic acid encoding said protein or a homolog having at least 95% identity therewith with an acellular protein production system, in the presence of at least one non-ionic detergent, liposomes or nanodiscs; and b) synthesis of said protein.

2. Method according to claim 1, characterised in that the contacting according to step a) occurs in the presence of at least one non-ionic detergent selected from Brij 35 or Brij 58, or nanodiscs comprising a MSP protein selected from proteins of SEQ ID NO. 9, 10 or 11.

3. Method according to any one of claims 1 or 2, characterised in that the acellular system for protein production is a batch system or an acellular system with continuous exchange.

4. Method according to any one of claims 1 to 3, characterised in that the concentration in nanodiscs is less than 80 µM.

5. Method according to any one of claims 1 to 4, characterised in that said erythrocyte protein, or variant thereof, and / or a MSP protein selected from proteins of SEQ ID NO. 9, 10 or 11, is fused to a labelling sequence.

6. A proteoliposome- or nanodisk-shaped particle comprising an erythrocyte protein and lipids, obtainable by the method of any of claims 1 to 5.

7. A particle according to claim 6, characterized in that said erythrocyte protein is selected from RhD, RhCE, RhAG, and UTB, or a homolog having at least 95% identity thereto, and is coupled to a solid support.

8. A composition comprising the particle according to claim 6.

9. A composition according to claim 8 further comprising an MSP protein selected from the proteins of SEQ ID NO. 9, 10, or 11.

10. A composition according to claim 8 or 9 comprising an erythrocyte protein at a concentration greater than 0.01 mg / ml, preferably greater than 0.1 mg / ml.

11. Use of the composition according to any one of claims 8 to 10 in an in vitro alloantibody detection assay.