КОМБИНАЦИЯ, ВКЛЮЧАЮЩАЯ ИНГИБИТОР KRAS G12D И ИНГИБИТОР EGFR, ДЛЯ ПРИМЕНЕНИЯ В ЛЕЧЕНИИ РАКА

EA202691288A1Pending Publication Date: 2026-07-17INCYTE CORP

Patent Information

Authority / Receiving Office
EA · EA
Patent Type
Applications
Current Assignee / Owner
INCYTE CORP
Filing Date
2024-10-08
Publication Date
2026-07-17

AI Technical Summary

Technical Problem

Current treatments for cancer with KRAS G12D mutations are limited, as KRAS inhibitors often face resistance due to EGFR activity, particularly in colorectal cancer.

Method used

Administering a combination of a KRAS G12D inhibitor and an EGFR inhibitor to target both pathways simultaneously, enhancing antitumor activity in KRAS G12D mutant colorectal cancer.

Benefits of technology

The combination therapy demonstrates superior antitumor activity compared to using either agent alone, effectively inhibiting pERK and halting tumor growth in KRAS G12D mutant tumors.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000000_0001_ABST
    Figure 00000000_0001_ABST
  • Figure 00000000_0000_ABST
    Figure 00000000_0000_ABST
Patent Text Reader

Abstract

В данном документе представлены способы лечения рака путем введения комбинированной терапии, включающей ингибитор KRAS G12D и ингибитор EGFR.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] COMBINATION COMPRISING A KRAS G12D INHIBITOR AND AN EGFR INHIBITOR FOR USE IN THE TREATMENT OF CANCER

[0002] RELATED APPLICATIONS

[0003] This application is related to U.S. Provisional Application No. 63 / 588,922, filed October 9, 2023, and U.S. Provisional Application No. 63 / 678,693, filed August 2, 2024, the content of each is hereby incorporated in its entirety.

[0004] BACKGROUND

[0005] KRAS mutations are among the most common genetic alterations in cancer (D.A. Erlanson et. al., Curr. Opin. Chem. Biol., 2021, 62, 101-108). KRAS is a membrane-bound GTPase that, when activated through upstream receptor tyrosine kinases, promotes cell survival and proliferation (D. Uprety et al., Cancer Treat. Rev., 2020, 89, 102070). KRAS proteins exist in a GTP-bound 'on' state and GDP-bound 'off' state. When GTP-bound, signals are transduced through activation of the mitogen activated protein kinase pathway and the PI3K pathway, in addition to others. KRAS mutations are found in approximately 23% of solid tumors. The G12D isoform is the most common, accounting for approximately 29% of KRAS mutations in cancer (J.K. Lee, et al., NPJ Precis. Oncol., 2022, 6, 91). KRAS G12D mutations are found in approximately 40% of pancreatic cancers (pancreatic ductal adenocarcinoma), 15% of colorectal carcinomas, and 5% of non-small cell lung adenocarcinomas, representing major unmet medical needs. The KRAS G12D mutation impairs GTP hydrolysis, resulting in a hyperactivated KRAS isoform that drives high levels of oncogenic ERK and PI3K signaling (M. Malumbres, et al., Nat. Rev. Cancer., 2003, 3, 459- 65).

[0006] Inhibiting KRAS G12D by binding to the KRAS G12D Switch-ll pocket, which leads to conformational changes disfavoring GTP binding and RAF association is hypothesized to abrogate KRAS signaling and halt tumor growth in KRAS G12D mutant tumors. Inhibiting KRAS G12D in this way is hypothesized to abrogate KRAS signaling and halt tumor growth in KRAS G12D mutant tumors. It has been demonstrated that EGFR activity in colorectal cancer contributes to KRAS inhibitor resistance in KRAS G12C mutated tumors (V. Amodio, et al., Cancer Discov 2020; 10:1129-1139).

[0007] SUMMARY

[0008] Provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or pharmaceutically acceptable salt thereof. Combining a KRAS G12D inhibitor with an EGFR inhibitor may generate superior antitumor activity in KRAS G12D mutant colorectal cancer than treatment with either agent alone. BRIEF DESCRIPTION OF THE DRAWINGS

[0009] Figure 1 shows antitumor activity of Compound 1 ± cetuximab in the LS513 Model.

[0010] Figure 2 shows body weight changes of LS513 tumor-bearing mice administered Compound 1 ± cetuximab.

[0011] Figure 3 shows inhibition of pERK in LS513 tumors by Compound 1 ± cetuximab after Single Dose Treatment.

[0012] Figure 4 shows antitumor activity of Compound 2 ± cetuximab in the LS513 Model. Figure 5 shows antitumor activity of Compound 1 ± cetuximab in the HPAFII Model.

[0013] DETAILED DESCRIPTION

[0014] Ras proteins are part of the family of small GTPases that are activated by growth factors and various extracellular stimuli. The Ras family regulates intracellular signaling pathways responsible for growth, migration, survival and differentiation of cells. Activation of Ras proteins at the cell membrane results in the binding of key effectors and initiation of a cascade of intracellular signaling pathways within the cell, including the RAF and PI3K kinase pathways. Somatic mutations in RAS may result in uncontrolled cell growth and malignant transformation while the activation of RAS proteins is tightly regulated in normal cells (D. Simanshu, et al., Cell, 2017, 170(1), 17-33). The Ras family is comprised of three members: KRAS, NRAS and HRAS. RAS mutant cancers account for about 25% of human cancers. KRAS is the most frequently mutated isoform accounting for 85% of all RAS mutations whereas NRAS and HRAS are found mutated in 12% and 3% of all Ras mutant cancers respectively (D. Simanshu, et al., Cell, 2017, 170(1), 17-33). KRAS mutations are prevalent amongst the top three most deadly cancer types: pancreatic (97%), colorectal (44%), and lung (30%) (A. D. Cox, et al. Nat. Rev. Drug. Discov., 2014, 13(11), 828-51). The majority of RAS mutations occur at amino acid residue 12, 13, and 61. The frequency of specific mutations varies between RAS gene isoforms and while G12 and Q61 mutations are predominant in KRAS and NRAS respectively, G12, G13 and Q61 mutations are most frequent in HRAS. Furthermore, the spectrum of mutations in a RAS isoform differs between cancer types. For example, KRAS G12D mutations predominate in pancreatic cancers (40%), followed by colorectal adenocarcinomas (15%) and lung cancers (5%) (Lee JK, et al., NPJ Precis. Oncol., 2022, 6, 459-465). Genomic studies across hundreds of cancer cell lines have demonstrated that cancer cells harboring KRAS mutations are highly dependent on KRAS function for cell growth and survival (R. McDonald, et al., Cell, 2017, 170(3), 577-92). The role of mutant KRAS as an oncogenic driver is further supported by extensive in vivo experimental evidence showing mutant KRAS is required for early tumor onset and maintenance in animal models (A. D. Cox, et al. Nat. Rev. Drug. Discov., 2014, 13(11), 828- The epidermal growth factor receptor (EGFR; ErbB-1 ; HER1 in humans) is a transmembrane protein that is a receptor for members of the epidermal growth factor family (EGF family) of extracellular protein ligands. Mutations that lead to EGFR overexpression have been associated with a number of cancers, including adenocarcinoma of the lung, anal cancers, glioblastoma, and epithelial tumors of the head and neck. These somatic mutations involving EGFR lead to its constant activation, which produces uncontrolled cell division.

[0015] The present disclosure is related to methods of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or pharmaceutically acceptable salt thereof.

[0016] Certain terms used herein are described below. Compounds of the present disclosure are described using standard nomenclature. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which this invention belongs.

[0017] Definitions

[0018] Listed below are definitions of various terms used herein. These definitions apply to the terms as they are used throughout this specification and claims, unless otherwise limited in specific instances, either individually or as part of a larger group.

[0019] Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art. Generally, the nomenclature used herein and the laboratory procedures in cell culture, molecular genetics, organic chemistry, and peptide chemistry are those well-known and commonly employed in the art.

[0020] As used herein, the articles “a” and “an” refer to one or to more than one ( / .e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element. Furthermore, use of the term “including” as well as other forms, such as “include,” “includes,” and “included,” is not limiting.

[0021] The term “about” when used in connection with a numerical value, means that a collection or range of values is included. For example, “about X” includes a range of values that are ±10%, ±5%, ±2%, ±1%, ±0.5%, ±0.2%, or ±0.1% of X, where X is a numerical value. In one embodiment, the term “about” refers to a range of values which are 10% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 5% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 1 % more or less than the specified value.

[0022] As used herein, “pharmaceutical combination” or “combination” refers to formulations of the separate compounds with or without instructions for combined use or to combination products. The combination compounds may thus be entirely separate pharmaceutical dosage forms or in pharmaceutical compositions that are also sold independently of each other and where instructions for their combined use are provided in the package equipment, e.g., leaflet or the like, or in other information, e.g., provided to physicians and medical staff (e.g., oral communications, communications in writing or the like), for simultaneous or sequential use for being jointly active.

[0023] The term “treat,” “treated,” “treating,” or “treatment” includes the diminishment or alleviation of at least one symptom associated or caused by the state, disorder or disease being treated. In certain embodiments, the treatment comprises bringing into contact with KRAS or EGFR an effective amount of a compound disclosed herein for conditions related to cancer.

[0024] As used herein, the term “prevent” or “prevention” means no disorder or disease development if none had occurred, or no further disorder or disease development if there had already been development of the disorder or disease. Also considered is the ability of one to prevent some or all of the symptoms associated with the disorder or disease.

[0025] As used herein, the term “patient,” “individual,” or “subject” refers to a human or a non-human mammal. Non-human mammals include, for example, livestock and pets, such as ovine, bovine, porcine, canine, feline and marine mammals. Preferably, the patient, subject, or individual is human.

[0026] As used herein, the term “free base equivalent” refers to the amount of active agent, or a pharmaceutically acceptable salt of the active agent (e.g., Compound 1) that is equivalent to the free-base of the active agent dose. Stated alternatively, the term “free base equivalent” means either an amount of Compound 1 free base, or the equivalent amount of Compound 1 free base that is provided by a salt of said compound.

[0027] As used herein, the terms “effective amount,” “pharmaceutically effective amount,” and “therapeutically effective amount” refer to a nontoxic but sufficient amount of an agent to provide the desired biological result. That result may be reduction or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. An appropriate therapeutic amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.

[0028] As used herein, the term “pharmaceutically acceptable” refers to a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively non-toxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.

[0029] As used herein, the term “pharmaceutically acceptable salt” refers to derivatives of the disclosed compounds wherein a parent compound is modified by converting an existing acid or base moiety to its salt form. Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. The pharmaceutically acceptable salts described herein include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. The pharmaceutically acceptable salts discussed herein can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are used. The phrase “pharmaceutically acceptable salt” is not limited to a mono, or 1 :1, salt. For example, “pharmaceutically acceptable salt” also includes bis-salts, such as a bis-hydrochloride salt. Lists of suitable salts are found in A.R. Gennaro (Ed.), Remington's Pharmaceutical Sciences, 17thEd., (Mack Publishing Company, Easton, 1985), p. 1418, S. M. Berge et al., J. Pharm. Sci., 1977, 66(1), 1-19, S. Gaisford in A. Adejare (Ed.), Remington, The Science and Practice of Pharmacy, 23rdEd., (Elsevier, 2020), Chapter 17, pp. 307-14; S.M. Berge et al., J. Pharm. Sci., 1977, 66(1), 1-19, T. S. Wiedmann, et al.,. Asian J. Pharm. Sci., 2016; 11, 722-34. D. Gupta et al., Molecules, 2018, 23(7), 1719; P.H. Stahl et al., Handbook of Pharmaceutical Salts: Properties, Selection, and Use, (Wiley, 2002) and in P.H. Stahl et al., Handbook of Pharmaceutical Salts: Properties, Selection, and Use, 2ndEd. (Wiley, 2011).

[0030] As used herein, the term “composition” or “pharmaceutical composition” refers to a mixture of at least one compound with a pharmaceutically acceptable carrier. The pharmaceutical composition facilitates administration of the composition to a patient or subject. Multiple techniques of administering a compound exist in the art including, but not limited to, intravenous, oral, aerosol, parenteral, ophthalmic, pulmonary, and topical administration.

[0031] As used herein, the term “pharmaceutically acceptable carrier” means a pharmaceutically acceptable material, composition or carrier, such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful to the patient such that it may perform its intended function. Typically, such constructs are carried or transported from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation, including the compound disclosed herein, and not injurious to the patient. Some examples of materials that may serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; surface active agents; alginic acid; pyrogen-free water; isotonic saline; Ringer’s solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations.

[0032] As used herein, “pharmaceutically acceptable carrier” also includes any and all coatings, antibacterial and antifungal agents, and absorption delaying agents, and the like that are compatible with the activity of a compound disclosed herein, and are physiologically acceptable to the patient. Supplementary active compounds may also be incorporated into the compositions. The “pharmaceutically acceptable carrier” may further include a pharmaceutically acceptable salt of the compound(s) disclosed herein. Other additional ingredients that may be included in the pharmaceutical compositions are known in the art and described, for example, in P. Beringer, et al., (Eds.), Remington: The Science and Practice of Pharmacy, 21stEd.; (Lippincott Williams & Wilkins: Philadelphia, Pa., 2005); A. Adejare (Ed.), Remington, The Science and Practice of Pharmacy, 23rdEd., (Elsevier, 2020); R. C. Rowe et al., Eds., Handbook of Pharmaceutical Excipients, 6thEd.; (Pharmaceutical Press, 2009); P. J. Shesky et al., Eds., Handbook of Pharmaceutical Excipients, 9thEd.; (The Pharmaceutical Press, 2020); M. Ash, et al., (Eds.), Handbook of Pharmaceutical Additives, 3rdEd.; (Gower Publishing Company: 2007); and M. Gibson (Ed.), Pharmaceutical Preformulation and Formulation, 2ndEd. (CRC Press LLC, 2009).

[0033] The term “single formulation” as used herein refers to a single carrier or vehicle formulated to deliver effective amounts of both therapeutic agents to a patient. The single vehicle is designed to deliver an effective amount of each of the agents, along with any pharmaceutically acceptable carriers or excipients. In some embodiments, the vehicle is a tablet, capsule, pill, or a patch. In other embodiments, the vehicle is a solution or a suspension.

[0034] The term “combination therapy” refers to the administration of two or more therapeutic compounds to treat a therapeutic condition or disorder described in the present disclosure. Such administration encompasses co-administration of these therapeutic compounds in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients or in multiple, or in separate containers (e.g., capsules) for each active ingredient. In addition, such administration also encompasses use of each type of therapeutic compound in a sequential manner, either at approximately the same time or at different times. In either case, the treatment regimen will provide beneficial effects of the drug combination in treating the conditions or disorders described herein.

[0035] The combination of agents described herein may display a synergistic effect. The term “synergistic effect” as used herein, refers to action of two agents such as, for example, a KRAS inhibitor (e.g., a KRAS inhibitor of formula I) and an EGFR inhibitor, producing an effect, for example, slowing the symptomatic progression of cancer or symptoms thereof, which is greater than the simple addition of the effects of each drug administered by themselves. A synergistic effect can be calculated, e.g., using suitable methods such as the Sigmoid-Emax equation (N.H.G. Holford, et al., Clin. Pharmacokinet., 1981 , 6: 429-53), the equation of Loewe additivity (S. Loewe, et al., Arch. Exp. Pathol Pharmacol., 1926, 114, SIS- 26), the median-effect equation (T.C. Chou, et al., Adv. Enzyme Regul., 1984, 22: 27-55), or based on the Bliss definition of drugs independence (E. Demidenko, et al., PLoS ONE, 2019, 74(11): e0224137). Each equation referred to above can be applied to experimental data to generate a corresponding graph to aid in assessing the effects of the drug combination. The corresponding graphs associated with the equations referred to above are the concentrationeffect curve, isobologram curve and combination index curve, respectively.

[0036] As used herein, the term “synergy” refers to the effect achieved when the active ingredients, i.e., KRAS inhibitor and EGFR inhibitor, used together is greater than the sum of the effects that results from using the compounds separately.

[0037] In an embodiment, provided herein is a combination therapy comprising an effective amount of a KRAS inhibitor and EGFR inhibitor. An “effective amount” of a combination of agents (i.e., KRAS inhibitor and EGFR inhibitor) is an amount sufficient to provide an observable improvement over the baseline clinically observable signs and symptoms of the disorders treated with the combination.

[0038] Provided herein is a combination of therapeutic agents and administration of the combination of agents to treat cancer, and related indications. As used herein, the term “cancer” includes related indications, such as anemia. As used herein, a “combination of agents” and similar terms refer to a combination of two types of agents: a KRAS inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or a pharmaceutically acceptable salt thereof. Use of racemic mixtures of the individual agents is also provided. Pharmacologically active metabolites include those that are inactive but converted into pharmacologically active forms in the body after administration.

[0039] As used herein, the term “alkyl,” by itself or as part of another substituent means, unless otherwise stated, a straight or branched chain hydrocarbon having the number of carbon atoms designated (i.e., Ci-Ce-alkyl means an alkyl having one to six carbon atoms) and includes straight and branched chains. In an embodiment, C1-C3, C1-C4, Ci-Ce alkyl groups are provided herein. Examples include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, tert-butyl, pentyl, neopentyl, and hexyl.

[0040] The term “alkylene,” employed alone or in combination with other terms, refers to a divalent alkyl linking group. An alkylene group formally corresponds to an alkane with two C-H bond replaced by points of attachment of the alkylene group to the remainder of the compound. The term “Cn-malkylene” refers to an alkylene group having n to m carbon atoms. Examples of alkylene groups include, but are not limited to, ethan-1 ,2-diyl, ethan-1 ,1- diyl, propan-1 , 3-diyl, propan-1 , 2-diyl, propan-1 , 1-diyl, butan-1 ,4-diyl, butan-1 ,3-diyl, butan- 1 ,2-diyl, 2-methyl-propan-1 , 3-diyl and the like.

[0041] As used herein, the term “alkoxy,” refers to the group — O-alkyl, wherein alkyl is as defined herein. Alkoxy includes, by way of example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, sec-butoxy, t-butoxy and the like. In an embodiment, C1-C3, C1-C4, C1- Ce alkoxy groups are provided herein.

[0042] The term “amino,” employed alone or in combination with other terms, refers to a group of formula -NH2, wherein the hydrogen atoms may be substituted with a substituent described herein. For example, “alkylamino” can refer to -NH(alkyl) and - N (alkyl)2.

[0043] As used herein, the term “halo” or “halogen” alone or as part of another substituent means, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom.

[0044] The term “haloalkyl” as used herein refers to an alkyl group in which one or more of the hydrogen atoms has been replaced by a halogen atom. The term “Cn-mhaloalkyl” refers to a Cn-m alkyl group having n to m carbon atoms and from at least one up to {2(n to m)+1} halogen atoms, which may either be the same or different. In some embodiments, the halogen atoms are fluoro atoms. In some embodiments, the haloalkyl group has 1 to 6 or 1 to 4 carbon atoms. Example haloalkyl groups include CF3, C2F5, CHF2, CH2F, CCI3, CHCI2, C2CI5 and the like. In some embodiments, the haloalkyl group is a fluoroalkyl group.

[0045] The term “haloalkoxy,” employed alone or in combination with other terms, refers to a group of formula -O-haloalkyl, wherein the haloalkyl group is as defined above. The term “Cn-m haloalkoxy” refers to a haloalkoxy group, the haloalkyl group of which has n to m carbons. Example haloalkoxy groups include trifluoromethoxy and the like. In some embodiments, the haloalkoxy group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

[0046] As used herein, the term “cycloalkyl” means a non-aromatic carbocyclic system that is partially or fully saturated having 1 , 2 or 3 rings wherein such rings may be fused. The term “fused” means that a second ring is present ( / .e., attached or formed) by having two adjacent atoms in common ( / .e., shared) with the first ring. Cycloalkyl also includes bicyclic structures that may be bridged or spirocyclic in nature with each individual ring within the bicycle varying from 3-10, 3-8, 3-7, 3-6, and 5-10 atoms. The term “cycloalkyl” includes, but is not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, bicyclo[3.1.0]hexyl, spiro[3.3]heptanyl, bicyclo[2.2.2]octanyl and bicyclo[1.1 .1]pentyl. In an embodiment, 3-10 membered cycloalkyl groups are provided herein.

[0047] As used herein, the term “heterocycloalkyl” means a non-aromatic carbocyclic system containing 1 , 2, 3 or 4 heteroatoms selected independently from N, O, and S and having 1 , 2 or 3 rings wherein such rings may be fused, wherein fused is defined above. Heterocycloalkyl also includes bicyclic structures that may be bridged or spirocyclic in nature with each individual ring within the bicycle varying from 3-8, 5-10, 4-6, or 3-10 atoms, and containing 0, 1 , or 2 N, O, or S atoms. The term “heterocycloalkyl” includes cyclic esters ( / .e., lactones) and cyclic amides ( / .e., lactams) and also specifically includes, but is not limited to, epoxidyl, oxetanyl, tetrahydrofuranyl, tetrahydropyranyl ( / .e., oxanyl), pyranyl, dioxanyl, aziridinyl, azetidinyl, pyrrolidinyl, 2,5-dihydro-1 H-pyrrolyl, oxazolidinyl, thiazolidinyl, piperidinyl, morpholinyl, piperazinyl, thiomorpholinyl, 1 ,3-oxazinanyl, 1 ,3-thiazinanyl, 2-aza- bicyclo[2.1.1]hexanyl, 5-azabicyclo[2.1.1]hexanyl, 6-azabicyclo[3.1.1] heptanyl, 2-azabicyclo- [2.2.1]heptanyl, 3-aza-bicyclo[3.1.1]heptanyl, 2-azabicyclo[3.1.1]heptanyl, 3-azabicyclo- [3.1.0]hexanyl, 2-aza-bicyclo[3.1.0]hexanyl, 3-azabicyclo[3.2.1]octanyl, 8-azabicyclo[3.2.1]- octanyl, 3-oxa-7-aza-bicyclo[3.3.1]nonanyl, 3-oxa-9-azabicyclo[3.3.1]nonanyl, 2-oxa-5-aza- bicyclo[2.2.1]heptanyl, 6-oxa-3-azabicyclo[3.1.1]heptanyl, 2-azaspiro[3.3]heptanyl, 2-oxa-6- azaspiro[3.3]heptanyl, 2-oxaspiro[3.3]heptanyl, 2-oxaspiro[3.5]nonanyl, 3-oxaspiro[5.3]- nonanyl, and 8-oxabicyclo-[3.2.1]octanyl. In an embodiment, 3-10 membered heterocycloalkyl groups are provided herein. In another embodiment, 5-10 membered heterocycloalkyl groups are provided herein. In still another embodiment, 4-6 membered heterocycloalkyl groups are provided herein.

[0048] The term “aromatic” refers to a carbocycle or heterocycle having one or more polyunsaturated rings having aromatic character ( / .e., having (4n + 2) delocalized > (pi) electrons where n is an integer).

[0049] The term “aryl,” employed alone or in combination with other terms, refers to an aromatic hydrocarbon group, which may be monocyclic or polycyclic {e.g., having 2 fused rings). The term “Cn-m aryl” refers to an aryl group having from n to m ring carbon atoms. Aryl groups include, e.g., phenyl, naphthyl, and the like. In some embodiments, aryl groups have from 6 to about 10 carbon atoms. In some embodiments, aryl groups have 6 carbon atoms. In some embodiments, aryl groups have 10 carbon atoms. In some embodiments, the aryl group is phenyl. In some embodiments, the aryl group is naphthyl.

[0050] As used herein, the term “heteroaryl” means an aromatic carbocyclic system containing 1 , 2, 3, or 4 heteroatoms selected independently from N, O, and S and having 1 , 2, or 3 rings wherein such rings may be fused, wherein fused is defined above. The term “heteroaryl” includes, but is not limited to, furanyl, thiophenyl, oxazolyl, thiazolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, isoxazolyl, isothiazolyl, oxadiazolyl, thiadiazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, imidazo[1,2-a]- pyridinyl, pyrazolo[1 ,5-a]pyridinyl, 5,6,7,8-tetrahydroisoquinolinyl, 5,6,7,8-tetra- hydroquinolinyl, 6,7-dihydro-5H-cyclopenta[b]pyridinyl, 6,7-dihydro-5H-cyclopenta[c]- pyridinyl, 1 ,4,5,6-tetrahydrocyclopenta[c]pyrazolyl, 2,4,5,6-tetrahydrocyclopenta[c]- pyrazolyl, 5,6-dihydro-4H-pyrrolo[1 ,2-b]pyrazolyl, 6,7-dihydro-5H-pyrrolo[1 ,2-b]- [1 ,2,4]triazolyl , 5,6,7,8-tetrahydro-[1 ,2,4]triazolo[1 ,5-a]pyridinyl , 4,5,6,7-tetrahydro- pyrazolo[1,5-a]pyridinyl, 4,5,6,7-tetrahydro-1 H-indazolyl and 4,5,6,7-tetrahydro-2H- indazolyl. In an embodiment, 5-10 membered heteroaryl groups are provided herein.

[0051] It is to be understood that if a cycloalkyl, heterocycloalkyl, aryl, or heteroaryl moiety may be bonded or otherwise attached to a designated moiety through differing ring atoms (i.e., shown or described without denotation of a specific point of attachment), then all possible points are intended, whether through a carbon atom or, for example, a trivalent nitrogen atom. For example, the term “pyridinyl” means 2-, 3- or 4-pyridinyl, the term “thienyl” means 2- or 3-thioenyl, and so forth.

[0052] As used herein, the term “substituted” means that an atom or group of atoms has replaced hydrogen as the substituent attached to another group.

[0053] As used herein, the term “optionally substituted” means that the referenced group may be substituted or unsubstituted. In one embodiment, the referenced group is optionally substituted with zero substituents, i.e., the referenced group is unsubstituted. In another embodiment, the referenced group is optionally substituted with one or more additional group(s) individually and independently selected from groups described herein.

[0054] KRAS G12D Inhibitors

[0055] The present disclosure relates to a combination therapy comprising a KRAS G12D inhibitor and an EGFR inhibitor. This combination therapy can be used to treat various disorders associated with abnormal activity of KRAS or EGFR.

[0056] In an embodiment, the KRAS G12D inhibitor is a compound of Formula I:

[0057] I or a pharmaceutically acceptable salt thereof, wherein:

[0058] Y is N or OR6; R1is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa1; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;

[0059] R2is selected from H, C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, and ORa2; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 or 2 substituents independently selected from Rg;

[0060] Cy1is selected from C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl and 6-10 membered heteroaryl; wherein the 4-10 membered heterocycloalkyl and 6-10 membered heteroaryl each has at least one ring-forming carbon atom and 1 , 2, 3, or 4 ringforming heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of 6-10 membered heteroaryl and 4-10 membered heterocycloalkyl is optionally substituted by oxo to form a carbonyl group; and wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 , 2, 3, or 4 substituents independently selected from R10;

[0061] R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-ecycloalkyl-Ciw alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, ORf3, C(O)NRc3Rd3, NRc3Rj3, and NRc3C(O)Rb3; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;

[0062] R5is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa5; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;

[0063] R6is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-9 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-ecycloalkyl-Ciw alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, ORa6, and C(O)NRc6Rd6; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-9 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 or 2 substituents independently selected from R60; R7is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa7; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;

[0064] Cy2is selected from

[0065] Cy2-a Cy2-b wherein n is 0, 1 , or 2; each R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa1°, C(O)Rb1°, C(O)NRc10Rd1°, C(O)ORa1°, NRc10Rd1°, and S(O)2Rb1°; each R20is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and

[0066] ORa20; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)Rb3°, C(O)NRc30Rd3°, C(O)ORa3°, NRc30Rd3°, and S(O)2Rb30; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa31, C(O)Rb31, C(O)NRc31Rd31, C(O)ORa31, NRc31Rd31, and S(O)2Rb31; each R33is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4- membered heterocycloalkyl, 6-membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)NRc30Rd3°, and NRc30Rd3°; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-membered heterocycloalkyl, 6-membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb6°; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa61, and NRc61Rd61;

[0067] Ra1is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Rb3, Rc3and Rd3is independently selected from H, C1-3 alkyl, Ci-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rd3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R30;

[0068] Rj3is selected from C1-3 alkyl, Ci-s haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rj3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R30;

[0069] Rf3is selected from Ci-s haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or

[0070] Rf3is selected from wherein Rxis H or C1-2 alkyl and Ryis C1-2 alkyl; or Rxand Ry, together with the C atom to which they are attached, form a 3-, or 4- membered cycloalkyl group;

[0071] Ra5is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6, Rc6and Rd6is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60;

[0072] Ra7is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra1°, Rb1°, Rc1° and Rd1° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; Rb2° is selected from NH2, C1-3 alkyl, and Ci-3 haloalkyl; each Ra3°, Rb3°, Rc3° and Rd3° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra31, Rb31, Rc31and Rd31is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61; each Ra61, Rc61, and Rd61, is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; and each Rgis independently selected from D, OH, CN, halo, C1-3 alkyl, C1-3 haloalkyl, Cis alkoxy, C1-3 haloalkoxy, amino, C1-3 alkylamino, and di(Ci-3 alkyl)amino.

[0073] In an embodiment of Formula I, or a pharmaceutically acceptable salt thereof,

[0074] Y is CR6;

[0075] R1is selected from H, C1-3 alkyl, and C1-3 haloalkyl;

[0076] R2is selected from H, C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa2; wherein said C1-3 alkyl is optionally substituted with 1 or 2 substituents independently selected from Rg;

[0077] Cy1is selected from C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl; wherein the 4-10 membered heterocycloalkyl and 6-10 membered heteroaryl each has at least one ring-forming carbon atom and 1 , 2, 3, or 4 ringforming heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of 6-10 membered heteroaryl and 4-10 membered heterocycloalkyl is optionally substituted by oxo to form a carbonyl group; and wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 , 2, 3, or 4 substituents independently selected from R10;

[0078] R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, C(O)NRc3Rd3, and NRc3C(O)Rb3; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;

[0079] R5is selected from H, C1-3 alkyl, C1-3 haloalkyl, and halo; R6is selected from H, C1-3 haloalkyl, C3-6 cycloalkyl, 4-8 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa6, and C(O)NRc6Rd6; wherein said C3-6 cycloalkyl, 4-8 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60;

[0080] R7is selected from H, C1-3 alkyl, C1-3 haloalkyl, halo, and CN;

[0081] Cy2is selected from

[0082] Cy2-a Cy2-b wherein n is 0, 1 , or 2; each R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa1°, C(O)Rb1°, C(O)NRc10Rd1°, C(O)ORa1°, NRc10Rd1°, and S(O)2Rb1°; each R20is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa20; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)Rb3°, C(O)NRc30Rd3°, C(O)ORa3°, NRc30Rd3°, and S(O)2Rb30; wherein said C1-3 alkyl, C3-6 cycloalkyl,

[0083] 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa31, C(O)Rb31, C(O)NRc31Rd31, C(O)ORa31, NRc31Rd31, and S(O)2Rb31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb6°; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa61, and NRc61Rd61; each Ra2is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Rb3, Rc3and Rd3is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said , C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rd3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R30; each Ra6, Rc6and Rd6is independently selected from H, C1-3 alkyl, Ci-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60; each Ra1°, Rb1°, Rc1° and Rd1° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;

[0084] Rb2° is selected from NH2, C1-3 alkyl, and C1-3 haloalkyl; each Ra3°, Rb3°, Rc3° and Rd3° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra31, Rb31, Rc31and Rd31is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61; and each Ra61, Rc61, and Rd61, is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; and each Rgis independently selected from D, CN, halo, C1-3 alkyl, and C1-3 haloalkyl.

[0085] In another embodiment of Formula I, or a pharmaceutically acceptable salt thereof,

[0086] Y is CR6;

[0087] R1is H;

[0088] R2is selected from C1-3 alkyl, C1-3 haloalkyl, halo, CN, and -CH2CH2CN;

[0089] Cy1is selected from C3-10 cycloalkyl, Ce- aryl and 6-10 membered heteroaryl; wherein the 6-10 membered heteroaryl has at least one ring-forming carbon atom and 1 , ring-forming heteroatoms independently selected from N and S; and wherein the C3-10 cycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R10;

[0090] R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;

[0091] R5is selected from H and halo;

[0092] R6is selected from H, C1-3 haloalkyl, 4-8 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said 4-8 membered heterocycloalkyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60; or

[0093] R7is halo;

[0094] Cy2is -®NH;

[0095] Cy2-b each R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa1°; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, halo, D, CN, ORa3°, C(O)NRc30Rd3°, and NRc30Rd3°; wherein said C1-3 alkyl and 4-6 membered heterocycloalkyl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, CN, ORa31, and NRc31Rd31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb60; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, and CN; each Ra1° is independently selected from H and C1-3 alkyl; each Ra3°, Rc3° and Rd3° is independently selected from H and C1-3 alkyl; each Ra31, Rc31and Rd31is independently selected from H and C1-3 alkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc60and Rd60attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61.

[0096] In yet another embodiment of Formula I, or a pharmaceutically acceptable salt thereof,

[0097] Y is CR6;

[0098] R1is H;

[0099] R2is -CH2CH2CN;

[0100] Cy1is phenyl; wherein the phenyl is optionally substituted with 1 or 2 substituents independently selected from R10;

[0101] R3is selected from H, C1-3 alkyl, phenyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2 or 3 substituents independently selected from R30;

[0102] R5is selected from H and halo;

[0103] R6is selected from 4-8 membered heterocycloalkyl; wherein said 4-8 membered heterocycloalkyl is optionally substituted with 1 or 2 substituents independently selected from R60; or

[0104] R6is selected from C1-3 alkyl; wherein said C1-3 alkyl is substituted with 1 or 2 substituents independently selected from R60;

[0105] R7is halo;

[0106] Cy2is each R10is independently selected from C1-3 alkyl and halo; each R30is independently selected from C1-3 alkyl, halo, D, OH, and C(O)NRc30Rd3°; wherein said C1-3 alkyl is optionally substituted with 1 substituent independently selected from R31; each R31is ORa31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, and NRc60S(O)2Rb60; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, and halo; each Rc30and Rd3° is independently selected from H and C1-3 alkyl; each Ra31is independently selected from H and C1-3 alkyl; and each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61.

[0107] In still another embodiment of Formula I, or a pharmaceutically acceptable salt thereof,

[0108] Y is CR6;

[0109] R1is H;

[0110] R2is -CH2CH2CN;

[0111] Cy1is phenyl; wherein the phenyl is optionally substituted with 1 or 2 substituents independently selected from R10;

[0112] R3is selected from H, methyl, ethyl, phenyl, 1 ,2,4-triazolyl, pyrazyl, and pyridyl; wherein said methyl, phenyl, 1 ,2,4-triazolyl, pyrazyl, and pyridyl are each optionally substituted with 1 , 2 or 3 substituents independently selected from R30;

[0113] R5is selected from H and chloro;

[0114] R6is selected from pyrrolidinyl, 2-azabicyclo[3.1.0]hexanyl, 2- azabicyclo[2.2.1]heptanyl, and 5-oxo-1 ,2,3,5-tetrahydroindolizin-3-yl; wherein said pyrrolidinyl, 2-azabicyclo[3.1.0]hexanyl, 2-azabicyclo[2.2.1]heptanyl ,and 5-oxo-1 , 2,3,5- tetrahydroindolizin-3-yl are optionally substituted with 1 or 2 substituents independently selected from R60;

[0115] R7is fluoro;

[0116] Cy2is each R10is independently selected from methyl, fluoro, and chloro; each R30is independently selected from methyl, fluoro, OH, D, and C(O)NRc30Rd3°; wherein said methyl is optionally substituted with 1 substituent that is R31; each R31is ORa31; each R60is independently selected from methyl, fluoro, C1-2 haloalkoxy, 3- oxomorpholinyl, 2-oxopyrazin-1(2H)-yl), C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, and NRc60S(O)2Rb6°; wherein said 3-oxomorpholinyl, and 2- oxopyrazin-1(2 / 7)-yl) are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from methyl and fluoro; each Rc3° and Rd3° is independently selected from H and methyl; each Ra31is independently selected from H and methyl; and each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-2 alkyl, Ci haloalkyl, cyclopropyl, tetrahydrofuranyl, and thiazolyl; wherein said C1-2 alkyl, cyclopropyl, tetrahydrofuranyl, and thiazolyl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form an azetidinyl group optionally substituted with 1 or 2 substituents independently selected from R61.

[0117] In an embodiment, the compound of Formula I is a compound of Formula II: or a pharmaceutically acceptable salt thereof.

[0118] In another embodiment, the compound of Formula I is a compound of Formula III: or a pharmaceutically acceptable salt thereof. In an embodiment of Formula I, or a pharmaceutically acceptable salt thereof, Y is CR6. In another embodiment of Formula I, or a pharmaceutically acceptable salt thereof, R1is H. In yet another embodiment of Formula I, or a pharmaceutically acceptable salt thereof, Cy1is phenyl optionally substituted with 1 or 2 substituents independently selected from halo. In still another embodiment of Formula I, or a pharmaceutically acceptable salt thereof, R3is methyl. In an embodiment of Formula I, or a pharmaceutically acceptable salt thereof, R5is H. In an embodiment of Formula I, or a pharmaceutically acceptable salt thereof, R6is 2-azabicyclo[3.1.0]hexanyl substituted with R60. In another embodiment of Formula I, or a pharmaceutically acceptable salt thereof, R7is fluoro. In yet another embodiment of Formula I, or a pharmaceutically acceptable salt thereof, Cy2is Cy2-b. In still another embodiment, R60is C(O)cyclopropyl.

[0119] In an embodiment, the KRAS G12D inhibitor is selected from 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(7-chloro-3-hydroxynaphthalen-1- yl)-6-fluoro-2-methyl-4-(1 H-1 ,2,4-triazol-1-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0120] 3-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(5,7-difluoro-1 H-indol-3-yl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0121] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(6-fluoro-5-methyl-1 / 7- indol-3-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0122] 3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (2,3-dichlorophenyl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0123] 3-((1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-8-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)methyl)oxazolidin-2-one;

[0124] 8-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-2,8-dimethyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1 -naphthonitrile;

[0125] 1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-7-(8-cyanonaphthalen-1-yl)-6- fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinoline-8-carbonitrile;

[0126] 8-(1-((7R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-8-methyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-2-((3-oxomorpholino)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1- naphthonitrile;

[0127] 3-(7-(benzo[b]thiophen-3-yl)- 1 -(( 1R, 4R, 5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; 3-(1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-4-(((S)-1-(dimethylamino)propan-2- yl)oxy)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0128] 8-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-2-methyl- 4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;

[0129] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0130] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-4-((3- fluoro-1-methylazetidin-3-yl)methoxy)-7-(3-hydroxynaphthalen-1-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)- / V, / V-dimethylpropanamide;

[0131] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-2-methyl-4-(5-methylpyrazin-2-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0132] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-methyl-2-((4-methyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0133] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-4- ethoxy-6-fluoro-2-((4-isopropyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0134] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-4-(3-(dimethylamino)-3- methylazetidin-1-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((3-oxomorpholino)methyl)-1 / 7- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0135] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-4-ethoxy-6-fluoro-7-(3- hydroxynaphthalen-1-yl)-2-(1-(3-oxomorpholino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0136] 3-(1-((endo)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1-yl)-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-(pyridin-3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0137] 3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (7,8-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0138] 3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (6,7-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0139] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; 1-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)isoquinoline-8-carbonitrile;

[0140] 8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;

[0141] 8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)-

[0142] 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)-1 -naphthonitrile;

[0143] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0144] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-

[0145] 2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0146] (2 / ?)-2-(1-((1 / ?,4 / ?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)- / V, / V- dimethylpyrrolidine-1 -carboxamide; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3- methylphenyl)-8-(2-cyanoethyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate; methyl (1 S,3R,5S)-3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;

[0147] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-(5-oxo-1 ,2,3,5-tetrahydroindolizin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2-c] quinolin-2- yl)pyrrolidine-1 -carboxylate;

[0148] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3-fluorophenyl)-2-((R)-1- (cyclopropanecarbonyl)pyrrolidin-2-yl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0149] 8-(2-((R)-1-acetylpyrrolidin-2-yl)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6- fluoro-8-methyl-4-(2-methylpyridin-4-yl)-1 H-pyrrolo[3,2-c]quinolin-7-yl)-1 , 2,3,4- tetrahydronaphthalene-1-carbonitrile; 5-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-8-(2- cyanoethyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;

[0150] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-

[0151] 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0152] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(5-fluoro-6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate; ethyl (2 / ?)-2-(1-((1 / ?,4 / ?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;

[0153] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-4-(methyl-d3)-1 H-pyrrolo[3,2-c]quinolin- 8-yl)propanenitrile;

[0154] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0155] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;

[0156] 5-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-7-(7- fluoronaphthalen-1-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;

[0157] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0158] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile; methyl (1R,3R,5R)-3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;

[0159] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-

[0160] (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0161] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6- (2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1 (2 / - / )-yl)ethyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; methyl (2R,4S)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-4-fluoropyrrolidine-1 -carboxylate; methyl (2R,5R)-2-(1-((1 / ?,4 / ?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-5-methylpyrrolidine-1 -carboxylate; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-3-chloro-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7- pyrrolo[3,2-c]quinolin-2-yl)pyrrolidine-1-carboxylate;

[0162] 4-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2 / - / )-yl)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-4- yl)-2-fluoro- / V-methylbenzamide; methyl (( 1 R)- 1 -( 1 -(( 1R, 4R, 5S)-2-azabicyclo[2.1.1 ]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)carbamate;

[0163] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide;

[0164] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide;

[0165] (2S)- / V-((1 / ?)-1-(1-((1 / ?,4 / ?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)tetrahydrofuran-2- carboxamide;

[0166] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)ethyl)cyclopropanesulfonamide;

[0167] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)thiazole-4- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)- / \ / - methylcyclopropanecarboxamide;

[0168] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- methylcyclopropane-1-carboxamide;

[0169] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1- hydroxyethyl)-2-((1R,3 / ?,5R)-2-(1-methylcyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan- 3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0170] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3R,5 / ?)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-(1- hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0171] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3 / ?,5R)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-methyl- 1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0172] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclopropane-1-carboxamide;

[0173] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclobutane-1 -carboxamide;

[0174] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-2-(1- (2,6-dimethyl-3-oxo-2,3-dihydropyridazin-4-yl)ethyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0175] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyrimidine-4- carboxamide;

[0176] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyridazine-3- carboxamide;

[0177] / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-3,3-difluoroazetidine- 1 -carboxamide;

[0178] 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-((R)-1-((1-methyl-1 / 7-pyrazol-4-yl)amino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile; 5-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(1-fluorocyclopropane-1-carbonyl)pyrrolidin-2-yl)-1 / 7- pyrrolo[3,2-c]quinolin-4-yl)-N,N-dimethylpicolinamide; and methyl (2R)-2-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(4-((dimethylamino)methyl)-2,3-difluorophenyl)-6-fluoro-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate; and pharmaceutically acceptable salts thereof.

[0179] In another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

[0180] In yet another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0181] In still another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”):

[0182] In an embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”):

[0183] In another aspect, the KRAS G12D inhibitor is a compound of Formula IV:

[0184] or a pharmaceutically acceptable salt thereof, wherein:

[0185] Cy1is phenyl optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, OH, C1-3 alkoxy, and C1-3 haloalkoxy;

[0186] R1is halogen;

[0187] R2is selected from H, D, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-5 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-e cycloalkyl- C1-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, CN, ORa2, C(O)Rb2, C(O)NRc2Rd2, NRc2Re2, and NRc2C(O)Rb2; wherein the C3-5 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene forming R2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, and 4-6 membered heterocycloalkyl-Ci-3 alkylene forming R2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, and 4-6 membered heterocycloalkyl-Ci-3 alkylene forming R2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each Ra2is independently selected from C1-6 alkyl, C2-6 alkenyl, C2-6 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl forming Ra2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Ra2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Ra2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-6 alkyl, C2-6 alkenyl, and C2-6 alkynyl forming Ra2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each Rb2, Rc2, and Rd2is independently selected from H, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming Rb2, Rc2, and Rd2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; or any Rc2and Rd2attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each Re2is independently selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl forming Re2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Re2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Re2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl, forming Re2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; or

[0188] Rc2and Re2attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each R2Ais independently selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, and R2B, wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl, forming R2Aare each optionally substituted with 1 , 2 or 3 substituents independently selected from R2B; each R2Bis independently selected from C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa2B, C(O)Rb2B, C(O)NRc2BRd2B, C(O)ORa2B, NRc2BRd2B, and S(O)2Rb2B; wherein the Ci-3alkyl, C3-6cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2C; each R2Cis independently selected from Ci-3alkyl, C2.3alkenyl, C2.3alkynyl, Ci-3haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa2C, C(O)Rb2C, C(O)NRc2CRd2C, C(O)ORa2C, NRc2CRd2C, and S(O)2Rb2C; each Ra2B, Rb2B, Rc2Band Rd2Bis independently selected from H, Ci-3alkyl, and Ci-3haloalkyl; each Ra2C, Rb2C, Rc2Cand Rd2Cis independently selected from H, Ci-3alkyl, and Ci-3haloalkyl;

[0189] R3is selected from Ci-3alkyl, C2.3alkenyl, C2.3alkynyl, C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, 5-10 membered heteroaryl, OR3A, and NR3BR3C; wherein the C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl Ci-3alkyl forming R3are each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl or 5-10 membered heteroaryl forming R3is optionally substituted by oxo to form a carbonyl group; and wherein the Ci-3alkyl, C2.3alkenyl, and C2.3alkynyl forming R3are each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;

[0190] R3Ais selected from Ci-3alkyl, C2.3alkenyl, C2.3alkynyl, C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, and 5-10 membered heteroaryl; wherein the C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl Ci-3alkyl forming R3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Aconsist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl or 5-10 membered heteroaryl forming R3Ais optionally substituted by oxo to form a carbonyl group; and wherein the Ci-3alkyl, C2.3alkenyl, and C2.3alkynyl forming R3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;

[0191] R3Bis selected from H, Ci-3alkyl, C2.3alkenyl, C2.3alkynyl, C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, and 5-10 membered heteroaryl; wherein the C3-io cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl forming R3Bare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Bconsist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Bis optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Bare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;

[0192] R3Band R3C, together with the N atom to which they are both attached, optionally form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group that is optionally substituted with 1 , 2, or 3 substituents independently selected from independently selected from R3D;

[0193] R3Cis selected from H, C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl; wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Care each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E; each R3Dis independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, and R3E; wherein each of the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Dis optionally substituted with 1 , 2, or 3 substituents independently selected from R3E; each R3Eis independently selected from D, halo, CN, ORa3, SRa3, C(O)Rb3, C(O)NRc3Rd3, C(O)ORa3, OC(O)Rb3, OC(O)NRc3Rd3, NRc3Rd3, NRc3C(O)Rb3, NRc3C(O)NRc3Rd3, NRc3C(O)ORa3, C(=NRe3)NRc3Rd3, NRc3C(=NRe3)NRc3Rd3, S(O)Rb3, S(O)NRc3Rd3, S(O)2Rb3, NRc3S(O)2Rb3, and S(O)2NRc3Rd3;

[0194] Ra3, Rb3, Rc3, and Rd3are each independently selected from H, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, Ce- aryl, C3-7 cycloalkyl, 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, Ce-w ary l-C 1-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3are each optionally substituted with 1 , 2, 3, 4, or 5 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORa3A, SRa3A, C(O)Rb3A, C(O)NRc3ARd3A, C(O)ORa3A, OC(O)Rb3A, OC(O)NRc3ARd3A, NRc3ARd3A, NRc3AC(O)Rb3A, NRc3AC(O)NRc3ARd3A, NRc3AC(O)ORa3A, C(=NRe3A)NRc3ARd3A, NRc3AC(=NRe3A)NRc3ARd3A, S(O)Rb3A, S(O)NRc3ARd3A, S(O)2Rb3A, NRc3AS(O)2Rb3A, and S(O)2NRc3ARd3A; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3is optionally substituted by oxo to form a carbonyl group; or Rc3and Rd3attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5-membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORa3A, SRa3A, C(O)Rb3A, C(O)NRc3ARd3A, C(O)ORa3A, OC(O)Rb3A, OC(O)NRc3ARd3A, NRc3ARd3A, NRc3AC(O)Rb3A, NRc3AC(O)NRc3ARd3A, NRc3AC(O)ORa3A, C(=NRe3A)NRc3ARd3A, NRc3AC(=NRe3A)NRc3ARd3A, S(O)Rb3A, S(O)NRc3ARd3A, S(O)2Rb3A, NRc3AS(O)2Rb3A, and S(O)2NRc3ARd3A;

[0195] Ra3A, Rb3A, Rc3A, and Rd3Aare each independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, aryl, Ce- aryl-Ci-s alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the C1-6 alkyl, C1-6 haloalkyl, C2-6 alkenyl, C2-6 alkynyl Ce- aryl-Ci-s alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-6 alkyl, C1-6 alkoxy, C1-6 haloalkyl, and C1-6 haloalkoxy; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Aconsist of at least one carbon atom, and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; and wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Ais optionally substituted by oxo to form a carbonyl group; or

[0196] Rc3Aand Rd3Aattached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5-membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-6 alkyl, C1-6 alkoxy, C1-6 haloalkyl, and C1-6 haloalkoxy; Re3, and Re3Aare each, independently, H, CN or NO2; each R4is independently selected from H, D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, and ORa4; each Ra4is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, ORa5, C1-3 haloalkyl, C2-3 alkenyl, and C2-3 alkynyl; or, optionally, two other R5attached to the same carbon atom, together with the carbon atom to which they are both attached, form a spiro C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo;

[0197] R5Ais H, D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, ORa5A, CN, or Cy2; wherein the C1-3 alkyl forming R5Ais optionally substituted with 1 , 2, 3 or 4 substituents each selected from R5Band also optionally substituted with Cy2, or, optionally, R5Aand R5attached to the same carbon atom, together with the carbon atom to which they are both attached, form a spiro C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; or, optionally, R5Aand R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; each R5Bis independently selected from D and halo; each Ra5is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;

[0198] Ra5Ais selected from H, C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, 3 or 4 substituents each selected from R5Band also optionally substituted with Cy2;

[0199] Cy2is selected from C3-7 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl; wherein the C3-7 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, 5-10 membered heteroaryl, Ce- aryl, and 5-10 membered heteroaryl forming Cy2is optionally substituted with 1 , 2, 3, or 4 substituents independently selected from RCy2; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming Cy2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 4- 10 membered heterocycloalkyl and 5-10 membered heteroaryl forming Cy2is optionally substituted by oxo to form a carbonyl group; each RCy2is independently selected from D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, 5-10 membered heteroaryl, halo, CN, ORaCy21, SRaCy21, C(O)RbCy21, C(O)NRcCy21RdCy21, C(O)ORaCy21,

[0200] OC(O)RbCy21, OC(O)NRcCy21RdCy21, NRcCy21RdCy21, NRcCy21C(O)RbCy21,

[0201] NRcCy21C(O)NRcCy21RdCy21, NRcCy21C(O)ORaCy21, C(=NReCy21)NRcCy21RdCy21,

[0202] NRcCy21C(=NReCy21)NRcCy21RdCy21, S(O)RbCy21, S(O)NRcCy21RdCy21, S(O)2RbCy21,

[0203] NRcCy2is(O)2RbCy21, and S(O)2NRcCy21RdCy21; wherein the C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl forming RCy2are each optionally substituted by 1 , 2, 3, or 4 substituents independently selected from RCy2A; wherein the ring- forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming RCy2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming RCy2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming RCy2are each optionally substituted by 1 , 2, or 3 substituents independently selected from RCy2B- each R°y2Ais independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, and RCy2B; wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming RCy2Aare each optionally substituted by 1 , 2, or 3 substituents independently selected from R0''26, each RCy2Bis independently selected from D, halo, CN, ORaCy21, SRaCy21, C(O)RbCy21,

[0204] C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, Ce-w aryl, C3-7 cycloalkyl, 5-10 membered heteroaryl,

[0205] 4-10 membered heterocycloalkyl, Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl,

[0206] C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCy21, RCCY2Ianc| Rdcy2iare eac|-loptionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORaCy22, SRaCy22, C(O)RbCy22, C(O)NRcCy22RdCy22, C(O)ORaCy22, OC(O)RbCy22, OC(O)NRcCy22RdCy22, NRcCy22RdCy22, NRcCy22C(O)RbCy22, NRcCy22C(O)NRcCy22RdCy22, NRcCy22C(O)ORaCy22, C(=NReCy22)NRcCy22RdCy22, NRcCy22C(=NReCy22)NRcCy22RdCy22, S(O)RbCy22, S(O)NRcCy22RdCy22, S(O)2RbCy22,

[0207] NRcCy22s(O)2RbCy22, and S(O)2NRcCy22RdCy22; wherein the ring-forming atoms each of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCv21, RCCY2I ,anc| Rdcy2i consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCv21, RCCY2I ,anc| Rdcy2i jSoptionally substituted by oxo to form a carbonyl group; or RcCy21and RdCy21attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5- membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORaCy22, SRaCy22, C(O)RbCy22, C(O)NRcCy22RdCy22, C(O)ORaCy22, OC(O)RbCy22, OC(O)NRcCy22RdCy22, NRcCy22RdCy22, NRcCy22C(O)RbCy22, NRcCy22C(O)NRcCy22RdCy22,dCy22, S(O)RbCy22, m H, C1-3 alkyl,

[0208] C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, aryl, Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl- C1-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCy22, Rccy22anc| Rdcy22aregg^ optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-3 alkyl), N(CI-3 alkyl)2, halo, C1-3 alkyl, C1-3 alkoxy, C1-3 haloalkyl, and C1-3 haloalkoxy; wherein the ring-forming atoms each of the 5- 10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCy22, RCCY22,anc| Rdcy22 consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCy22, RcCy22,anRdCy22jSoptionally substituted by oxo to form a carbonyl group; or

[0209] RcCy22and RdCy22attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5- membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-3 alkyl, C1-3 alkoxy, C1-3 haloalkyl, and C1-3 haloalkoxy; and

[0210] ReCy21and ReCy22are each, independently, H, CN or NO2.

[0211] In an embodiment of Formula IV,

[0212] Cy1is phenyl optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;

[0213] R1is halo;

[0214] R2is C1-3 alkyl optionally substituted with OH;

[0215] R3is C3-10 cycloalkyl optionally substituted with halo; each R4is H; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, and halo; and

[0216] R5Ais H, halo, or ORa5A; Ra5Ais selected from C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D, and also optionally substituted with Cy2; and Cy2is selected from Ce-io aryl and 5-10 membered heteroaryl.

[0217] In another embodiment of Formula IV,

[0218] Cy1is phenyl optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;

[0219] R1is halo;

[0220] R2is C1-3 alkyl optionally substituted with OH;

[0221] R3is OR3Aor C3-10 cycloalkyl optionally substituted with halo;

[0222] R3Ais C1-3 alkyl; each R4is H; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, and halo;

[0223] R5Ais H, halo, or ORa5A;

[0224] Ra5Ais selected from C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D, and also optionally substituted with Cy2; and

[0225] Cy2is selected from Ce-io aryl and 5-10 membered heteroaryl.

[0226] In another embodiment of Formula IV,

[0227] Cy1is phenyl optionally substituted with 1 or 2 substituents each selected from C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;

[0228] R1is halo;

[0229] R2is C1-3 alkyl optionally substituted with OH;

[0230] R3is OR3Aor C3-10 cycloalkyl optionally substituted with halo;

[0231] R3Ais C1-3 alkyl; each R4is H; one R5is R5A; and each other R5is independently selected from H, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl;

[0232] R5Ais H, halo, or ORa5A; and

[0233] Ra5Ais selected from C1-3 alkyl and C1-3 haloalkyl, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D.

[0234] In an embodiment, the compound of Formula IV is a compound of Formula IV-A or Formula IV-B:

[0235] or a pharmaceutically acceptable salt thereof.

[0236] In another embodiment, the compound of Formula IV is selected from:

[0237] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-methoxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0238] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-fluoro-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0239] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(6-(cyclopropanecarbonyl)-6- azatricyclo[3.2.1 ,02,4]octan-7-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0240] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(methoxy-d3)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0241] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-3-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0242] 3-(2-(5-(benzyloxy)-2-(cyclopropanecarbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-1-(2- azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0243] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0244] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(5-fluoro-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-4-((R)-1-hydroxyethyl)-1H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0245] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(difluoromethyl)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0246] 5-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-4-yl)- N,N-dimethylpicolinamide;

[0247] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2- yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0248] 4-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-4-yl)- 2-fluoro-N-methylbenzamide;

[0249] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-methyl-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0250] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-hydroxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0251] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-2-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0252] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-4-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0253] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0254] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(5-fluoro-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-4-(1-hydroxyethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0255] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(5-chloro-2-(1-fluorocyclopropane-1-carbonyl)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0256] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5- (trifluoromethoxy)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0257] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-cyclopropoxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;

[0258] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1 -fluorocyclopropane- 1 -carbonyl)-2-azabicyclo[2.2.1 ]heptan-3-yl)-6-fluoro-4-(1 - hydroxyethyl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;

[0259] 3-(1 -(2-azabicyclo[2.1.1]hexan-5-yl)-2-(5-cyclopropoxy-2-(1-fluorocyclopropane-1- carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; methyl 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-2-yl)-5-(trifluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate;

[0260] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(2-(1- fluorocyclopropane-1-carbonyl)-5-(trifluoromethoxy)-2-azabicyclo[2.2.1]heptan-3-yl)-4- methyl-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; methyl 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethyl)-2- azabicyclo[2.2.1]heptane-2-carboxylate; and

[0261] 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethyl)-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; and pharmaceutically acceptable salts thereof.

[0262] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-(1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof.

[0263] In still another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3- (( / ?a)-1-((1 / ?,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate:

[0264]

[0265] In an embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Sa)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate:

[0266] In another embodiment, the KRAS G12D inhibitor is selected from MRTX1133, RMC- 9805, HRS-4642, ASP-3082, BI-2852, MRTX-EX185, 3144, QTX3046, VRTX153, JAB- 22000, TH-Z827, TH-Z801 , TH-Z814, TH-Z816, TH-Z835, TH-Z827, TH-Z837, KD-8, NS-1, and CAS No.: 2765254-39-3.

[0267] In some embodiments, the inhibitor of KRAS G12D inhibitor is selected from a compound as disclosed in WO2018 / 145020, WG2022 / 015375, WO2021 / 091967, WG2022 / 060836, US2023 / 0293464A1 , US2023 / 0219951A1 , or US2023 / 0285498A1 , the contents of which are incorporated by reference in their entirety.

[0268] In some embodiments, the inhibitor of KRAS G12D inhibitor is selected from a compound as disclosed in WO2016161361; WO2020212895; WG2021041671 ; WG2021081212; WO2021106231 ; WO2021107160; WO2021126799; WO2021215544; WO2021248079; WO2021248082 WO2021248095; WG2022002102; WO2022015375; WO2022031678; WG2022042630; WO2022066646; WO2022098625; WO2022105855; WO2022105857; WO2022105859; WO2022173033; WO2022177917; WO2022184178; WO2022188729; WO2022192794; WO2022194066; WO2022194191; WO2022194192; WO2022198905; WO2022199170; WO2022199586; WO2022206723; WO2022206724; WO2022212947; WO2022214102; WO2022217042; WO2022221739; WG2022223020; WO2022227987; WO2022228543; WO2022232331 ; WO2022232332; WO2022234639; WO2022234851 ; WO2022240971 ; WO2022261154; WO2022262686; WO2022262838; WO2022266069; WO2022268051 ; W02023001123; W02023001141 ; W02023018810; WO2023018812; W02023020347; W02023025116; W02023030495; WO2023051586; WO2023056951 ; WO2023059594; WO2023059596; WO2023059597; WO2023059598; W02023059600; WO2023061294; WO2023061463; WO2023072188; WO2023085657; WO2023098425; WO2023098426; WO2023098832; WO2023101928; WO2023103523; WO2023103906; W02023104018; WO2023113739; WO2023122662; WO2023125627; WO2023125989; WO2023133183; WO2023134465; WO2023143312; WO2023159086; WO2023159087; WO2023179629; WO2023179703; WO2023274324; WO2023274383; W02023278600; W02023280026; W02023280280; WO2023283933; WO2023284537; WO2023284881 ; US11453683; US20180086752; US20180201610; US20220323614; US20220402971 ; US20230077225; US20230083431 ; US20230174518; US20230242544; and US20230279025, the contents of which are incorporated by reference in their entirety.

[0269] In yet another embodiment, the KRAS G12D inhibitor is a proteolysis targeting chimera (PROTAC). PROTACs are heterobifunctional compounds comprised of a ligand for a target protein (e.g., KRAS with a G12D mutation) and a ligand for an E3 ligase joined by a linker.

[0270] In some embodiments, the inhibitor of KRAS G12D proteolysis targeting chimera (PROTAC) is selected from compounds as disclosed in WO2022148421 ; WO2022148422; WO2022173032; WO2023077441 ; WO2023081476; WO2023119677; WO2023120742; WO2023138524; and WO2023171781 ; the contents of which are incorporated by reference in their entirety.

[0271] In one embodiment, the disclosed compounds may exist as tautomers. All tautomers are included within the scope of the compounds presented herein.

[0272] Compounds provided herein can exist in the form of atropisomers ( / .e., conformational diastereoisomers) that can be stable at ambient temperature and separable, e.g., by chromatography. For example, the compounds of Formula I can exist in the form of atropisomers that are interchangeable by rotation around the bond connecting Cy1(or any of the embodiments thereof) to the remainder of the molecule. Reference to the compounds described herein or any of the embodiments is understood to include all such atropisomeric forms of the compounds. Without being limited by any theory, it is understood that, for a given compound, one atropisomer may be more potent as an inhibitor of KRAS (including G12D mutated form of KRAS) than another atropisomer. For example, compounds of formula I as described herein in which Cy1is 2,3-dichlorophenyl can exist in the form of atropisomers in which the conformation of the dichlorophenyl relative to the remainder of the molecule is as shown by the partial formulae Formula IV-A or Formula IV-B below. The asymmetry of atropisomers is assigned as either Raor Sa, as determined by conventional methods of characterizing points of asymmetry. Without being limited by any theory, it is understood that, for a given compound, the atropisomer represented by Formula IV-A is generally more potent as an inhibitor of KRAS (including G12D mutated forms of KRAS) than the atropisomer represented by Formula IV-B.

[0273] Compounds described herein also include isotopically-labeled compounds wherein one or more atoms is replaced by an atom having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes suitable for inclusion in the compounds described herein include and are not limited to2H,3H,11C,13C,14C,36CI,18F,123l,125l,13N,15N,15O,170,18O,32P, and35S. In another embodiment, isotopically-labeled compounds are useful in drug or substrate tissue distribution studies. In another embodiment, substitution with heavier isotopes such as deuterium affords greater metabolic stability (for example, increased in vivo half-life or reduced dosage requirements). In yet another embodiment, the compounds described herein include a2H ( / .e., deuterium) isotope.

[0274] In still another embodiment, substitution with positron emitting isotopes, such as11C,18F,15O and13N, is useful in Positron Emission Topography (PET) studies for examining substrate receptor occupancy. Isotopically-labeled compounds are prepared by any suitable method or by processes using an appropriate isotopically-labeled reagent in place of the non-labeled reagent otherwise employed.

[0275] The specific compounds described herein, and other compounds encompassed by one or more of the formulas described herein having different substituents are synthesized using techniques and materials described herein and as described, for example, in Fieser and Fieser’s Reagents for Organic Synthesis, Volumes 1-17 (John Wiley and Sons, 1991); Rodd’s Chemistry of Carbon Compounds, Volumes 1-5 and Supplemental (Elsevier Science Publishers, 1989); Organic Reactions, Volumes 1-40 (John Wiley and Sons, 1991), Carey and Sundberg, Advanced Organic Chemistry 4th Ed., Vols. A and B (Plenum 2000, 2001), Advances in Heterocyclic Chemistry, Vols. 1-114 (Elsevier, 1963-2023); Journal of Heterocyclic Chemistry V ols. 1-60 (Journal of Heterocyclic Chemistry, 1964-2023); E. M. Carreira, et al. (Eds.) Science of Synthesis, Vols. 1-48 (2001-2010) and Knowledge Updates KU2010 / 1-4; 2011 / 1-4; 2012 / 1-4, 2013 / 1-4; 2014 / 1-4, 2015 / 1-2; 2016 / 1-3, 2017 / 1-3; 2018 / 1- 4, 2019 / 1-3; 2020 / 1-3, 2021 / 1-3, 2022 / 1-3, 2023 / 1 (Thieme, 2001-2023); Houben-Weyl, Methoden der Organischen Chemie, 4thEd. Vols. 1-67 (Thieme, 1952-1987); Houben-Weyl, Methoden der Organischen Chemie, E-Series. Vols. 1-23 (Thieme, 1982-2003); A. R. Katritzky, et al. (Eds.), Comprehensive Organic Functional Group Transformations, Vols. 1-6 (Pergamon Press, 1995); A. R. Katritzky et al. (Eds.), Comprehensive Organic Functional Group Transformations II, Vols. 1-6 (Elsevier, 2ndEdition, 2005); A. R. Katritzky et al. (Eds.); Comprehensive Heterocyclic Chemistry, Vols. 1-8 (Pergamon Press, 1984); A. R. Katritzky, et al. (Eds.); Comprehensive Heterocyclic Chemistry II, Vols. 1-10 (Pergamon Press, 1996); A. R. Katritzky, et al. (Eds.); Comprehensive Heterocyclic Chemistry III, Vols. 1-14 (Elsevier Science, 2008); D. St.C. Black, et al. (Eds.); Comprehensive Heterocyclic Chemistry IV, Vols. 1-14 (Elsevier Science, 2022); M.B. Smith et al., March's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, 6thEd. (Wiley, 2007); M. B. Smith et al., March's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, 8thEd. (Wiley, 2020); B. M. Trost et al. (Ed.), Comprehensive Organic Synthesis, Vols. 1-9 (Pergamon Press, 1991); and Patai's Chemistry of Functional Groups, 100 Vols. (Wiley 1964-2022) (all of which are incorporated by reference for such disclosure). General methods for the preparation of compounds as described herein are modified by the use of appropriate reagents and conditions, for the introduction of the various moieties found in the Formulas as provided herein.

[0276] Compounds described herein are synthesized using any suitable procedures starting from compounds that are available from commercial sources, or are prepared using procedures described herein.

[0277] EGFR Inhibitors

[0278] The combination therapy provided herein can comprise a KRAS G12D inhibitor and any one of a number of EGFR inhibitors.

[0279] EGFR is a member of the ErbB family of receptor tyrosine kinases found in both normal and tumor cells; it is responsible for regulating epithelial tissue development and homeostasis. EGFR has been implicated in various types of cancer, as it is often overexpressed in malignant cells, and EGFR overexpression has been linked to more advanced disease and poor prognosis. EGFR is often mutated in certain types of cancer and serves as a driver of tumorigenesis. In vitro, cetuximab was shown to mediate anti-tumor effects in numerous cancer cell lines and human tumor xenografts.

[0280] In some embodiments, the EGFR inhibitor is a small molecule inhibitor. In an embodiment, the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib. In some embodiments, the EGFR inhibitor is an anti-EGFR antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab.

[0281] In some embodiments, the EGFR inhibitor is cetuximab.

[0282] Cetuximab is a recombinant chimeric human / mouse IgG 1 monoclonal antibody that competitively binds to epidermal growth factor receptor (EGFR) and competitively inhibits the binding of epidermal growth factor (EGF). An antibody consisting of the heavy chain and the light chain listed below is termed cetuximab.

[0283] Cetuximab heavy chain (HC)

[0284] QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDY NTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QG N VFSCSVM H EALH N H YTQKSLSLSPG K Cetuximab light chain (LC)

[0285] DI LLTQSPVI LSVSPGERVSFSCRASQSIGTN I HWYQQRTNGSPRLLI KYASESISGI PS RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECT

[0286] Methods of Treatment

[0287] In an aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor.

[0288] In another aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject: a pharmaceutical composition comprising a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient; and a pharmaceutical composition comprising an EGFR inhibitor, or pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

[0289] In an embodiment, the KRAS G12D inhibitor is a compound of Formula I, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound listed supra. In another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

[0290] In yet another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0291] In still another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”).

[0292] In an embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”).

[0293] In an embodiment, the KRAS G12D inhibitor is a compound of Formula IV, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound of Formula IV listed supra. In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8- (2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof.

[0294] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Ra)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0295] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Sa)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0296] In some embodiments, the EGFR inhibitor is an anti-EGFR antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab. In some embodiments, the EGFR inhibitor is cetuximab. In an embodiment, the EGFR inhibitor is a small molecule inhibitor. In an embodiment, the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib.

[0297] In another embodiment, the KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, is administered in combination with an EGFR inhibitor, or pharmaceutically acceptable salt thereof. In some embodiments, the EGFR inhibitor is a small molecule inhibitor. In an embodiment, the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib.

[0298] In some embodiments, the EGFR inhibitor is an anti-EGFR antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab. In some embodiments, the EGFR inhibitor is cetuximab.

[0299] In yet another aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject: a pharmaceutical composition comprising Compound 1 , and at least one pharmaceutically acceptable carrier or excipient; and a pharmaceutical composition comprising cetuximab, and at least one pharmaceutically acceptable carrier or excipient.

[0300] In yet another aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject: a pharmaceutical composition comprising Compound 1*, and at least one pharmaceutically acceptable carrier or excipient; and a pharmaceutical composition comprising cetuximab, and at least one pharmaceutically acceptable carrier or excipient.

[0301] In yet another embodiment, the KRAS G12D inhibitor has an IC50 of about 100 nM or lower. In still another embodiment, the KRAS G12D inhibitor is selective for inhibiting G12D versus wild-type KRAS.

[0302] In another embodiment, the KRAS G12D inhibitor is administered to the subject in a pharmaceutical composition comprising the KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

[0303] In yet another embodiment, the EGFR inhibitor is administered to the subject in a pharmaceutical composition comprising the EGFR inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

[0304] In yet another aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is 3-(1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

[0305] In an embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0306] In another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”).

[0307] In yet another embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”).

[0308] In another aspect, provided herein is a method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is methyl (1 R,3R,4R,5S)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1 ]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

[0309] In another embodiment of the methods, the KRAS G12D inhibitor is administered twice daily (BID). In another embodiment, the KRAS G12D inhibitor is administered once daily (QD). In yet another embodiment, the KRAS G12D inhibitor is administered orally (PO).

[0310] In an embodiment, the EGFR inhibitor is administered twice a week (BIW). In another embodiment, the EGFR inhibitor is administered as an intravenous injection (IV).

[0311] In yet another embodiment, the cancer is selected from carcinomas, hematological cancers, sarcomas, and glioblastoma. In still another embodiment, the cancer is a cancer comprising abnormally proliferating cells having a KRAS G12D mutation.

[0312] In an embodiment, the method further comprises identifying the presence of abnormally proliferating cells having a KRAS G12D mutation.

[0313] In another embodiment, the cancer is a hematological cancer selected from myeloproliferative neoplasms, myelodysplastic syndrome, chronic and juvenile myelomonocytic leukemia, acute myeloid leukemia, acute lymphocytic leukemia, and multiple myeloma.

[0314] In another embodiment, the cancer is a carcinoma selected from pancreatic, colorectal, lung, bladder, gastric, esophageal, breast, head and neck, cervical, skin, and thyroid carcinomas. In yet another embodiment, the carcinoma is colorectal carcinoma. In still another embodiment, the carcinoma is lung carcinoma. In an embodiment, the carcinoma is pancreatic carcinoma.

[0315] In another embodiment, the cancer is colorectal cancer.

[0316] In yet another embodiment, the cancer is non-small cell lung cancer (NSCLC).

[0317] In still another embodiment, the cancer is pancreatic ductal adenocarcinoma.

[0318] In another aspect, provided herein is a method of treating colorectal cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

[0319] In an embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0320] In another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”).

[0321] In yet another embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”).

[0322] In another aspect, provided herein is a method of treating colorectal cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is methyl (1R,3R,4R,5S)-3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

[0323] In an embodiment, the cancer is metastatic.

[0324] In an embodiment of the methods, the KRAS inhibitor and EGFR inhibitor are administered separately.

[0325] In another embodiment of the methods, the cancer is a myeloproliferative neoplasm.

[0326] In another embodiment of the methods, the cancer is a myelodysplastic syndrome. Myelodysplastic syndromes (MDS) can include hematopoietic stem cell disorders characterized by one or more of the following: ineffective blood cell production, progressive cytopenias, risk of progression to acute leukemia or cellular marrow with impaired morphology and maturation (dysmyelopoiesis). Myelodysplastic syndromes can also include refractory anemia, refractory anemia with ringed sideroblasts, refractory anemia with excess blasts, refractory anemia with excess blasts in transformation and chronic myelomonocytic leukemia.

[0327] In yet another embodiment of the methods, the cancer is selected from the group consisting of chronic myeloid leukemia (CML), polycythemia vera (PV), essential thrombocythemia (ET), myelofibrosis (MF), chronic neutrophilic leukemia, chronic eosinophilic leukemia, chronic myelomonocytic leukemia, juvenile myelomonocytic leukemia, hypereosinophilic syndrome, systemic mastocytosis, atypical chronic myelogenous leukemia, acute lymphoblastic leukemia (ALL), and acute myeloid leukemia (AML). In still another embodiment, the cancer is myelofibrosis (MF).

[0328] In an embodiment of the methods, the cancer is selected from the group consisting of primary myelofibrosis, post-polycythemia vera myelofibrosis, or post-essential thrombocythemia myelofibrosis.

[0329] In another embodiment of the methods, the subject is human.

[0330] In yet another embodiment of the methods, the treatment comprises administering the KRAS inhibitor and the EGFR inhibitor at substantially the same time.

[0331] In still another embodiment of the methods, the treatment comprises administering the KRAS inhibitor and the EGFR inhibitor at different times.

[0332] In an embodiment of the methods, the KRAS inhibitor is administered to the subject, followed by administration of the EGFR inhibitor. In another embodiment, the EGFR inhibitor is administered to the subject, followed by administration of the KRAS inhibitor.

[0333] In another embodiment of the methods, the KRAS inhibitor and / or EGFR inhibitor are administered at dosages that would not be effective when one or both of the KRAS inhibitor and the EGFR inhibitor are administered alone, but which amounts are effective in combination.

[0334] In an embodiment of the methods, the method involves the administration of a therapeutically effective amount of a combination or composition comprising compounds provided herein, or pharmaceutically acceptable salts thereof, to a subject (including, but not limited to a human or animal) in need of treatment (including a subject identified as in need).

[0335] In another embodiment of the methods, the treatment includes co-administering the amount of the KRAS inhibitor and the amount of the EGFR inhibitor. In an embodiment, the amount of the KRAS inhibitor and the amount of the EGFR inhibitor are in a single formulation or unit dosage form. In still other embodiments, the amount of the KRAS inhibitor and the amount of the EGFR inhibitor are in a separate formulations or unit dosage forms. In the foregoing methods, the treatment can include administering the amount of KRAS inhibitor and the amount of EGFR inhibitor at substantially the same time or administering the amount of KRAS inhibitor and the amount of EGFR inhibitor at different times. In some embodiments of the foregoing methods, the amount of KRAS inhibitor and / or the amount of EGFR inhibitor is administered at dosages that would not be effective when one or both of KRAS inhibitor and EGFR inhibitor is administered alone, but which amounts are effective in combination.

[0336] Pharmaceutical Combinations

[0337] In an aspect, provided herein is a pharmaceutical combination comprising a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or pharmaceutically acceptable salt thereof. In an embodiment, the pharmaceutical combination can include separate pharmaceutical dosage forms or pharmaceutical compositions that are also sold independently of each other. In another embodiment, the pharmaceutical combination is for simultaneous or sequential use for being jointly active. In another embodiment, the pharmaceutical combination can include the components separately or together in a single unit dose.

[0338] In an embodiment, the KRAS G12D inhibitor is a compound of Formula I, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound listed supra. In another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

[0339] In yet another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0340] In still another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”).

[0341] In an embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”).

[0342] In an embodiment, the KRAS G12D inhibitor is a compound of Formula IV, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound of Formula IV listed supra. In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8- (2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof.

[0343] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Ra)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0344] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Sa)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0345] In some embodiments, the EGFR inhibitor is an anti-EGFR antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab. In some embodiments, the EGFR inhibitor is cetuximab.

[0346] In an embodiment, the EGFR inhibitor is a small molecule inhibitor. In an embodiment, the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib.

[0347] In another embodiment of the pharmaceutical combinations, the KRAS G12D inhibitor is administered twice daily (BID). In another embodiment, the KRAS G12D inhibitor is administered once daily (QD). In yet another embodiment, the KRAS G12D inhibitor is administered orally (PO).

[0348] In an embodiment, the EGFR inhibitor is administered twice a week (BIW). In another embodiment, the EGFR inhibitor is administered as an intravenous injection (IV). In another embodiment, the EGFR inhibitor is administered as an intraperitoneal injection (IP).

[0349] The administration of a pharmaceutical combination provided herein may result in a beneficial effect, e.g., a synergistic therapeutic effect, e.g., with regard to alleviating, delaying progression of or inhibiting the symptoms, and may also result in further surprising beneficial effects, e.g., fewer side-effects, an improved quality of life or a decreased morbidity, compared with a monotherapy applying only one of the pharmaceutically active ingredients used in the combination of the invention.

[0350] Pharmaceutical Compositions

[0351] In an aspect, provided herein is a pharmaceutical composition comprising a) a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof; b) an EGFR inhibitor, or a pharmaceutically acceptable salt thereof; and c) at least one pharmaceutically acceptable carrier or excipient.

[0352] In an embodiment, the KRAS G12D inhibitor is a compound of Formula I, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound listed supra. In another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

[0353] In yet another embodiment, the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1*”).

[0354] In still another embodiment, the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1”).

[0355] In an embodiment, the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate (“Compound 1a”).

[0356] In an embodiment, the KRAS G12D inhibitor is a compound of Formula IV, or a pharmaceutically acceptable salt thereof. In another embodiment, the KRAS G12D inhibitor is selected from a compound of Formula IV listed supra. In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8- (2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate (“Compound 2”), or a pharmaceutically acceptable salt thereof.

[0357] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Ra)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0358] In another embodiment, the KRAS G12D inhibitor is methyl (1R,3R,4R,5S)-3-((Sa)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6- fluoro- 4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate, or a pharmaceutically acceptable salt thereof.

[0359] In some embodiments, the EGFR inhibitor is an anti-EGFR antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab. In some embodiments, the EGFR inhibitor is cetuximab.

[0360] In an embodiment, the EGFR inhibitor is a small molecule inhibitor. In an embodiment, the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib.

[0361] Packaged Formulations

[0362] Packaged pharmaceutical formulations or pharmaceutical products are included herein. Such packaged formulations include one or more pharmaceutical formulations comprising a combination of a KRAS inhibitor and an EGFR inhibitor. The combination of compounds in formulated form is contained in a container. The package typically contains instructions for using the formulation to treat an animal (typically a human patient) suffering from cancer.

[0363] In certain embodiments the packaged pharmaceutical formulation or pharmaceutical product contains the combination of compounds described herein in a container with instructions for administering the dosage forms on a fixed schedule. In some of these embodiments, the combination of compounds is provided in separate unit dosage forms.

[0364] In a particular embodiment, the compounds of the combination can be dosed on the same schedule, whether by administering a single formulation or unit dosage form containing all of the compounds of the combination, or by administering separate formulations or unit dosage forms of the compounds of the combination. However, some of the compounds used in the combination may be administered more frequently than once per day, or with different frequencies that other compounds in the combination. Therefore, in one embodiment the packaged pharmaceutical formation contains a formulation or unit dosage form containing all of the compounds in the combination of compounds, and an additional formulation or unit dosage form that includes one of the compounds in the combination of agents, with no additional active compound, in a container, with instructions for administering the dosage forms on a fixed schedule.

[0365] The package formulations provided herein include comprise prescribing information, for example, to a patient or health care provider, or as a label in a packaged pharmaceutical formulation. Prescribing information may include for example efficacy, dosage and administration, contraindication and adverse reaction information pertaining to the pharmaceutical formulation.

[0366] In all of the foregoing the combination of compounds of the invention can be administered alone, as mixtures, or with additional active agents. Administration / Dosage / Formulations

[0367] In another aspect, provided herein is a pharmaceutical composition or pharmaceutical combination comprising the compounds disclosed herein, together with a pharmaceutically acceptable carrier.

[0368] Administration of the combination includes administration of the combination in a single formulation or unit dosage form, administration of the individual agents of the combination concurrently but separately, or administration of the individual agents of the combination sequentially by any suitable route. The dosage of the individual agents of the combination may require more frequent administration of one of the agent(s) as compared to the other agent(s) in the combination. Therefore, to permit appropriate dosing, packaged pharmaceutical products may contain one or more dosage forms that contain the combination of agents, and one or more dosage forms that contain one of the combination of agents, but not the other agent(s) of the combination.

[0369] Actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.

[0370] In particular, the selected dosage level will depend upon a variety of factors including the activity of the particular compound employed, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds or materials used in combination with the compound, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well, known in the medical arts.

[0371] A medical doctor, e.g., physician or veterinarian, having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could begin administration of the pharmaceutical composition to dose the disclosed compound at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.

[0372] In an embodiment, Compound 1 free base equivalent is administered at a dose of about 50 mg to about 2000 mg. In an embodiment, Compound 1 free base equivalent is administered at a dose of about 200 mg to about 1600 mg. In an embodiment, Compound 1 free base equivalent is administered at a dose of about 200 mg to about 1200 mg.

[0373] In an embodiment, Compound 1 free base equivalent is administered at a dose of about 25 mg, about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, or about 2000 mg.

[0374] In an embodiment, Compound 1 is administered once, twice, thrice, or four times daily.

[0375] In an embodiment, Compound 1* free base equivalent is administered at a dose of about 50 mg to about 2000 mg. In an embodiment, Compound 1* free base equivalent is administered at a dose of about 200 mg to about 1600 mg. In an embodiment, Compound 1* free base equivalent is administered at a dose of about 200 mg to about 1200 mg.

[0376] In an embodiment, Compound 1* free base equivalent is administered at a dose of about 100 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, or about 2000 mg.

[0377] In an embodiment, cetuximab is administered at a dose of about 100 mg / m2to about 1000 mg / m2. In an embodiment, cetuximab is administered at a dose of about 300 mg / m2to about 800 mg / m2. In an embodiment, cetuximab is administered at a dose of about 400 mg / m2to about 600 mg / m2.

[0378] In an embodiment, cetuximab is administered at a dose of about 100 mg / m2, about 200 mg / m2, about 250 mg / m2, about 300 mg / m2, about 350 mg / m2, about 400 mg / m2, about 450 mg / m2, about 500 mg / m2, about 550 mg / m2, about 600 mg / m2, about 700 mg / m2, about 800 mg / m2, about 900 mg / m2, about 1000 mg / m2, about 1100 mg / m2, about 1200 mg / m2, about 1300 mg / m2, about 1400 mg / m2, about 1500 mg / m2, about 1600 mg / m2, about 1700 mg / m2, about 1800 mg / m2, about 1900 mg / m2, or about 2000 mg / m2.

[0379] In an embodiment, cetuximab is administered intravenously (IV). In an embodiment, cetuximab is administered once every two weeks (q2wk).

[0380] In particular embodiments, it is especially advantageous to formulate the compound in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the patients to be treated; each unit containing a predetermined quantity of the disclosed compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical vehicle. The dosage unit forms are dictated by and directly dependent on (a) the unique characteristics of the disclosed compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding / formulating such a disclosed compound for the treatment of pain, a depressive disorder, or drug addiction in a patient. In one embodiment, the compounds provided herein are formulated using one or more pharmaceutically acceptable excipients or carriers. In one embodiment, the pharmaceutical compositions provided herein comprise a therapeutically effective amount of a disclosed compound and a pharmaceutically acceptable carrier.

[0381] The drug compounds provided herein (for example, a KRAS inhibitor and an EGFR inhibitor are present in the combinations, dosage forms, pharmaceutical compositions and pharmaceutical formulations disclosed herein in a ratio in the range of 100:1 to 1:100. For example, the ratio of an PD EGFR inhibitor: a KRAS inhibitor can be in the range of 1:100 to 1 :1 , for example, 1 :100, 1 :90, 1 :80, 1:70, 1:60, 1 :50, 1:40, 1:30, 1:20, 1:10, 1:5, 1:2, or 1:1 of EGFR inhibitor: KRAS inhibitor. In another example, the ratio of a KRAS inhibitor : an EGFR inhibitor can be in the range of 1 :100 to 1:1, for example, 1:100, 1:90, 1:80, 1:70, 1 :60, 1:50, 1 :40, 1:30, 1:20, 1 :10, 1:5, 1:2, or 1:1 of a KRAS inhibitor : an EGFR inhibitor.

[0382] The optimum ratios, individual and combined dosages, and concentrations of the drug compounds that yield efficacy without toxicity are based on the kinetics of the active ingredients’ availability to target sites, and are determined using methods known to those of skill in the art.

[0383] Routes of administration of any of the compositions discussed herein include oral, nasal, rectal, intravaginal, parenteral, buccal, sublingual or topical. The compounds may be formulated for administration by any suitable route, such as for oral or parenteral, for example, transdermal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans) urethral, vaginal (e.g., trans- and perivaginally), (intra)nasal and (trans) rectal), intravesical, intrapulmonary, intraduodenal, intragastrical, intrathecal, subcutaneous, intramuscular, intradermal, intra-arterial, intravenous, intrabronchial, inhalation, and topical administration. In one embodiment, the preferred route of administration is oral.

[0384] Suitable compositions and dosage forms include, for example, tablets, capsules, caplets, pills, gel caps, troches, dispersions, suspensions, solutions, syrups, granules, beads, transdermal patches, gels, powders, pellets, magmas, lozenges, creams, pastes, plasters, lotions, discs, suppositories, liquid sprays for nasal or oral administration, dry powder or aerosolized formulations for inhalation, compositions and formulations for intravesical administration and the like. It should be understood that the formulations and compositions are not limited to the particular formulations and compositions that are described herein.

[0385] For oral application, particularly suitable are tablets, dragees, liquids, drops, suppositories, or capsules, caplets and gel caps. The compositions intended for oral use may be prepared according to any method known in the art and such compositions may contain one or more agents selected from the group consisting of inert, non-toxic pharmaceutically excipients that are suitable for the manufacture of tablets. Such excipients include, for example an inert diluent such as lactose; granulating and disintegrating agents such as cornstarch; binding agents such as starch; and lubricating agents such as magnesium stearate. The tablets may be uncoated or they may be coated by known techniques for elegance or to delay the release of the active ingredients. Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert diluent.

[0386] For parenteral administration, the disclosed compounds may be formulated for injection or infusion, for example, intravenous, intramuscular or subcutaneous injection or infusion, or for administration in a bolus dose or continuous infusion. Suspensions, solutions or emulsions in an oily or aqueous vehicle, optionally containing other formulatory agents such as suspending, stabilizing or dispersing agents may be used.

[0387] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures, embodiments, claims, and examples described herein. Such equivalents were considered to be within the scope of this disclosure and covered by the claims appended hereto. For example, it should be understood, that modifications in reaction conditions, including but not limited to reaction times, reaction size / volume, and experimental reagents, such as solvents, catalysts, pressures, atmospheric conditions, e.g., nitrogen atmosphere, and reducing / oxidizing agents, with art-recognized alternatives and using no more than routine experimentation, are within the scope of the present application.

[0388] It is to be understood that wherever values and ranges are provided herein, all values and ranges encompassed by these values and ranges, are meant to be encompassed within the scope of the present disclosure. Moreover, all values that fall within these ranges, as well as the upper or lower limits of a range of values, are also contemplated by the present application.

[0389] The following examples further illustrate aspects of the present disclosure. However, they are in no way a limitation of the teachings of the present disclosure as set forth.

[0390] EXAMPLES

[0391] The compounds and methods disclosed herein are further illustrated by the following examples, which should not be construed as further limiting. The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of organic synthesis, cell biology, cell culture, and molecular biology, which are within the skill of the art.

[0392] The KRAS inhibitors provided herein, their syntheses, and their biological activity against KRAS can be found in WO 2023 / 064857, which is incorporated by reference in its entirety. The KRAS inhibitors provided herein, their syntheses, and their biological activity against KRAS can be found in PCT / US2024 / 025160, which is incorporated by reference in its entirety. The EGFR inhibitor provided herein, its synthesis, and biological activity against EGFR can be found in US 6,217,866, which is incorporated by reference in its entirety.

[0393] The following abbreviations may be used herein: AcOH (acetic acid); AC2O (acetic anhydride); aq. (aqueous); atm. (atmosphere(s)); Boc (t-butoxycarbonyl); BOP ((benzotriazol-1-yloxy)tris(dimethylamino)phosphonium hexafluorophosphate); br (broad); Cbz (carboxy benzyl); calc, (calculated); d (doublet); dd (doublet of doublets); DBU (1 ,8- diazabicyclo[5.4.0]undec-7-ene); DCM (dichloromethane); DIAD (A / , A / -diisopropyl azidodicarboxylate); DIEA (N,N-diisopropylethylamine); DIPEA (A / , / V-diisopropylethylamine); DIBAL (diisobutylaluminium hydride); DMF ( / V, / V-dimethylformamide); DMSO (dimethyl sulfoxide); Et (ethyl); EtOAc (ethyl acetate); FCC (flash column chromatography); g (gram(s)); h (hour(s)); HATU (A / , A / , A / ', / V'-tetramethyl-O-(7-azabenzotriazol-1-yl)uronium hexafluorophosphate); HCI (hydrochloric acid); HPLC (high performance liquid chromatography); Hz (hertz); J (coupling constant); L (liter(s)); LCMS (liquid chromatography - mass spectrometry); LDA (lithium diisopropylamide); m (multiplet); M (molar); mCPBA (3- chloroperoxybenzoic acid); MS (Mass spectrometry); Me (methyl); MeCN (acetonitrile); MeOH (methanol); mg (milligram(s)); min. (minutes(s)); mL (milliliter(s)); mmol (millimole(s)); MTBE (methyl terf-butyl ether); N (normal); NCS (N-chlorosuccinimide); NEta (triethylamine); nM (nanomolar); NMP (N-methylpyrrolidinone); NMR (nuclear magnetic resonance spectroscopy); OTf (trifluoromethanesulfonate); Ph (phenyl); pM (picomolar); PPT(precipitate); RP-HPLC (reverse phase high performance liquid chromatography); r.t. (room temperature), s (singlet); t (triplet or tertiary); TBS (tert-butyldimethylsilyl); tert (tertiary); tt (triplet of triplets); TFA (trifluoroacetic acid); THF (tetrahydrofuran); pg (microgram (s)); pL (microliter(s)); pM (micromolar); wt % (weight percent). Brine is saturated aqueous sodium chloride. In vacuo is under vacuum.

[0394] Example 1 : Synthesis Procedure for 3-(1-((1 / ?,4 / ?,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-2- ((1 / ?,3 / ?,5 / ?)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile Step 1. Methyl 2-amino-4-bromo-3-fluorobenzoate:

[0395] Dimethyl sulfate (823 g, 6.53 mole) was added to a mixture of 2-amino-4-bromo-3- fluorobenzoic acid (1500 g, 6.22 mole) and potassium carbonate (945 g, 6.84 mole) in N,N- dimethylamide or 1 ,4-dioxane (6 L) at 5 - 50 °C. After the addition, the mixture was stirred at room temperature for 2 hours to complete the reaction. Water (7.5 L) was gradually added to the reaction mixture to precipitate the product. After the water addition, the mixture was stirred at room temperature for 1 hour. The solids were isolated by filtration and the wet cake was washed with water (3 X 1.5 L). The solids were dried under vacuum at about 50 °C overnight to give desired product (1530 g, 99% yield). LCMS calculated for CsHyBrFNCh: 246.96; Found: 248 (M + H+).1H NMR (400 MHz, DMSO-cfe) 6 7.49 (dd, J = 8.8, 1.7 Hz, 1 H), 6.87 - 6.77 (m, 3H), 3.82 (s, 3H).19F NMR (376 MHz, DMSO-cfe) 6 -127.24

[0396] Step 2. Methyl 3-amino-2,,3,-dichloro-2-fluoro-[1,1,-biphenyl]-4-carboxylate:

[0397] C O 2 M e QuNHzCl

[0398] Bis(di-tert-butyl(4-dimethylaminophenyl)phosphine)dichloropalladium(ll) (Pd-132) (8.12 g, 0.011 mole) was added to a mixture of methyl 2-amino-4-bromo-3-fluorobenzoate (1420 g, 5.72 mole), 2,3-dichlorophenylboronic acid (1226 g, 6.3 mole) and potassium fluoride (732 g, 12.6 mole) in acetonitrile (6 L) and water (1.5 L). The mixture was degassed and refilled with nitrogen and heated to 70 °C for 1 hour to complete the reaction. Water (6 L) was added to the reaction mixture at 50 °C. The mixture was cooled to room temperature and stirred for 1 hour. The solids were isolated by filtration and the wet cake was washed with 50% acetonitrile in water (2 X 2 L) and water (2 X 2L). The solids were dried under vacuum at about 50 °C overnight to give desired product (1700 g, 94% yield). LCMS calculated for C14H9 CI2FNO2: 313.01 ; Found: 314 (M + H+).1H NMR (400 MHz, DMSO-cfe) 6 7.74 (dd, J = 8.0, 1.6 Hz, 1 H), 7.64 (dd, J = 8.4, 1.4 Hz, 1 H), 7.48 (t, J = 7.9 Hz, 1 H), 7.40 (dd, J = 7.9, 1.6 Hz, 1 H), 6.70 (s(b), 2H), 6.51 (dd, J = 8.3, 6.6 Hz, 1 H), 3.86 (s, 3H).19F NMR (376 MHz, DMSO-cfe) 5 -134.70

[0399] Step 3. 3-Amino-6-bromo-2',3’-dichloro-2-fluoro-[1,1 '-biphenyl]-4-carboxylic acid: / V-Bromosuccinimide (684 g, 3.84 mole) was added to a solution of methyl 3-amino- 2',3'-dichloro-2-fluoro-[1 ,1'-biphenyl]-4-carboxylate (1150, 3.66 mole) in acetonitrile (5.75 L) at 50 - 66 °C. After the reaction completion, the acetonitrile (3 L) was removed by rotavapor. Water (5.75 L) was added to the concentrated mixture and stirred at room temperature for 2- 3 hours. The solids were isolated by filtration and the wet cake was washed with water to give methyl 3-amino-6-bromo-2',3'-dichloro-2-fluoro-[1 ,1'-biphenyl]-4-carboxylate. LCMS calculated for C^HgBrFCbNCh: 390.92; Found: 391 (M+H).1H NMR (400 MHz, DMSO-cfe) 6 7.86 (d, J = 1.7 Hz, 1 H), 7.79 (dd, J = 8.1 , 1.5 Hz, 1 H), 7.52 (t, J = 7.9 Hz, 1 H), 7.40 (dd, J = 7.7, 1.5 Hz, 1 H), 6.83 (s(b), 2H), 3.87 (s, 3H).19F NMR (376 MHz, DMSO-cfe) 6 -128.19.

[0400] Step 4. 3-Amino-6-bromo-2',3'-dichloro-2-fluoro-[1,1 '-biphenyl]-4-carboxylic acid:

[0401] The wet cake of 3-amino-6-bromo-2',3'-dichloro-2-fluoro-[1 ,1'-biphenyl]-4-carboxylic acid was dissolved in THF (3 L) and methanol (1.5 L). Sodium hydroxide (1.5 M) aqueous solution (5 L) was added to the solution and the mixture was stirred at about 50 °C for 2 hours to complete the saponification reaction. Hydrochloric acid (1.5 M) aqueous solution was gradually added to the mixture to adjust the pH to 3- 4 and stirred at room temperature for 1 hour. The solids were isolated by filtration and the wet cake was washed with water (3 X 1 .2 L). The solids were dried under vacuum at about 50 °C overnight to give desired product (1354 g, 97.5% yield over two steps). LCMS calculated for CiaHyBrCbFNO2: 376.90; Found: 378 (M + H+).1H NMR (400 MHz, DMSO-cfe) 5 7.85 (d, J = 1.7 Hz, 1 H), 7.78 (dd, J = 8.1 , 1.5 Hz, 1 H), 7.52 (t, J = 7.9 Hz, 1 H), 7.39 (dd, J = 7.9, 1.5 Hz, 1 H), 6.88.19F NMR (376 MHz, DMSO-cfe) 5 -128.95.

[0402] Step 5. 6-Bromo-7-(2,3-dichlorophenyl)-8-fluoro-2H-benzo[cf][1,3]oxazine-2,4(1H)- dione:

[0403] Triphosgene (500 g, 1.65 mole) in tetrahydrofuran (THF) (500 mL) was added to the solution of 3-amino-6-bromo-2',3'-dichloro-2-fluoro-[1 ,1'-biphenyl]-4-carboxylic acid (1254 g, 3.31 mole) in THF (4 L) at 60 °C and stirred for 1 hour to complete the reaction. The mixture was cooled to 35 °C and n-heptane (10 L) was slowly charged to precipitate the product. The mixture was cooled to room temperature and stirred for 1 hour. The solids were isolated by filtration and washed with n-heptane (2 X 1 L). The wet cake was dried under vacuum at about 50 °C overnight to give desired product (1385 g, quantitative yield). LCMS calculated for Ci4H5BrCI2FNO3: 402.88; Found: 404 (M + H+).1H NMR (400 MHz, DMSO-cfe) 6 12.24 (s, 1 H), 8.10 (d, J = 1.5 Hz, 1 H), 7.85 (dd, J = 8.1 , 1.5 Hz, 1 H), 7.58 (t, J = 7.9 Hz, 1 H), 7.43 (dd, J = 7.7, 1 .5 Hz, 1 H).19F NMR (376 MHz, DMSO-cfe) 6 -123.98.

[0404] Step 6. Ethyl 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2-methylquinoline-3- carboxylate:

[0405] A mixture of 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-2 / 7-benzo[c(][1 ,3]oxazine- 2,4(1 / - / )-dione (1078 g, 2.66 mole), ethyl acetoacetate (693 g, 5.32 mole), sodium acetate (393 g, 4.79 mole) and sodium chloride (933 g. 16 mole) in dimethyl sulfoxide (5 L) was heated to 50 - 60 °C for 5 hours. The temperature was raised to 100 °C and stirred for 1 hour to complete the reaction. The mixture was cooled to about 60 °C and water (10 L) was gradually added to precipitate the product. The mixture was cooled to room temperature and stirred for 1 hour. The solids were isolated by filtration and the wet cake was washed with water (2 X 2 L). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (1145 g, 91% yield). LCMS calculated for Ci9Hi3BrCbFNO2: 470.94; Found: 472 (M + H+).1H NMR (400 MHz, DMSO-cfe) 5 12.05 (s, 1 H), 8.18 (d, J = 1.5 Hz, 1 H), 7.84 (dd, J = 8.0, 1.6 Hz, 1 H), 7.58 (t, J = 7.9 Hz, 1 H), 7.50 (dd, J = 7.7, 1.6 Hz, 1 H), 4.28 (q, J = 7.1 Hz, 2H), 2.46 (s, 3H), 1.29 (t, J = 7.1 Hz, 3H).19F NMR (376 MHz, DMSO-cfe) 5 -124.80.

[0406] Step 6b. Ethyl 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2-methylquinoline-3- carboxylate:

[0407] The title compound can alternatively be prepared by the following process. A solution of methyl 3-amino-2',3'-dichloro-2-fluoro-[1 ,1'-biphenyl]-4-carboxylate (100 g, 0.254 mole), ethyl acetoacetate (33.1 g, 0.51 mole) and p-toluenesulfonic acid (2,2 g, 0.013 mole) in xylene (1 L) was refluxed for 5 hours to azeotropically remove water. Sodium ethoxide (26 g, 0.381 mole) was added to the mixture and the mixture was refluxed for another 5 hours. The mixture was cooled to room temperature and poured into dilute hydrochloric acid pH = 6-7. The organic phase was separated and the aqueous phase was extracted with ethyl acetate. The combined organic phases were concentrated and the product was purified over silica gel column and eluted with ethyl acetate and heptane (0 - 30%) to give desired product (65 g, 54%). LCMS calculated for Ci9Hi3BrCI2FNO3: 470.91 ; Found: 472 (M + H+).1H NMR (400 MHz, DMSO-cfe) 6 12.05 (s, 1 H), 8.18 (d, J = 1.5 Hz, 1 H), 7.84 (dd, J = 8.0, 1.6 Hz, 1 H), 7.58 (t, J = 7.9 Hz, 1 H), 7.50 (dd, J= 7.7, 1.6 Hz, 1 H), 4.28 (q, J = 7.1 Hz, 2H), 2.46 (s, 3H), 1.29 (t, J = 7.1 Hz, 3H).19F NMR (376 MHz, DMSO-cfe) 6 -124.80.

[0408] Step 7. Ethyl 6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate:

[0409] A mixture of ethyl 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate (246 g, 0.52 mole), acrylonitrile (69 g, 1.3 mole), trimethylamine (156 g, 1.56 mole) and bis(di-tert-butyl)-dimethylaminophenylphosphone dichloride palladium (II) (Pd-132) (14.7 g, 0.02 mole) in / V, / V-dimethylamide (1.5 L) was heated to 85 °C for about 5 hours to complete the reaction. The mixture was cooled to 50 °C and water (1 L) was gradually added. The mixture was cooled to room temperature and 1M hydrochloric acid aqueous solution was added to adjust the pH to pH 5 - 6. The solids were isolated by filtration and the wet cake was washed with water (2 X 500 mL). The wet solids were dissolved in methanol (1 L) and dichloromethane (9 L). To the solution was added sodium bisulfite (186g, 1.8 mole) and water (4 L). The mixture was stirred at room temperature for 1 hour and the aqueous phase was separated and discarded. The organic phase was washed with water (2 X 2L). Activated charcoal (150 g) was added to the organic solution and the mixture was stirred at room temperature for 1 hour. The mixture was filtered over a diatomaceous earth bed and the bed was rinsed with dichloromethane (2 L). The organic solution was concentrated to about 1 L and heptane (3.5 L) was gradually added to precipitate the product. The solids were isolated by filtration and washed with heptane (2 X 2 L). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (210 g, 90% yield). LCMS calculated for C22H15CI2FNO3: 444.04; Found: 445 (M + H+).1H- NMR (400 MHz, DMSO-cfe) (cis and trans mixture): 512.05 (s, 1 H), 8.64 (s, OH), 8.39 (s, 1 H), 7.86 (td, J = 7.7, 1 .5 Hz, 1 H), 7.63 - 7.53 (m, 1 H), 7.47 (td, J = 7.5, 1.6 Hz, 1 H), 7.04 (d, J = 16.5 Hz, 1 H), 6.88 (d, J = 11.9 Hz, OH), 6.55 (d, J = 16.6 Hz, 1 H), 5.91 (d, J = 12.0 Hz, OH), 4.29 (q, J = 7.1 Hz, 2H), 2.47 (d, J = 5.0 Hz, 4H), 1.30 (td, J = 7.1 , 3.2 Hz, 4H). Step 8. Ethyl 6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate:

[0410] A mixture of ethyl 6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxyl-2- methylquinoline-3-carboxylate (155 g, 348 mmol), pyridine (450 mL) and 1,4-dioxane (450 mL) was heated to 50 - 60 °C to give a homogenous solution. To the solution was added sodium borohydride (65.8 g, 1741 mmol) in portions at 50 - 60 °C. The resulting mixture was stirred for 22 hours at 50 - 60 °C to complete the reduction. After cooling to about 15 °C, ethyl acetate (950 mL) was added to the reaction mixture. Concentrated hydrochloric acid was gradually added to the mixture to adjust the aqueous phase pH to 1 - 2. The organic phase was separated and the aqueous phase was extracted with ethyl acetate (500 mL). The combined ethyl acetate phase was washed with 1N aqueous hydrochloric acid (500 mL), water (2 X 500 mL), 10% brine (300 mL) and dried over sodium sulfate (75 g). The solution was concentrated and the residue was purified by silica gel column (0 - 20% MeOH in DCM) to give desired product (117.8 g, 76%). LCMS calculated for C22H17CI2FN2O3: 446.06; Found: 447 (M + H+).1H NMR (400 MHz, DMSO-cfe) 5 11.87 (s, 1H), 8.00 (s, 1H), 7.84 (dd, J = 7.9, 1.7 Hz, 1H), 7.71 - 7.48 (m, 2H), 4.28 (q, J = 7.1 Hz, 2H), 2.79 (ddd, J = 11.7, 7.4, 3.7 Hz, 1 H), 2.73 - 2.59 (m, 3H), 2.46 (s, 3H), 1.30 (t, J = 7.1 Hz, 3H).

[0411] Step 9. Ethyl 4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate:

[0412] A mixture of ethyl 6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate (60 g, 134 mmol), benzyltriethylammonium chloride (31 g, 135 mmol), / V, / V-Dimethylaniline (49.1 g, 405 mmol) in acetonitrile (300 mL) was added Phosphorus oxychloride (62 g, 405 mmol) at below 20 °C. The mixture was heated to 60 °C for 1 hour to complete the reaction. The mixture was cooled to room temperature and pooled into ice-water (900 mL) at temperature below 20 °C. Product precipitated out during the aqueous quench. The mixture was stirred at room temperature for more than 5 hours. The solids were isolated by filtration and the wet cake was washed with 10% acetonitrile in water (2 X 150 mL). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (57 g, 90% yield). LCMS calculated for C22H16CI3FN2O2: 464.03; Found: 465 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 8.16 (s, 1 H), 7.86 (dd, J = 7.5, 2.1 Hz, 1 H), 7.64 - 7.53 (m, 2H), 4.52 (q, J = 7.1 Hz, 2H), 2.97 - 2.86 (m, 1 H), 2.85 - 2.72 (m, 3H), 2.69 (s, 3H), 1.40 (t, J = 7.1 Hz, 3H).

[0413] Step 10. Ethyl 4-chloro-6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate:

[0414] A mixture of ethyl 6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate (600 g, 1.35 mole), benzyltriethylammonium chloride (307 g,

[0415] I .35 mole), / V, / V-Diethylaniline (603 g, 4.04 mole) in acetonitrile (3 L) was added Phosphorus oxychloride (389.7 g, 4.04 mole) at below 20 °C. The mixture was heated to 60 °C for 1 hour to complete the reaction. The mixture was cooled to room temperature and pooled into icewater (9 L) at temperature below 20 °C. Product precipitated out during the aqueous quench. The mixture was stirred at room temperature for more than 5 hours. The solids were isolated by filtration and the wet cake was washed with 10% acetonitrile in water (2 X 1 .5 L). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (563 g, 90% yield). LCMS calculated for C22H14CI3FN2O2: 462.01 ; Found: 463 (M + H+).1H-NMR (400 MHz, DMSO-cfe) (mixture of cis and trans isomers) 5 8.72 (s, 0.3H), 8.51 (s, 1 H), 7.87 (ddd, J = 7.3, 5.6, 1.5 Hz, 1.3H), 7.64 - 7.46 (m, 3H), 7.21 (d, J = 16.5 Hz, 1 H), 7.05 (d, J =

[0416] I I .9 Hz, 0.3H), 6.73 (d, J = 16.5 Hz, 1 H), 6.08 (d, J = 11.9 Hz, 0.3H), 4.53 (qd, J = 7.1 , 2.0 Hz, 2H), 2.72 (d, J = 7.4 Hz, 4H), 1.41 (t, J = 7.1 Hz, 4H).

[0417] Step 11. Ethyl 4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate:

[0418] A mixture of ethyl 4-chloro-6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate (528 g, 1.14 mole) and PMHS (411g, 6.83 mole) in toluene (1 .8 L) were stirred at about 50 °C. In another 2-L flask, diacetoxycopper hydrate (4.1 g, 0.02 mole), (9,9-dimethyl-9H-xanthene-4,5-diyl)bis(diphenylphosphane) (13.58 g, 0.023 mol) in toluene (300 ml) and tert-butanol (483 g, 6.52 mole) were stirred for 1-2 hours to a solution. The copper acetate solution was slowly added to the solution of ethyl 4-chloro-6-(2- cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylate and PMHS in toluene at 50 - 60 °C to complete the reduction. The reaction mixture was concentrated under vacuum distillation to about 2 L. To the 2 L residue was added heptane (8 L) at about 50 °C for 1 hour. The mixture was cooled to room temperature and stirred overnight. The solids were isolated by filtration and the wet cake was washed with heptane (2 X 1 .2 L). The wet cake and silica gel (260 g) in dichloromethane (2.7 L) were stirred for 1 hour. The mixture was filtered over silica gel bed (260 g) and the silica gel bed was rinsed with DCM (4 L) until the eluent was almost colorless. The dichloromethane was removed.

[0419] Dichloromethane (140 mL) and methyl tert-butyl ether (260 mL) were added to the residue. The solids were isolated by filtration and the wet cake was washed with MTBE (2 X 1.2 L). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (476 g, 90% yield). LCMS calculated for C22H16CI3FN2O2: 464.03; Found: 465 (M + H+).1H- N MR (400 MHz, DMSO-cfe) 6 8.16 (s, 1 H), 7.86 (dd, J = 7.5, 2.1 Hz, 1 H), 7.64 - 7.53 (m, 2H), 4.52 (q, J = 7.1 Hz, 2H), 2.97 - 2.86 (m, 1 H), 2.85 - 2.72 (m, 3H), 2.69 (s, 3H), 1.40 (t, J = 7.1 Hz, 3H).

[0420] Step 12. Ethyl ( / ?a)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate:

[0421] The racemic ethyl 4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate was subject to chiral separation (Chiralpak IB N, MTBE as eluent) to give both ethyl (R)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate and ethyl (S)-4-chloro-6-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylate. LCMS calculated for C22H16CI3FN2O2: 464.03; Found: 465 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 8.16 (s, 1 H), 7.86 (dd, J = 7.5, 2.1 Hz, 1 H), 7.64 - 7.53 (m, 2H), 4.52 (q, J = 7.1 Hz, 2H), 2.97 - 2.86 (m, 1 H), 2.85 - 2.72 (m, 3H), 2.69 (s, 3H), 1.40 (t, J = 7.1 Hz, 3H) Step 13. Ethyl 4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate by racemization:

[0422] A mixture of ethyl (S)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate (100 g) in sulfolane (200 mL) was heated to 185 °C for 2 hours to give racemic ethyl 4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate. The mixture was cooled to 50 °C and acetonitrile (200 mL) was added. To the solution was added water (700 mL) at 50 °C. The mixture was cooled to room temperature and stirred for 4 hours. The solids were isolated by filtration and the wet cake was washed with water (2 X 200 mL). The wet solids were dried under vacuum at about 50 °C overnight to give desired product (97 g, 97% yield). LCMS calculated for C22H16CI3FN2O2: 464.03; Found: 465 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 8.16 (s, 1 H), 7.86 (dd, J = 7.5, 2.1 Hz, 1 H), 7.64 - 7.53 (m, 2H), 4.52 (q, J = 7.1 Hz, 2H), 2.97 - 2.86 (m, 1 H), 2.85 - 2.72 (m, 3H), 2.69 (s, 3H), 1.40 (t, J = 7.1 Hz, 3H)

[0423] Step 14. tert-Butyl (1 / ?,4 / ?,5S)-5-((( / ?a)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-3- (ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate:

[0424] A mixture of ethyl (F?a)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate (106.3 g, 228 mmol), tert-butyl (1R,4R,5S)-5-amino-2- azabicyclo[2.1.1]hexane-2-carboxylate (58.8g, 297 mmol), lithium chloride (19 g, 446 mmol), diisopropylethylamine (99.5 g, 670 mmol) in dimethylsulfoxide (400 mL) was heated to 80 °C overnight. The reaction mixture was cooled to room temperature and tert-butyl methyl ether (TBME) (1 L) and water (500 mL) were subsequently added. The organic phase was separated. The organic phase was washed with 0.1 N aqueous hydrochloric acid (500 mL), saturated sodium bicarbonate (500 mL) and water (500 mL). The solvent was removed under reduced pressure to give desired product that was used for next step without further purification. Analytical sample was purified by silica gel column (0 - 10% MeOH in DCM). LCMS calculated for C32H33CI2FN4O4: 626.19; Found: 627 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 8.09 (s, 1 H), 7.82 (dd, J = 8.1 , 1.5 Hz, 1 H), 7.56 (t, J = 7.8 Hz, 1 H), 7.38 (dd, J = 7.7, 1.5 Hz, 1 H), 7.14 (s, 1 H), 4.49 - 4.37 (m, 2H), 4.31 (s, 1 H), 3.71 (d, J = 4.1 Hz, 1 H), 3.65 - 3.43 (m, 1 H), 3.18 (d, J = 9.3 Hz, 1 H), 3.02 (s, 1 H), 2.91 - 2.74 (m, 2H), 2.70 (dd, J = 13.6, 5.9 Hz, 2H), 2.55 (s, 3H), 1.81 - 1.60 (m, 1 H), 1.38 (t, J = 7.1 Hz, 3H), 1.34 - 1.06 (m, 4H), 0.92 (s, 9H).

[0425] Step 14a. tert-Butyl (1 / ?,4 / ?,5S)-5-((( / ?a)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-3- (ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate:

[0426] The title compound can be alternatively prepared by the following method. A mixture of ethyl (R)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3- carboxylate (40 g, 85 mmol), lithium carbonate (19 g, 258 mmol), and tert-Butyl (1 R,4R,5S)- 5-amino-2-azabicyclo[2.1.1]hexane-2-carboxylate oxalate (29.4 g, 98 mmol) in DMSO (120 mL) was heated to 80 °C overnight. The reaction mixture was cooled to r.t. and MTBE (300 mL) and filtered. The solids were rinsed with MTBE (100 mL). The combined filtrate was washed with water (2x320 mL). The organic phase was separated. The solvent was removed under reduced pressure to give the product that was used for next step without further purification. An analytical sample was purified by silica gel column (0-10% MeOH in DCM). LCMS calc, for C32H33CI2FN4O4: 626.19; Found: 627 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 8.09 (s, 1 H), 7.82 (dd, J=8.1, 1.5 Hz, 1 H), 7.56 (t, J=7.8 Hz, 1 H), 7.38 (dd, J=7.7, 1.5 Hz, 1 H), 7.14 (s, 1 H), 4.49-4.37 (m, 2H), 4.31 (s, 1 H), 3.71 (d, J==4.1 Hz, 1 H), 3.65-3.43 (m, 1 H), 3.18 (d, J==9.3 Hz, 1 H), 3.02 (s, 1 H), 2.91-2.74 (m, 2H), 2.70 (dd, J==13.6, 5.9 Hz, 2H), 2.55 (s, 3H), 1.81-1.60 (m, 1 H), 1.38 (t, J=7.1 Hz, 3H), 1.34-1.06 (m, 4H), 0.92 (s, 6H).

[0427] The alternative atropisomer tert-butyl (1R,4R,5S)-5-(((Ra)-6-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-3-(ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2- azabicyclo[2.1.1]hexane-2-carboxylate is prepared by an analogous route by performing an analogous process starting from ethyl (Sa)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 8-fluoro-2-methylquinoline-3-carboxylate instead of ethyl (Ra)-4-chloro-6-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylate. Step 15. ( / ?a)-4-(((1 / ?,4 / ?,5S)-2-(tert-butoxycarbonyl)-2-azabicyclo[2.1.1]hexan-5- yl)amino)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3- carboxylic acid:

[0428] Sodium hydroxide aqueous solution (2 M) (134 mL, 268 mmol) was added to a solution of tert-butyl (1 R,4R,5S)-5-((6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-3- (ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate (140.0 g, 223 mmol) in acetonitrile (560 ml) and methanol (210 ml) at room temperature. The mixture was heated to 50 °C for 1 - 1.5 hours. The mixture was cooled to room temperature and acidified with 1M hydrochloric acid aqueous solution to about pH 5. The acetonitrile and methanol were removed under vacuum. The product was extracted by ethyl acetate (1.7 L). The aqueous phase was separated and extracted with ethyl acetate (420 mL). The combined ethyl acetate phases were concentrated under vacuum to give a residue. Tert-Butyl methyl ether (300 mL) was added to the residue and the mixture slurry was agitated at room temperature for 2 hours. The solids were isolated by filtration and the wet cake was washed with TBME (2 X 100 mL). The solids were dried under vacuum at about 50 °C to give desired product (135 g, quantitative) that was used for next step without further purification.

[0429] Step 15b. ( / ?a)-4-(((1 / ?,4 / ?,5S)-2-(tert-butoxycarbonyl)-2-azabicyclo[2.1.1]hexan-5- yl)amino)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3- carboxylic acid:

[0430] The tile compound can be alternatively prepared by the following process. Sodium trimethylsinolate (338 g, 95%) was added to a solution of tert-butyl (1 R,4R,5S)-5-((6-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-3-(ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)- 2-azabicyclo[2.1.1]hexane-2-carboxylate (1400 g, 2.231 mol) in tetrahydrofuran (14 L) and water (80 mL) at room temperature. The mixture was heated to 50 °C for 1 - 3 hours to complete the reaction. The mixture was cooled to room temperature and acidified with 1M hydrochloric acid aqueous solution to about pH 5. The tetrahydrofuran was removed under vacuum. The product was extracted by dichloromethane (6 L). The aqueous phase was separated and extracted with dichloromethane (6 L). The combined organic phases were concentrated under vacuum to give the product in DCM solution (6 L). The concentrated dichloromethane solution was added to tert-butyl methyl ether (7 L) was added to the residue and the mixture slurry was agitated at room temperature for 2 hours. N-Heptane (7 L) was added to the mixture. The dichloromethane was removed under vacuum. The solids were isolated by filtration and the wet cake was washed with n-heptane (2 X 3 L). The solids were dried under vacuum at about 50 °C to give desired product that was used for next step without further purification.

[0431] Step 16. tert-butyl (1 / ?,4 / ?,5S)-5-((( / ?a)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro- 3-iodo-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate:

[0432] To a mixture of 4-(((1 R,4R,5S)-2-(tert-butoxycarbonyl)-2-azabicyclo[2.1.1]hexan-5- yl)amino)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylic acid (132 g, 220 mmol), and sodium phosphate (74.4 g, 440 mmol) in anhydrous acetonitrile (1614 ml) was added N-iodosuccinimide (94 g, 396 mmol) and the mixture was stirred for 1 hour. Water (1.6 L) was added to the mixture and resulting slurry was stirred for 5 hours at room temperature. The solids were isolated by filtration and the wet cake was reslurried in water (2.6 L) at room temperature for 5 hours. The solids were isolated by filtration and the wet cake was washed with water (2 X 250 mL). The solids were dried under vacuum at about 50 °C to give desired product (120 g, 80% yield). LCMS calculated for C39H28CI2FIN4O2: 680.06; Found: 681 (M + H+).1H-NMR (400 MHz, DMSO-cfe) 6 7.94 (s, 1 H), 7.82 (dd, J = 8.0, 1.6 Hz, 1 H), 7.56 (t, J = 7.8 Hz, 1 H), 7.50 (dd, J = 7.7, 1.6 Hz, 1 H), 5.49 (s, 1 H), 4.28 (s, 2H), 3.09 (s, 1 H), 2.96 - 2.58 (m, 8H), 1.71 (s, 1 H), 1.59 - 0.96 (m, 11 H).

[0433] Step 17. tert-Butyl (1R,4R,5S)-5-(((Ra)-6-(2-cyanoethyl)-3-(((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)ethynyl)-7-(2,3-dichlorophenyl)- 8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate:

[0434] A mixture of cyclopropyl((1R,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexan-2- yl)methanone (47.5 g, 260 mmol), tert-butyl (1R,4R,5S)-5-((6-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-8-fluoro-3-iodo-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate (136.5 g, 200 mmol), and tetrabutylammonium acetate (242 g, 801 mmol) in DMF (1100 ml) was subsurface purged with nitrogen gas for 10 minutes.

[0435] Tris(dibenzylideneacetone)dipalladium(0) (2.75 g, 3 mmol) was added to the mixture. The mixture was subsurface purged with nitrogen gas for another 15 minutes before heating to 70 °C for 1 hour. The reaction mixture was cooled to room temperature and added to half saturated sodium bicarbonate aqueous solution (2200 mL). The solids were isolated by filtration and the wet cake was washed with water (600 mL). The solids were dried under vacuum at about 50 °C and purified by silica gel column eluted with 0 - 2% methanol in ethyl acetate to give desired product (142 g, 96% yield).1H NMR (400 MHz, DMSO-d6) 5 8.03 (d, J = 12.4 Hz, 1 H), 7.81 (dd, J = 8.1, 1.6 Hz, 1H), 7.55 (t, J = 7.9 Hz, 1 H), 7.36 (d, J = 7.3 Hz, 1 H), 6.70 - 6.44 (m, 1H), 5.68 - 5.13 (m, 1 H), 4.54 - 4.18 (m, 2H), 4.00 - 3.80 (m, 1 H), 3.51 (s, 1 H), 3.19 (t, J = 9.0 Hz, 1H), 3.07 - 2.91 (m, 1H), 2.78 (d, J = 10.7 Hz, 3H), 2.66 (d, J = 9.0 Hz, 3H), 2.57 (d, J = 11.7 Hz, 4H), 2.36 - 2.08 (m, 2H), 1.88 (dd, J = 17.9, 10.5 Hz, 2H), 1.35 (d, J = 9.7 Hz, 2H), 1.15 - 0.59 (m, 16H).

[0436] Step 17a. tert-Butyl (1 / ?,4 / ?,5S)-5-((( / ?a)-6-(2-cyanoethyl)-3-(((1 / ?,3 / ?,5 / ?)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)ethynyl)-7-(2,3-dichlorophenyl)- 8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate:

[0437] The title compound can alternatively be prepared by the following method. A mixture of cyclopropyl((1R,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexan-2-yl)methanone (17.7 kg, 101 mol), tert-butyl (1R,4R,5S)-5-((6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-3-iodo-2- methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate (64.7 kg, 95 mol), copper (I) iodide (0.42 kg 2 mol), tris (4-fluorophenyl)phosphine (0.39 kg, 1 mol) and K2CO3 (36.4 kg, 191 mol) in DMSO (488.4 L) was subsurface purged with nitrogen gas for 30 min. Palladium (II) acetate (60 g, 30 mmol) was added to the mixture. The mixture was subsurface purged with nitrogen gas for another 30 min. before heating to 50 °C for more than 10 h. The reaction mixture was cooled to r.t. and EtOAc (906 L) was added, followed by slow addition of water (1267 L) was added. The mixture was stirred at r.t. for 30 min. and filtered over a diatomaceous earth bed. The diatomaceous earth bed was rinsed with EtOAc (33 L). The organic phase was separated from the aqueous phase and the aqueous phase was back extracted with EtOAc (195 L). The combined organic phase was washed with water (195 L). To the EtOAc phase was added water (130 L) and ammonium pyrrolidinedithiocarbamate (3.1 kg, 19 mol). The mixture was agitated at 50 °C for no less than 4 h. The mixture was cooled to r.t. and polish filtered. The aqueous phase was separated and discarded. The organic phase was washed with water (325 L). The organic phase was heated to 50 °C and passed through activated carbon cartridge. The solution is concentrated under vacuum and solvent swapped into toluene to remove residual water to give desired product in 98% solution yield. The toluene solution was solvent swap into NMP for next step indole-cyclization without further purification.1H NMR (400 MHz, DMSO-cfe) 5 8.03 (d, J=12.4 Hz, 1 H), 7.81 (dd, J=8.1 , 1.6 Hz, 1 H), 7.55 (t, J=7.9 Hz, 1 H), 7.36 (d,

[0438] J=7.3 Hz, 1 H), 6.70-6.44 (m, 1 H), 5.68-5.13 (m, 1 H), 4.54-4.18 (m, 2H), 4.00-3.80 (m, 1 H), 3.51 (s, 1 H), 3.19 (t, J=9.0 Hz, 1 H), 3.07-2.91 (m, 1 H), 2.78 (d, J=10.7 Hz, 3H), 2.66 (d, J=9.0 Hz, 3H), 2.57 (d, J=11.7 Hz, 4H), 2.36-2.08 (m, 2H), 1.88 (dd, J=17.9, 10.5 Hz, 2H), 1.35 (d, J=9.7 Hz, 2H), 1.15-0.59 (m, 16H).

[0439] The alternative atropisomer tert-butyl (1R,4R,5S)-5-(((Sa)-6-(2-cyanoethyl)-3- (((1 R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1 ,0]hexan-3-yl)ethynyl)-7-(2,3- dichlorophenyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate is prepared by an analogous route by performing processes analogous to Steps 14-17 starting from ethyl (Sa)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate instead of ethyl (Ra)-4-chloro-6-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylate.

[0440] Step 18. tert-Butyl (1 / ?,4 / ?,5S)-5-(( / ?a)-8-(2-cyanoethyl)-2-((1 / ?,3 / ?,5 / ?)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro- 4-methyl-1H-pyrrolo[3,2-c]quinolin-1-yl)-2-azabicyclo[2.1.1]hexane-2-carboxylate:

[0441] To a mixture of tert-butyl (1 R,4R,5S)-5-((6-(2-cyanoethyl)-3-(((1 R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)ethynyl)-7-(2,3-dichlorophenyl)-8- fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate (141.0 g, 159 mmol) and cesium carbonate (78 g, 238 mmol) in dimethyl sulfoxide (1 L) or / V-methy-2- pyrrolidone was heated to 80 - 85 °C for 1 hour and half. The reaction was cooled to room temperature and water (2 L) was gradually added. The product was gradually precipitated out of the solution. The resulting slurry was stirred at room temperature for 1 h. The solids were isolated by filtration and the wet cake was washed with water (2 X 300 mL). The wet solids were dried under vacuum. The solids were purified by flash chromatography with 60 - 100% ethyl acetate in dichloromethane. The solvents were removed and the solids in heptane (840 mL) were crystallized from ethyl acetate (420 mL) and tert-butyl methyl ether (420 mL) and heptane 9840 mL) to give desired product (122 g, 87% yield). LCMS calculated for C40H40CI2FN5O3: 727.25; Found: 728 (M + H+).1H NMR (500 MHz, DMSO-d6) 68.12 (s, 1H), 7.81 (dt, = 8.0, 2.1 Hz, 1H), 7.55 (td, J = 7.8, 5.0 Hz, 1H), 7.45 - 7.29 (m, 1H), 6.26 (s, 1H), 5.81 -5.49 (m, 1H), 5.34-5.13 (m, 1H), 5.00 (dd, J= 14.3, 6.8 Hz, 1H), 4.19-3.97 (m, 1H), 3.63 (dt, J= 6.8, 3.1 Hz, 1H), 3.40 (d, J= 9.4 Hz, 1H), 3.27-3.09 (m, 1 H), 2.95 (dt, J = 14.2, 7.6 Hz, 1 H), 2.89 - 2.73 (m, 3H), 2.70 (d, J = 2.7 Hz, 4H), 2.34 - 2.20 (m, 1H), 2.21 - 1.97 (m, 2H), 1.73 (dp, J= 15.0, 4.8 Hz, 1H), 1.66-1.34 (m, 2H), 1.21 - 1.03 (m, 1 H), 1.02 - 0.79 (m, 4H), 0.78 - 0.22 (m, 11 H).

[0442] Step 19.3-(( / ?a)-1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro- 4-methyl-1H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile:

[0443] To a solution of te / Y-Butyl (1 R,4R,5S)-5-((Ra)-8-(2-cyanoethyl)-2-((1 R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-1-yl)-2-azabicyclo[2.1.1]hexane-2-carboxylate (167.7 g, 230.1 mmol) in dichloromethane (1.35 L) was added trimethylsilyl iodide (69 g, 345 mmol) at room temperature and stirred for 1 hour. Sodium bicarbonate aqueous solution (500 mL) was added to quench the reaction. The organic phase was isolated and washed with water. The solvent was evaporated by rotavapor and the residue was passed over silica gel bed (1- 20% methanol in dichloromethane). The solvent was swapped into ethyl acetate and tert- butyl methyl ether to give crystalline product (136 g, 94% yield). LCMS calculated for C35H32CI2FN5O: 627.20; Found: 628 (M + H+).1H-NMR (400 MHz, DMSO-cfe)51H NMR (500 MHz, DMSO-d6) 58.15 (d, J= 13.6 Hz, 1H), 7.89-7.73 (m, 1H), 7.64-7.33 (m, 2H), 6.69 -6.14 (m, 1H), 5.76-5.43 (m, 1H), 4.97 (d, J= 4.9 Hz, 1H), 4.31 (dd, J= 17.0, 6.0 Hz, 1H), 4.18-3.94 (m, 1H), 3.58-3.45 (m, 1H), 2.94 (dt, 2H, J= 12.4, 6.1 Hz), 2.89-2.56 (m, 8H), 2.44-2.19 (m, 2H), 2.07 (d, J= 12.9 Hz, 1H), 1.96-1.54 (m, 3H), 1.30-1.13 (m, 1H), 1.06 -0.20 (m, 6H).

[0444] The alternative atropisomer 3-((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2- ((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile is prepared by an analogous route by performing processes analogous to Steps 14-19 starting from ethyl (Sa)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3- carboxylate instead of ethyl (Ra)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate.

[0445] Step 20: 3-((Ra)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro- 4-methyl-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile monohydrochloride dihydrate (Compound 1):

[0446] To a solution of dissolved 3-((Ra)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]-hexan-5-yl)-2- ((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile free base (53.8 g, 85 mmol) in methanol (110 mL), ethyl acetate (50 mL), water (11 mL) and tert-butyl methyl ether (TBME) (110 mL) was added 6N aqueous hydrochloric acid (14.5 mL) at 30 - 50 °C. The mixture was seeded and the solution gradually turned cloudy. TBME (440 mL) was slowly added to the mixture at about 40 °C over 1 hour. The mixture was cooled to about 15 °C and agitated for 2 hours. The solids were isolated by filtration and the wet cake was washed with 5% methanol and 20% ethyl acetate in TBME (2 X 110 mL). The wet solids were slurried in ethyl acetate (270 mL) and dried under vacuum at about 50 °C to give desired product (53.7g, 90% yield). LCMS calculated for C35H32CI2FN5O: 627.20; Found: 628 (M + H+).1H NMR (500 MHz, DMSO-cfe) 6 8.15 (s, 1 H), 7.83 (dd, J = 8.1 , 1.6 Hz, 1 H); 7.57 (dd, J = 7.9, 7.9, 1 H); 7.45 (dd, J= 7.7, 1.6 Hz, 1 H); 6.44 (s, 1 H); 5.65 (s, 1 H); 5.51 (d, J = 10.6Hz, 1 H); 4.14 (td, J = 6.4, 2.6 Hz, 1 H); 3.84-3.90 (m, 1 H); 3.30-3.37 (m, 1 H); 3.43-3.50 (m, 1 H); 2.86-2.95 (m, 1 H); 2.83-2.92 (m.1 H); 2.79 (s, 3H); 2.70-2.79 (m, 1 H); 2.29-2.35 (m, 1 H); 2.25-2.32 (m, 1 H); 1.97 (dd, J = 13.0, 2.6 Hz, 1 H); 1.69 -1.83 (m, 1 H); 1.65 (d, J = 9.1 Hz, 1 H); 0.91-1.00 (m, 2H); 0.82-0.88 (m, 2H); 0.72-0.80 (m, 1 H); 0.63-0.69 (m, 1 H). 13C NMR (125 MHz, DMSO-cfe) 6 171.6; 145.8; 132.8; 135.1 ; 132.8; 131.9; 131.5; 131.4; 129.2; 101.6; 120.7; 57.9; 56.5; 44.5; 42.5; 30.5; 38.3; 32.8; 22.1 ; 17.5; 17.1 ; 13.2; 13.0; 7.70; 7.80. 19F NMR (376 MHz, DMSO-cfe) 5 -122.1 (s).

[0447] The alternative atropisomer 3-((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2- ((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile monohydrochloride dihydrate is prepared by an analogous route by performing processes analogous to Steps 15-21 starting from 3-((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)- 2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile instead of 3- (( / ?a)-1-((1 / ?,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3 / ?,5 / ?)-2-(cyclopropanecarbonyl)-

[0448] 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile.

[0449] Example 1A: Synthesis procedure for Methyl (1 / ?,3 / ?,4 / ?,5S)-3-(( / ?a)-1-((1 / ?,4 / ?,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl- 1H-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2- carboxylate (Compound 2)

[0450] Step 1. Methyl (1R,3R,4R,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-ethynyl-2- azabicyclo[2.2. 1 ]heptane-2-carboxylate

[0451] To a solution of Intermediate 5 (1.85 g, 3.89 mmol) in dioxane (10 mL) was added HCI (4 N in dioxane, 10 mL). The reaction was stirred at room temperature for 0.5 h. Upon completion, the volatiles were removed under reduced pressure. The residue was dissolved in DCM (20 mL). Upon stirring, / V, / V-diisopropylethylamine (2.0 mL, 11.7 mmol) was added followed by methyl chloroformate (0.6 mL, 7.78 mmol). The mixture was stirred for 0.5 h. Once completed, the reaction mixture was diluted with DCM, washed with water, dried over Na2SO4, filtered and concentrated. The crude product was purified by flash chromatography (0-50% ethyl acetate / hexanes) to afford the title compound. LC-MS calc, for C2eH32NO3Si (M+H)+: m / z=434.2; found 434.2.

[0452] Step 2. Methyl (1R,3R,4R,5S)-3-ethynyl-5-hydroxy-2-azabicyclo[2.2.1]heptane-2-carboxylate

[0453] To a solution of methyl (1 ?,3 ?,4 ?,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-ethynyl-2- azabicyclo[2.2.1]heptane-2-carboxylate (1.43 g, 3.30 mmol) in THF (11 mL) was added TBAF (1 N in THF, 4.0 mL, 3.96 mmol). The reaction was stirred at room temperature for 16 h. Upon completion, the volatiles were removed. The crude was purified by flash chromatography (0-10% methanol / DCM) to afford the title compound. LC-MS calc, for C10H14NO3 (M+H)+: m / z=196.1; found 196.1.

[0454] Step 3. Methyl (1R,3R,4R,5S)-5-(difluoromethoxy)-3-ethynyl-2-azabicyclo[2.2.1]heptane-2- carboxylate

[0455] To a flask containing methyl (1F?,3F?,4F?,5S)-3-ethynyl-5-hydroxy-2- azabicyclo[2.2.1]heptane-2-carboxylate (0.514 g, 2.63 mmol) and copper(l) iodide (0.100 g, 0.527 mmol) was charged acetonitrile (13 mL). The mixture was stirred at 50 °C before an acetonitrile solution (2 mL) containing 2-(fluorosulfonyl)difluoroacetic acid (0.703 g, 3.95 mmol) was added slowly. The reaction mixture was stirred at 50 °C for 1 h. Upon completion, the mixture was concentrated under reduced pressure. The residue was dissolved in DCM, washed with saturated NaHCOs solution and water. The organic layer was dried over Na2SO4, filtered and concentrated. The crude product was purified by silica chromatography (0-50% ethyl acetate / hexanes) to afford title compound (0.467 g, 72% yield). LC-MS calc, for C11H14F2NO3 (M+H)+: m / z=246.1 ; found 246.1.

[0456] Step 4. tert-Butyl (1R,4R,5S)-5-((Ra)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-2- ((1R, 3R, 4R, 5S)-5-(difluoromethoxy)-2-(methoxycarbonyl) -2-azabicyclo[2.2. 1 ]heptan-3-yl)-6- fluoro-4-methyl- 1 H-pyrrolo[3, 2-c]quinolin- 1-yl)-2-azabicyclo[2. 1. 1 ]hexane-2-carboxylate

[0457]

[0458] A mixture of Intermediate 2 (0.500 g, 0.734 mmol), methyl (1R,3R,4R,5S)-5- (difluoromethoxy)-3-ethynyl-2-azabicyclo[2.2.1]heptane-2-carboxylate (0.270 g, 1.10 mmol), copper(l) iodide (0.056 g, 0.294 mmol), tetrakis(triphenylphosphine)palladium(0) (0.170 g, 0.147 mmol) and / V, / V-diisopropylethylamine (1.3 mL, 7.34 mmol) in DMF (4.6 mL) was sparged with N2 and heated at 70 °C for 1 h. Then, cesium carbonate (0.717 g, 2.20 mmol) was added to the reaction mixture. The resulting slurry was stirred at 90 °C for another 18 h. Upon completion, the mixture was cooled down to room temperature and poured into water. The solution was extracted with ethyl acetate twice. Then the combined organic layers were washed with brine five times, dried over Na2SO4, filtered and concentrated. The crude product was purified by flash chromatography (0-100% EtOAc / hexanes) to afford the title compound. LC-MS calc, for C40H41CI2F3N5O5 (M+H)+: m / z=798.2; found 798.3. Step 4. Methyl (1R,3R,4R,5S)-3-((Ra)-1-((1R,4R,5S)-2-azabicyclo[2. 1. 1]hexan-5-yl)-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-2-yl)-5- (difluoromethoxy)-2-azabicyclo[2.2. 1]heptane-2-carboxylate

[0459] To a solution of terf-butyl (1R,4R,5S)-5-((Ra)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 2-((1R,3R,4R,5S)-5-(difluoromethoxy)-2-(methoxycarbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)- 6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-1-yl)-2-azabicyclo[2.1.1]hexane-2-carboxylate (0.350 g, 0.439 mmol) in DCM (7 mL), was added acetonitrile (0.7 mL) and TFA (7 mL). The reaction was stirred at room temperature for 0.5 h. Upon completion, volatiles were removed under reduced pressure and the residue was dissolved in acetonitrile (4 mL) and water (1 mL) and purified by preparative LC-MS (XBridge® C18 column, eluting with a gradient of acetonitrile / water containing 0.1 % TFA, at flow rate of 60 mL / min) to afford the title compound. LC-MS calc, for C35H33CI2F3N5O3 (M+H)+: m / z=698.2; found 698.2.1H NMR was collected on the TFA salt.1H NMR (500 MHz, DMSO-d6) 5 9.53 (s, 1 H), 8.24 (s, 1 H), 8.19 (s, 1 H), 7.86 (dd, J=8.1 , 1.5 Hz, 1 H), 7.59 (t, J=7.9 Hz, 1 H), 7.47 (td, J=7.8, 1.6 Hz, 1 H), 6.97 (s, 1 H), 6.83 (t, J=75 Hz, 1 H), 5.73 (s, 1 H), 4.96 (m, 1 H), 4.88 (m, 1 H), 4.59 (s, 1 H), 4.32 (s, 1 H), 3.92 (m, 1 H), 3.74 (s, 3H), 3.53 (m, 1 H), 3.44 (m, 1 H), 3.12-2.99 (m, 1 H), 2.97-2.78 (m, 5H), 2.76-2.62 (m, 2H), 2.39-2.32 (m, 1 H), 2.32-2.19 (m, 1 H), 1.76-1.59 (m, 3H), 1.57- 1.47 (m, 1 H). The alternative atropisomer methyl (1R,3R,4 / ?,5S)-3-((Sa)-1-((1 / ?,4 / ?,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7- pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate can be prepared by an analogous route by performing processes analogous to the steps above starting from tert-butyl (1R,4R,5S)-5-((Sa)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-2- ((1R,3R,4R,5S)-5-(difluoromethoxy)-2-(methoxycarbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6- fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-1-yl)-2-azabicyclo[2.1.1]hexane-2-carboxylate instead of tert-butyl (1R,4R,5S)-5-((Ra)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-2- ((1R,3R,4R,5S)-5-(difluoromethoxy)-2-(methoxycarbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6- fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-1-yl)-2-azabicyclo[2.1.1]hexane-2-carboxylate.

[0460] Intermediate 1. Ethyl ( / ?)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate

[0461] A mixture of 2-amino-4-bromo-3-fluorobenzoic acid (28.0 g, 120 mmol), (2,3- dichlorophenyl)boronic acid (25.1 g, 132 mmol), bis(di-tert-butyl(4- dimethylaminophenyl)phosphine)dichloropalladium(ll) (2.12 g, 3.00 mmol) and potassium phosphate (50.8 g, 239 mmol) in 1,4-dioxane (170 mL) and water (30 mL) was sparged with N2 and heated at 70 °C for 1 h. Once completed, the reaction mixture was cooled down to r.t. and poured into 1 N HCI (200 mL). The mixture was stirred for another 10 min., resulting in precipitation. The solids were collected on a fritted filter, washed with water followed by hexanes and dried under reduced pressure to afford the sub-title compound in near quantitative yield. The crude product was used in next step without further purification. LC- MS calc, for C13H9CI2FNO2 (M+H)+: m / z=300.0; found 300.0.

[0462] To a solution of 3-amino-2',3'-dichloro-2-fluoro-[1,1'-biphenyl]-4-carboxylic acid (35.8 g, 119 mmol) in DMSO (100 mL) was added / V-bromosuccinimide (22.3 g, 125 mmol). The resulting mixture was heated at 50 °C for 1 h. Once completed, the reaction mixture was cooled down to r.t. and poured into ice water (400 mL). To the suspension, was added 20 mL saturated Na2S20s solution. After stirring for 15 min., the solids were collected on a fritted filter, washed with water followed by hexanes and dried under reduced pressure to afford the sub-title compound (43.0 g, 95% yield). The crude product was used in next step without further purification. LC-MS calc, for CiaHsBrChFNCh (M+H)+: m / z=377.9, 379.9; found 378.0, 380.0.

[0463] To a solution of 3-amino-6-bromo-2',3'-dichloro-2-fluoro-[1,T-biphenyl]-4-carboxylic acid (38.6 g, 102 mmol) in THF (300 mL) was added triphosgene (10.6 g, 35.6 mmol) portionwise. After addition, the mixture was heated at 60 °C for 0.5 h. Once completed, the reaction mixture was cooled down to r.t. and poured into heptane (1000 mL). After stirring for 1 h, the solids were collected on a fritted filter, washed with hexanes and dried under reduced pressure to afford the sub-title compound in near quantitative yield. The crude product was used in next step without further purification.

[0464] Step 4. Ethyl 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2-methylquinoline-3- carboxylate

[0465] To a solution of 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-2 / 7-benzo[c(][1 ,3]oxazine- 2,4(1 / - / )-dione (41.5 g, 102 mmol) in DMSO (200 mL), was added (1 -ethoxy- 1,3-dioxobutan- 2-yl)sodium (18.7 g, 123 mmol) portionwise. After addition, the mixture was heated at 80 °C for 1 h. Once completed, the reaction mixture was cooled down to r.t. and poured into 1 N HCI (400 mL). After stirring for 1 h, the solids were collected on a fritted filter, washed with water followed by hexanes and dried under reduced pressure to afford the sub-title compound (40.0 g, 83% yield). The crude product was used in next step without further purification. LC-MS calc, for CigH BrChFNOa (M+H)+: m / z=471.9, 473.9; found 471.9, 474.0.

[0466] Step 5. Ethyl (E)-6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate

[0467] To a solution of ethyl 6-bromo-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate (35.0 g, 74.0 mmol), bis(di-ferf-butyl(4- dimethylaminophenyl)phosphine)dichloropalladium(ll) (2.62 g, 3.70 mmol) in DMF (100 mL), acrylonitrile (12.3 mL, 185 mmol) and NEta (30.9 mL, 222 mmol) were added. The mixture was sparged with N2 and heated at 85 °C for 1 h. Once completed, the reaction mixture was cooled down to r.t. and poured into 1 N HCI (500 mL). After stirring for 1 h, the solids were collected on a fritted filter, washed with water followed by hexanes and dried under reduced pressure to afford the sub-title compound (19.2 g, 58% yield). The crude product was used in next step without further purification. LC-MS calc, for C22H16CI2FN2O3 (M+H)+: m / z=445.0; found 445.0.

[0468] Step 6. Ethyl (E)-4-chloro-6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline- 3-carboxylate

[0469] To a slurry of ethyl (E)-6-(2-cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-4-hydroxy-2- methylquinoline-3-carboxylate (30.0 g, 67.4 mmol) and benzyltriethylammonium chloride (15.4 g, 67.4 mmol) in MeCN (150 mL) at 0 °C, was added DIPEA (23.5 mL, 135 mmol). Upon stirring at 0 °C, phosphoryl chloride (12.6 mL, 135 mmol) was added dropwise into the mixture. Then the mixture was heated at 60 °C for 1 h. Upon completion, the reaction mixture was cooled to r.t. and slowly poured into ice water (1000 mL). The mixture was extracted with DCM three times, dried over Na2SO4, filtered and concentrated. The crude product was further purified by FCC (0-50% EtOAc / hexanes) to afford the sub-title compound (4.5 g, 14% yield). LC-MS calc, for C22H15CI3FN2O2 (M+H)+: m / z=463.0; found 463.0.

[0470] Step 7. Ethyl (R)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate

[0471] A mixture of copper(ll) acetate monohydrate (0.19 g, 0.97 mmol) and Xantphos (0.56 g, 0.97 mmol) was stirred in toluene (1 mL) and tert-butanol (9 mL) at 60 °C for 0.5 h to afford a homogeneous solution. In a separate vial, to a mixture of ethyl (E)-4-chloro-6-(2- cyanovinyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylate (4.5 g, 9.70 mmol) and polymethylhydrosiloxane (3.5 g, 58.2 mmol) in toluene (12 mL) at 60 °C, was added the previous copper-containing solution. The mixture was stirred at 60 °C for 0.5 h. Upon completion, the reaction mixture was filtered through diatomaceous earth and concentrated. The crude product was purified using FCC (0-40% EtOAc / DCM) to afford a mixture of two atropisomers (2.0 g, 44% yield). The title compound was separated from its atropisomer using chiral supercritical fluid chromatography (ChiralPak IJ column, eluting with 40% MeOH in CO2 at a flow rate of 70 mL / min; the title compound eluted after its atropisomer). LC-MS calc, for C22H17CI3FN2O2 (M+H)+: m / z=465.0; found 465.0.

[0472] Intermediate 2. tert-Butyl (1 / ?,4 / ?,5S)-5-((( / ?)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8- fluoro-3-iodo-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2-carboxylate

[0473] Step 1. tert-Butyl (1R,4R,5S)-5-(((R)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-3- (ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2. 1. 1]hexane-2- carboxylate To a solution of ethyl (R)-4-chloro-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2- methylquinoline-3-carboxylate (intermediate 1 , 7.2 g, 15.5 mmol) in / V-methyl-2-pyrrolidone (21 mL), was added tert-butyl (1R,4R,5S)-5-amino-2-azabicyclo[2.1.1]hexane-2-carboxylate (5.52 g, 27.8 mmol) and DIPEA (8.1 mL, 46.4 mmol). The resulting mixture was heated at 80 °C for 18 h. Once completed, the reaction mixture was cooled down to r.t. and poured into 1 N HCI (300 mL) and ice mixture. After stirring for 0.5 h, the solids were collected on a fritted filter, washed with water followed by hexanes and dried under reduced pressure to afford white solids (8.2 g, 85% yield). The crude product was used in next step without further purification. LC-MS calc, for C32H34CI2FN4O4 (M+H)+: m / z=627.2; found 627.1.

[0474] Step 2. (R)-4-(((1R,4R,5S)-2-(tert-Butoxycarbonyl)-2-azabicyclo[2. 1. 1]hexan-5-yl)amino)-6-

[0475] To a solution of tert-butyl (1R,4R,5S)-5-(((R)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 3-(ethoxycarbonyl)-8-fluoro-2-methylquinolin-4-yl)amino)-2-azabicyclo[2.1.1]hexane-2- carboxylate (4.0 g, 6.37 mmol) in MeCN (13 mL), was added 1 N NaOH (16 mL, 15.94 mmol). The mixture was heated at 50 °C for 2 h. Once completed, the reaction mixture was cooled down to r.t. and acidified to pH 5 using 1 N HCI. The organic volatiles were removed under reduced pressure. The residue aqueous phase was extracted with EtOAc three times. The combined organic layers were dried over Na2SO4, filtered and concentrated under reduced pressure to give a yellow solid (3.70 g, 97% yield). The crude material was used in the next step without further purification. LC-MS calc, for C30H30CI2FN4O4 (M+H)+: m / z=599.2; found 599.1.

[0476] Step 3. tert-Butyl ( 1R,4R,5S)-5-(((R)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-3-iodo- 2-methylquinolin-4-yl)amino)-2-azabicyclo[2. 1. 1]hexane-2-carboxylate

[0477] To a solution of (R)-4-(((1R,4R,5S)-2-(tert-butoxycarbonyl)-2-azabicyclo[2.1.1]hexan- 5-yl)amino)-6-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-8-fluoro-2-methylquinoline-3-carboxylic acid (3.70 g, 6.17 mmol) in MeCN (6.2 mL), was added potassium phosphate (2.62 g, 12.34 mmol) and / V-iodosuccinimide (2.50 g, 11.1 mmol). The mixture was stirred at r.t. for 1 h. Once completed, the reaction mixture was poured into saturated Na2S20s solution. After stirring for 10 min., the mixture was extracted with EtOAc three times. The combined organic layers were dried over Na2SO4, filtered and concentrated under reduced pressure. The crude product was further purified with FCC (0-100% EtOAc / hexanes) to afford the title compound as an off-white solid (1.95 g, 46% yield). LC-MS calc, for C29H29CI2FIN4O2 (M+H)+: m / z=681.1 ; found 681.0.

[0478] Intermediate 3. Methyl (1 / ?,3 / ?,4S)-2-((S)-1-phenylethyl)-2-azabicyclo[2.2.1]hept-5-ene-

[0479] 3-carboxylate

[0480] Step 1. Methyl 2- hydroxy-2- methoxyacetate

[0481] A solution of glyoxylic acid monohydrate (41.4 g, 450 mmol) in anhydrous MeOH (200 mL) was heated to 70 °C overnight. After cooling to r.t., the mixture was stirred with solid NaHCOs for 10 min. The resulting mixture was filtered and concentrated under reduced pressure to afford an oily residue. The residue was dissolved in CH2CI2, dried over Na2SC>4, filtered and concentrated to afford the product (40.0 g, 82% yield). The product was used in next step without further purification.

[0482] Step 2. Methyl (S,E)-2-((1 -phenylethyl) imino)acetate

[0483] To a solution of methyl 2-hydroxy-2-methoxyacetate (40.0 g, 333 mmol) in toluene (95 mL) was added (S)-1-phenylethan-1-amine (40.4 g, 333 mmol) slowly. The mixture was stirred for 1 h at r.t. and diluted with EtOAc. The organic layer was washed with brine, dried over Na2SC>4, filtered and concentrated under reduced pressure to a yellow oil. The crude product was used in the next step without further purification.

[0484] Step 3. Methyl (1R,3R,4S)-2-((S)-1-phenylethyl)-2-azabicyclo[2.2.1]hept-5-ene-3-carboxylate

[0485] To a solution of methyl (S,E)-2-((1-phenylethyl)imino)acetate (63.7 g, 333 mmol) in 2,2,2-trifluoroethanol (800 mL) at -10 °C, was added TFA (25.5 mL, 333 mmol). The reaction mixture was allowed to stir at -10 °C for 1 h before cyclopentadiene (24.2 g, 366 mmol) was added slowly. The mixture was stirred at -10 °C for another 0.5 h and then allowed to warm up to r.t. After removal of volatiles, the residue was diluted with 2 N hydrochloric acid (500 mL) and washed with diethyl ether. The organic layer was extracted with 2 N hydrochloric acid (100 mL). The combined aqueous layer was neutralized with 28% ammonium hydroxide and extracted with EtOAc three times. The combined organic layers was dried over Na2SO4, filtered and concentrated. The crude product was purified by FCC (0-10% EtOAc / hexanes) in batches to afford the title compound as a colorless solid. LC-MS calc. for Ci6H2oN02(M+H)+: m / z=258.1 ; found 258.2.1H NMR (500 MHz, CDCI3) 6 7.32- 7.27 (m, 2H), 7.25 (m, 2H), 7.22-7.16 (m, 1 H), 6.44 (ddd, J=5.7, 3.1 , 1.2 Hz, 1 H), 6.29 (dd, J=5.7, 2.0 Hz, 1 H), 4.33 (h, J=1.5 Hz, 1 H), 3.37 (s, 3H), 3.06 (q, J=6.5 Hz, 1 H), 2.93 (dq, J=3.3, 1.6 Hz, 1 H), 2.24 (d, J=0.9 Hz, 1 H), 2.13 (dt, J=8.4, 1.7 Hz, 1 H), 1.48-1.41 (m, 4H).

[0486] Intermediate 4. 2-(tert-butyl) 3-methyl (1 / ?,3 / ?,4 / ?,5S)-5-hydroxy-2- azabicyclo[2.2.1]heptane-2,3-dicarboxylate

[0487] Boc

[0488] Step 1. Methyl (1R,3R,4R,5S)-5-hydroxy-2-((S)-1-phenylethyl)-2-azabicyclo[2.2.1]heptane-3- carboxylate

[0489] To a solution of methyl (1F?,3F?,4S)-2-((S)-1-phenylethyl)-2-azabicyclo[2.2.1]hept-5- ene-3-carboxylate (intermediate 3, 5.3 g, 20.6 mmol) in THF (70 mL) at 0 °C, was added a 0.5 N THF solution of 9-borabicyclo[3.3.1]nonane (51.5 mL, 25.7 mmol). The reaction mixture was allowed to warm up to r.t. and stirred for 18 h. Then the reaction mixture was cooled to 0 °C and a 2 N NaOH solution (36.0 mL, 72.1 mmol) was added followed by hydrogen peroxide (30% aqueous solution, 10.5 mL, 103 mmol). The reaction mixture was allowed to warm up to r.t. and stirred for 1 h. The reaction mixture was diluted with EtOAc, washed with brine, dried over Na2SO4, filtered and concentrated. The crude product was purified by FCC (50%-70% EtOAc / hexanes) to afford the sub-title compound (2.0 g, 38% yield). LC-MS calc, for C16H22NO3 (M+H)+: m / z=276.2; found 276.2.

[0490] Step 2. Methyl (1R,3R,4R,5S)-5-hydroxy-2-azabicyclo[2.2.1]heptane-3-carboxylate

[0491] To a solution of methyl (1F?,3F?,4F?,5S)-5-hydroxy-2-((S)-1-phenylethyl)-2- azabicyclo[2.2.1]heptane-3-carboxylate (2.00 g, 7.26 mmol) in EtOH (35 mL) was added 20% Pd(OH)2 / C (0.58 g). The mixture was stirred under an atmosphere of H2 for 18 h. The resulting mixture was filtered through diatomaceous earth and concentrated to afford the sub-title compound. The crude material was used for next step without further purification. LC-MS calc, for C8HI4NO3(M+H)+: m / z=172.1 ; found 172.1.

[0492] Step 3. 2-(tert-Butyl) 3-methyl (1R,3R,4R,5S)-5-hydroxy-2-azabicyclo[2.2.1]heptane-2,3- dicarboxylate

[0493] To methyl (1F?,3F?,4F?,5S)-5-hydroxy-2-azabicyclo[2.2.1]heptane-3-carboxylate (1.24 g, 7.26 mmol) dissolved in THF (10 mL), was added DIPEA (5.10 mL, 29.1 mmol) and BOC2O (3.96 g, 18.2 mmol). The reaction mixture was stirred at r.t. for 0.5 h and diluted with EtOAc. After washing with 0.01 N HCI and brine, the organic fraction was dried over Na2SO4, filtered and concentrated. The crude product was further purified by FCC (0%-100% EtOAc / hexanes) to afford the title compound (1.88 g, 95% yield). LC-MS calc, for CgH NOs (M-fBu+2H)+: m / z=216.1 ; found 216.1.

[0494] Intermediate 5. tert-butyl (1 / ?,3 / ?,4 / ?,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-ethynyl-2- azabicyclo[2.2.1]heptane-2-carboxylate

[0495] Step 1. 2-(tert-Butyl) 3-methyl (1R,3R,4R,5S)-5-((tert-butyldiphenylsilyl)oxy)-2- azabicyclo[2.2. 1 ]heptane-2, 3-dicarboxylate Boc

[0496] To a solution of 2-(tert-butyl) 3-methyl (1F?,3F?,4F?,5S)-5-hydroxy-2- azabicyclo[2.2.1]heptane-2, 3-dicarboxylate (intermediate 4, 1.88 g, 6.92 mmol) in DMF (140 mL), was added tert-butylchlorodiphenylsilane (2.08 g, 7.64 mmol) and imidazole (1.40 g, 20.8 mmol). The reaction mixture was stirred at r.t. for 18 h. The mixture was diluted with EtOAc, washed with brine five times, dried over Na2SO4, filtered and concentrated. The crude product was purified by FCC (0%-40% EtOAc / hexanes) to afford the sub-title compound. LC-MS calc, for C2sH32NOsSi (M-fBu+2H)+: m / z=454.2; found 454.2.

[0497] Step 2. tert-Butyl (1R,3R,4R,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-(hydroxymethyl)-2- azabicyclo[2.2. 1 ]heptane-2-carboxylate

[0498] Boc To a solution of 2-(tert-butyl) 3-methyl (1 ?,3 ?,4 ?,5S)-5-((tert-butyldiphenylsilyl)oxy)- 2-azabicyclo[2.2.1]heptane-2,3-dicarboxylate (1.53 g, 3.01 mmol) in THF (15 mL), was added a 2 N THF solution of UBH4 (3.8 mL, 7.52 mmol). The mixture was stirred at r.t. for 8 h and then quenched by slow addition of a saturated NH4CI solution. The mixture was diluted with EtOAc, washed with brine, dried over Na2SO4, filtered and concentrated. The crude product was purified by FCC (0-60% EtOAc / hexanes) to afford the sub-title compound (1.39 g, 96% yield). LC-MS calc, for C24H32NO4Si (M-fBu+2H)+: m / z=426.2; found 426.2.

[0499] Step 3. tert-Butyl (1R,3R,4R,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-formyl-2- azabicyclo[2.2. 1 ]heptane-2-carboxylate

[0500] Boc

[0501] To a solution of oxalyl chloride (0.73 g, 5.76 mmol) in DCM (5.3 mL) cooled to -78 °C, was added DMSO (0.61 mL, 8.64 mmol) slowly. After stirring for 10 min., a DCM (1 mL) solution of tert-butyl (1F?,3F?,4F?,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-(hydroxymethyl)- 2-azabicyclo[2.2.1]heptane-2-carboxylate (1.39 g, 2.88 mmol) was added. The reaction mixture was stirred at -78 °C for 1 h before DI PEA (1 .5 mL) was added. The reaction mixture was allowed to warm up to r.t. and stirred for another 0.5 h. Then the reaction mixture was poured into a DCM (15 mL) / 28% ammonium hydroxide (1.5 mL) mixture. After stirring for 10 min., the mixture was diluted with water. The organic phase was separated, dried over Na2SO4, filtered and concentrated to give crude product, which was used in the next step without further purification. LC-MS calc, for C^HsoNCuSi (M-fBu+2H)+: m / z=424.2; found 424.3.

[0502] Step 4. tert- Butyl (1R,3R,4R,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-ethynyl-2- azabicyclo[2.2. 1 ]heptane-2-carboxylate

[0503] To a solution of tert-butyl (1F?,3F?,4F?,5S)-5-((tert-butyldiphenylsilyl)oxy)-3-formyl-2- azabicyclo[2.2.1]heptane-2-carboxylate (1.38 g, 2.88 mmol) in MeOH (15 mL) was added dimethyl(1-diazo-2-oxopropyl)phosphonate (0.61 g, 3.17 mmol) and K2CO3(1.19 g, 8.64 mmol). After stirring for 18 h, the reaction mixture was filtered through diatomaceous earth. The filtrate was concentrated. The residue was extracted with EtOAc, filtered through diatomaceous earth and concentrated. The crude product was purified by FCC (0-40% EtOAc / hexanes) to afford the title compound (0.20 g, 51 % over 2 steps). LC-MS calc, for C25H30NO3Si (M-fBu+2H)+: m / z=420.2; found 420.2. Example 2. Synthesis of cyclopropyl((1 / ?,3 / ?,5 / ?)-3-ethynyl-2-azabicyclo[3.1.0]hexan-2- yl)methanone (step 17 in Example 1)

[0504] Step 1. l-(tert-Butyl) 2-ethyl ( / ?)-2,3-dihydro-1H-pyrrole-1,2-dicarboxylate:

[0505] To a solution of 1 -(ferf-butyl) 2-ethyl (R)-5-oxopyrrolidine-1,2-dicarboxylate (241 g, 0.938 mol) in anhydrous toluene (1.6 L) was added 1M lithium triethyl borohydride in tetrahydrofuran (1.01 L, 1.01 mol) dropwise at -50 - -40 °C over 1 h. After addition, the mixture was stirred for 1 h at about -50 °C. DI PEA (726 mL, 4.17 mol) was added to the mixture dropwise over 1 h. 4-Dimethylaminopyridine (1.49 g, 12.2 mmol, 0.013 eq.) was added to the mixture, followed by the dropwise addition of trifluoroacetic anhydride (156.5 mL, 1.126 mol) over 1.5 h. After addition, the mixture was stirred for 1 h at about -50 °C, then slowly warmed to r.t. The mixture was stirred for 1 h at r.t. The reaction mixture was cooled to 0 °C and diluted slowly with water (2.41 L), while maintaining the temperature below 10 °C during addition. The organic layer was separated and washed with water (2.41 L) and saturated brine (720 mL). The organic layer was dried over sodium sulfate (120 g). The solution was concentrated under reduced pressure to give desired product (230 g, quant.) as yellow oil. GCMS calc, for C12H19NO4: 241.1 ; Found: 214.2 (M+).1H-NMR (400 MHz, CDCI3) 5 6.70-6.48 (m, 1H), 4.99-4.86 (m, 1 H), 4.70-4.52 (m, 1H), 4.30-4.11 (m, 2H), 3.15-2.98 (m, 1H), 2.73-2.57 (m, 1H), 1.53-1.38 (m, 9H), 1.34-1.21 (m, 4H).

[0506] Step 2. 2-(tert-Butyl) 3-ethyl (1 / ?,3 / ?,5 / ?)-2-azabicyclo[3.1.0]hexane-2,3-dicarboxylate

[0507] To a solution 1 -(terf-butyl) 2-ethyl (R)-2,3-dihydro-1 / 7-pyrrole-1,2-dicarboxylate (230 g, 0.938 mol) in toluene (2.3 L) was added 1.1M diethylzinc in toluene (1.7 L, 1.87 mol) at -30 to -25 °C over 1 h. Chloroiodomethane (273 mL, 3.752 mol) was added to the mixture dropwise over 2 h at about -30 to -20 °C and the mixture was stirred for 16 h. Halfsaturated sodium bicarbonate (2.3 L) was added to the mixture and the mixture was warmed up to r.t. The mixture was filtered over diatomaceous earth to remove white solids and the filter bed was rinsed with toluene (1.5 L). The organic layer was separated from the filtrate and washed with water (2x1.15 L) and saturated brine (1.15 L). The toluene solution was concentrated under reduced pressure to give a 6 to 1 mixture (231 g) of 2-(tert- Butyl) 3-ethyl (1R,3R,5R)-2-azabicyclo[3.1.0]hexane-2,3-dicarboxylate and 2-(ferf-butyl) 3-ethyl (1 S,3R,5S)-2-azabicyclo[3.1.0]hexane-2,3-dicarboxylate as yellow oil as determined by GCMS analysis.

[0508] Aqueous methyl amine (40%, 344 g) was added to a crude mixture product obtained above (226 g) and the mixture was stirred for 16 h at r.t. Water (340 mL) and methyl tert- butyl ether (340 mL) was added to the mixture. The organic layer was separated and washed with water (340 mL) and saturated brine (230 mL). The solution was concentrated under reduced pressure to give 2-(tert-butyl) 3-ethyl (1R,3R,5R)-2-azabicyclo[3.1.0]hexane- 2,3-dicarboxylate (177 g, 73% calc, yield) as yellow oil, which contained 2% 2-(tert-butyl) 3- ethyl (1 S,3R,5S)-2-azabicyclo[3.1.0]hexane-2,3-dicarboxylate as determined by GCMS analysis. GCMS calc, for C13H21NO4: 255.1 ; Found: 255.1 (M+).1H-NMR (400 MHz, CDCI3) 6 4.56-4.39 (m, 1 H), 4.18-4.01 (m, 2H), 3.51-3.36 (m, 1 H), 2.60-2.42 (m, 1 H), 2.00-1.92 (m, 1 H), 1.45-1.32 (m, 9H), 1.23-1.15 (m, 4H), 0.87-0.79 (m, 1 H), 0.70-0.56 (m, 1 H).

[0509] Step 3. tert-Butyl (1 / ?,3 / ?,5 / ?)-3-(hydroxymethyl)-2-azabicyclo[3.1.0]hexane-2- carboxylate „ Boc

[0510] A solution of 2-(tert-butyl) 3-ethyl (1R,3R,5R)-2-azabicyclo[3.1.0]hexane-2,3- dicarboxylate (177 g, 0.694 mol) in tetrahydrofuran (1.56 L) was added to 1M lithium aluminum hydride solution in tetrahydrofuran (777 mL, 0.777 mol, 1.12 eq.) at about 0-10 °C over 1 h. After addition, the mixture was stirred for 2 h at 3 °C. Water (27 mL) was added to the mixture dropwise to quench the reaction. Sodium hydroxide solution (15%, 27 mL) and water (80 mL) were sequentially added to the mixture dropwise. The mixture was stirred at r.t. for 1 h. DCM (2.35 L) was added to the mixture. The suspension was filtered through diatomaceous earth (100 g) bed and rinsed with DCM (300 mL). The filtrate was concentrated under reduced pressure and dried under vacuum oven at 40 °C for 18 h to give tert-butyl (1R,3R,5R)-3-(hydroxymethyl)-2-azabicyclo[3.1.0]hexane-2-carboxylate (133 g, 90% yield) as yellow oil which contained 2% of an isomer as determined by GCMS analysis. GCMS calc, for CnHi9NO3: 213.1 ; Found: 213.2 (M+).1H-NMR (400 MHz, CDCI3) 5 4.83 (brs, 1 H), 4.34 (brs, 1 H), 2.45 (ddd, 1 H), 1.55-1.43 (m, 12H), 0.80 (q, 1 H), 0.40 (brs, 1 H).

[0511] Step 4. tert-Butyl (1 / ?,3 / ?,5 / ?)-3-formyl-2-azabicyclo[3.1.0]hexane-2-carboxylate

[0512] Boc

[0513] DMSO (42.7 mL, 0.603 mol) was added to oxalyl chloride (26.4 mL, 0.301 mol) in DCM (535 mL) dropwise at -78 °C over 30 min., while maintaining the temperature below -60 °C during addition. After stirring at -78 °C for 30 min. tert-butyl (1R,3R,5R)-3- (hydroxymethyl)-2-azabicyclo[3.1.0]hexane-2-carboxylate (53.5 g, 0.251 mol) in DCM (535 mL) was added to solution dropwise at -78 °C over 40 min. After stirring at -78 °C for 30 min., NEta (104.9 mL, 0.753 mol) was added to solution dropwise at -78 °C over 40 min. After stirring at -78 °C for 1 h, the reaction mixture was warmed to 0 °C and stirred for 30 min. Water (888 mL) was added to the mixture and stirred for 20 min. The aqueous layer was separated and extracted with DCM (2x888 mL). The combined organic layers were sequentially washed with 1 M HCI (888 mL), water (888 mL) and saturated brine (888 mL). The organic layer was concentrated under reduced pressure to give te / f-butyl (1R,3R,5R)-3- formyl-2-azabicyclo[3.1.0]hexane-2-carboxylate (44 g, 83% yield) as yellow oil. GCMS calc, for C11H17NO3: 213.1 ; Found: 213.2 (M+).1H-NMR (400 MHz, CDCI3) 6 9.54-9.31 (m, 1 H), 4.64-4.39 (m, 1 H), 3.68-3.45 (m, 1 H), 2.68-2.33 (m, 1 H), 2.24-2.10 (m, 1 H), 1.53-1.41 (m, 10H), 0.88-0.71 (m, 1 H), 0.39-0.28 (m, 1 H).

[0514] Step 5. tert-Butyl (1 / ?,3 / ?,5 / ?)-3-ethynyl-2-azabicyclo[3.1.0]hexane-2-carboxylate „ Boc

[0515] K2CO3 (28.8 g, 0.209 mol, 2 eq.) was added to a solution of terf-butyl (1R,3R,5R)-3- formyl-2-azabicyclo[3.1.0]hexane-2-carboxylate (22 g, 0.104 mol) in methanol (352 mL) at 0-5°C. Dimethyl (1-diazo-2-oxopropyl)phosphonate (18.3 mL, 0.110 mol) was added to the mixture dropwise at 0-5 °C for 30 min., while maintaining the temperature at < 5 °C during addition. After stirring at 0-5 °C for 15 min., the reaction mixture was warmed up to r.t. and stirred for 2 h. Water (372 mL) and EtOAc (930 mL) was added to the mixture, which was stirred for 15 min. The aqueous layer was separated and extracted with EtOAc (372 mL). The combined organic layers were washed with water (560 mL) and saturated brine (560 mL). The organic solution was concentrated under reduced pressure and purified over silica gel and eluted with a gradient of 0-10% EtOAc in heptane to give a 7 to 1 mixture of terf-butyl (1R,3R,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexane-2-carboxylate and terf-butyl (1R,3S,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexane-2-carboxylate (82 g, 74% calc, yield) as light yellow oil. GCMS calc, for C12H17NO2: 207.1 ; Found: 207.0 (M+).1H-NMR (400 MHz, CDCI3) 6 4.78-4.54 (m, 1 H), 3.60-3.46 (m, 1 H), 2.52-2.40 (m, 1 H), 2.30-2.22 (m, 1 H), 2.18- 2.08 (m, 1 H), 1.50-1.48 (m, 9H), 1.16-1.05 (m, 1 H), 0.91-0.80 (m, 1 H), 0.78-0.66 (m, 1 H).

[0516] Step 6. Cyclopropyl((1 / ?,3 / ?,5 / ?)-3-ethynyl-2-azabicyclo[3.1.0]hexan-2-yl)methanone A mixture of tert-butyl (1R,3R,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexane-2-carboxylate and tert-butyl (1R,3S,5R)-3-ethynyl-2-azabicyclo[3.1.0]hexane-2-carboxylate (82 g, 0.39 mol) and 4M HCI in dioxane (297 mL, 1.19 mol, 3 eq.) was stirred at rt for 4 h. The reaction mixture was diluted with THF (1.23 L) and cooled to 0 °C. NEt3(275.8 mL, 1.98 mol) was added to the reaction at 0 °C dropwise over 1.5 h while maintaining the temperature at <10 °C during addition. Cyclopropanecarbonyl chloride (45,4 g, 0.43 mol) was added to the reaction at 0 °C. The reaction was warmed to r.t. and stirred for 3 h. 1 M HCI (410 mL, 5 vol) and DCM (820 mL) was added. The aqueous layer was separated and extracted with DCM (2x820 mL). The combined organic layers were washed with water (820 mL) and saturated brine (820 mL). The organic layer was concentrated under reduced pressure to give a crude residue (60 g). Diatomaceous earth (120 g) was added to the crude residue and the mixture was dried under reduced pressure to give a dried load powder (186 g). The dried load powder was purified on a silica gel column (1.5 kg) and eluted with a gradient of 15 to 40% EtOAc in heptane. The desired fractions were concentrated under reduced pressure and dried under vacuum at 30 °C for 18 h to give the title compound (40.8 g, 59% yield) as brown oil. GCMS calc, for C12H17NO2: 175.1 ; Found: 175.0 (M+).1H-NMR (400 MHz, DMSC ) 6 5.14 (dt, 0.45H), 4.81 (dt, 0.55H), 3.82 (t, 0.55H), 3.71 (t, 0.45H), 3.42 (d, 0.45H), 3.15 (d, 0.55H), 2.57 (ddd, 0.45H), 2.44 (ddd, 0.55H), 2.09 (dd, 0.45H), 2.04 (ddd, 0.55H), 1.97 (dd, 0.55H), 1.86-1.69 (m, 1 H), 1.62 (dddd, 0.45H), 1.01 (td, 0.55H), 0.90 (td, 0.45H), 0.87-0.68 (m, 5H).

[0517] Example 3. Synthesis of tert-Butyl (1 R,4R,5S)-5-amino-2-azabicyclo[2.1.1]hexane-2- carboxylate oxalate (step 14a in Example 1)

[0518] Step 1. (E)-4-Methoxybut-3-en-2-one:

[0519] A mixture of 4,4-dimethoxy-2-butanone (350 g, 1.0 eq) and sodium acetate (11g, 0.05 eq.) was heated to 145-150 °C under nitrogen atmosphere and the resulting methanol is purged during the heating process. When the reaction is complete, the mixture was cooled to 70-80 °C. The product was distilled under vacuum to give desired product (130 g, yield 50%). 1 H NMR (CD2CI2 / CHDOD, 400 MHz): 5 7.60 (d, 1 H, J=12.8 Hz) 5.53 (d, 1 H, J=12.8 Hz), 3.81 (s, 3H,), 2.17 (s, 3H). 13C NMR (CD2CI2 / CD3OD, 100.6 MHz): 5 27.1 , 58.0, 107.0, 165.2, 199.6.

[0520] Step 2. (E)-4-(Allylamino)but-3-en-2-one: A mixture of (E)-4-methoxybut-3-en-2-one (150 g) and NEts (182 g) in DCM (450 mL) was added was agitated under nitrogen at 10-15 °C. Allylamine hydrochloride aqueous solution (60%, 234 g) is slowly added to the mixture at 10-15 °C. After the addition, the mixture is agitated for 30 min. When the reaction was completed, water (150 g) was added to the reaction mixture. The organic phase was separated, and the water phase was extracted with DCM (300 mL). The combined organic phases were washed with brine (150 mL) and organic phase was concentrated under vacuum to give crude product as yellow oil (175 g, yield 93%). 1 H NMR (500MHz, CDCI3): 5 9.75 (bs, 1 H); 6.58 (dd, 1 H, J=16.8, 2); 5.78-5.86 (m, 1 H); 5.19 (d, 1 H, J=16.8)); 5,14 (d, 1 H, J=10, 1)); 5.00 (d, 1 H, J=10, 1); 3.74-3.77 (m, 2H); 2.03, (s, 3H). 13C NMR (125 Hz, CDCI3): 197.5; 153.2; 165.3; 117.6; 94.9; 51.1 ; 29.2.

[0521] Step 3. tert-Butyl (E)-allyl(3-oxobut-1-en-1-yl)carbamate:

[0522] A mixture of (E)-4-(allylamino)but-3-en-2-one (130 g), trimethylamine (105 g), N,N- dimethylaminopyridine (13 g) in toluene (390 mL) was heated to 50-55 °C. (Boc)2O (259 g) was added in portion while maintained the reaction temperature between 50-55 °C. After the reaction mixture was agitated for 2 h at 50-55 °C to complete the reaction. The mixture was cooled to 10-15 °C and 3 M aq. HCI was added to the mixture until the pH 5-6. The organic phase was separated, and the aqueous phase was extracted with toluene (260 mL). The combined organic phases were washed with water (260 mL). Activated charcoal (1 g) was added. The mixture was agitated at 50-55 °C for 1 h before cooling the mixture to 20-30 °C. The mixture was filtered over diatomaceous earth bed and the diatomaceous earth bed was rinsed with toluene. The filtrated was concentrated to a residue and the residue was coevaporated with MeCN to give a residue as yellow oil (189 g, 80% yield). 1 H NMR (500 MHz, CDCI3): 5 8.11 (d, 1 H, J=15); 5.68-5.73 (m, 1 H); 5.49 (d, 1 H, J=15); 5.14 (d, 1 H, J=18); 5.09 (d, 1 H, J=10); 4.13 (t, 2H); 2.20 (s, 3H); 1.50 (s, 9H). 13C NMR (125 MHz, CDCI3): 198.6; 153.0; 143.2; 131.8; 117.8; 109.5; 84.0; 47.0; 28.3; 28.1.

[0523] Step 4. tert-Butyl 5-acetyl-2-azabicyclo[2.1.1]hexane-2-carboxylate:

[0524] Boc

[0525] A solution of tert-butyl (E)-allyl(3-oxobut-1-en-1-yl)carbamate (270 g) in MeCN (3240 mL) was subjected to UV-photo reactor. When the reaction was complete, the yellow oil residue (major and minor isomer mixture) was used for next step without further purification. Sample was purified by column to get analytical data. 1 H NMR (500 MHz, CDCI3) 6 4.62-6.78 (bd, 1 H); 3.40 (bt, 1 H); 3.16 (bs, 1 H); 3.06 (bs, 1 H); 2.69 (s, 1 H); 1.97 (s, 3H); 1.70-1.73 (m, 1 H); 1.46 (s, 9H).

[0526] Step 5. tert-Butyl (1R,4R,5S)-5-amino-2-azabicyclo[2.1.1]hexane-2-carboxylate oxalate:

[0527] A mixture of tert-butyl 5-acetyl-2-azabicyclo[2.1.1]hexane-2-carboxylate (150 g) in MeCN (1500 mL) was added to sodium hypochlorite (173.5 g) in 30% sodium hydroxide solution at 30-40 °C (1500 mL). The mixture was agitated at 30-40 °C for 30 min. to complete the reaction. The mixture was cooled to 10-15 °C and 6M HCI aq. solution was added to adjust the mixture pH 8-9. The mixture was concentrated under vacuum to remove MeCN at 50-55 °C and methanol (90 mL) was added to the residue. The mixture was cooled to 10-15 °C and 6M HCI was added to adjust the mixture pH 2-3 (solids precipitated out as the pH adjustment) and agitated for additional 2-3 h. The solids were isolated and rinsed with water (300 mL). The wet solids were dried under vacuum at 50-55 °C.

[0528] Recrystallization: A mixture of the solids in toluene (1500 mL) was heated to 60- 70 °C to a solution. (R)-(+)-1 -phenylethylamine (80.7 g) was added at 40-70 °C. The solution was cooled to 30-35 °C over 90 min. (solids precipitated gradually) and agitated for 1 h. The suspension was cooled to 20-25 °C over 90 min. and agitated for 2 h. The solids were isolated and rinsed with toluene (40 mL). A mixture of the cake and toluene (1200 mL) was heated to 100-105 °C to a solution. The mixture was cooled to 75-85 °C over 90 min. (solids precipitated) and agitated for 1 h. The mixture was cooled to 20-25 °C over 2 h and agitated for 2 h. The solids were isolated and rinsed with toluene (40 mL). The recrystallization process was repeated one more time.

[0529] Free base: to a mixture of the wet cake in toluene (225 mL) and water (225 mL) was added 30% aq. NaOH at 10-15 °C to pH 9-10. The mixture was agitated for 30 min. and the organic phase was separated. To the aqueous phase was added 6 M aq. HCI at 10-15 °C to pH 2-3 (solids predicated). The mixture was then cooled to 3-8 °C and agitated for 1 h. The solids were isolated and washed with water (40 mL). The wet cake was dried under vacuum at 50-55 °C to give the desired (1R,4S,5S)-2-(terf-butoxycarbonyl)-2- azabicyclo[2.1.1]hexane-5-carboxylic acid (25 g, 18% yield).

[0530] A mixture of the acid (245 g), pyridine (86 g) and ammonium carbonate (111 g) in MeCN (3700 mL) was added (Boc)2O (310 g) at 15-25 °C. The mixture was agitated for 5 h to complete the reaction. The solids were isolated and rinsed with MeCN (250 mL). The filtrate and rinse were combined and concentrated under vacuum at 40-45 °C and azeotroped with heptane. To the residue was added EtOAc (130 mL) and n-heptane (650 mL) at 40-45 °C. The mixture was cooled to 10-15 °C (solids precipitated) and agitated for 2 h. The solids were isolated and rinsed with n-heptane (250 mL). The wet cake was dried under vacuum at 50-55 °C to give desired product tert-butyl (1R,4S,5S)-5-carbamoyl- 2-azabicyclo[2.1.1]hexane-2-carboxylate quantitatively.

[0531] To cooled 15% aq. NaOH (800 mL) at 10-15 °C was added the tert-butyl (1R,4S,5S)- 5-carbamoyl-2-azabicyclo[2.1.1]hexane-2-carboxylate (214 g). Sodium hypochlorite (91.2 g) was added at 10-20 °C and the mixture was agitated for 2 h. The mixture was heated to 40- 45 °C for 4 h to complete the reaction. The reaction mixture was cooled to 15-20 °C and citric acid was added to adjust pH 5-6. The mixture was basified by addition of sodium hydroxide to pH 14. The basified mixture was extracted with 2-methyltetrahydrofuran (2x1000 mL). The combined organic phase was concentrated under vacuum and the residual was azeotroped with MeCN. The residue was dissolved in (140 mL) and activated charcoal (2 gram) was added. The mixture was agitated at 25-30 °C for 2 h. The mixture was filtered, and the filter bed is rinsed with MeCN (85 mL). The combined filtrate and rinse were added to a solution of oxalic acid (120 g) in MeCN (850 mL) at 40-45 °C. The solution was cooled to 3-7°C and agitated for 1 h. The solids were isolated and rinsed with MeCN (110 mL). The wet cake was dried at 40-50 °C under vacuum to give desired tert-butyl (1 R,4R,5S)-5-amino-2-azabicyclo[2.1.1]hexane-2-carboxylate oxalate (248 g, 91% yield) as white solids. HPLC-MS for calc. C10H18N2O2: 198.14; Found (M+H): 199.11H NMR (500 MHz, DMSO-cfe): 68.44 (s, 3H); 3.34, (m, 1H); 4.24, dt, 1H, J=6.9, 1.7 Hz); 3.20-3.31 (m, 2H); 2.84, (dt, 1 H, J=6.5, 3.0); 1.65-1.71 (m, 1H); 1.42 (s, 9H); 1.19 (d, 1H, J=8.1).13C NMR (125 Hz, DMSO-d6): 6 165.0; 155.8; 79.5; 61.5; 50.6; 44.9; 40.8; 33.8; 28.6.

[0532] Example 4: Antitumor Efficacy and Pharmacodynamics Compound 1 ± Cetuximab and Compound 2 ± Cetuximab in the LS513 Colorectal Cancer Xenograft Mouse Model LS513 Xenograft Efficacy Model

[0533] Female NSG-SCID mice (Jackson Labs, aged 8-10 weeks) were inoculated subcutaneously with 5 x 106LS513 cells suspended in 50% phosphate buffered saline and 50% Matrigel® (354234 Corning®). For the efficacy portion of these studies — note that compound 1 (monotherapy and combinations) and compound 2 (monotherapy and combinations) were tested in independent studies — treatment of tumor-bearing mice started 11 (combination with Compound 1) or 13 days (combination with Compound 2) days after inoculation, when tumor volume reached approximately 250 mm3. LS513 inoculated mice were randomized by tumor volume into groups of n = 10. They were then administered monotherapy with either Compound 1 (30 mg / kg QD PO or 100 mg / kg QD PO), Compound 2 (10 mg / kg QD PO or 30 mg / kg QD PO), or cetuximab (3 mg / kg BIW IP), Compound 1 in combination with cetuximab (at either 30 mg / kg QD or 100 mg / kg QD Compound 1), Compound 2 in combination with cetuximab (at either 10 mg / kg QD or 30 mg / kg QD Compound 2) or vehicle PO. Treatment was continuous throughout the study and ended on day 31 (Compound 1) or day 33 (Compound 2) post-tumor implant. Mice were weighed and tumor measurements taken twice a week thru the end of the study on the day following the final treatment dose (day 32 or day 33 post-tumor implant). The tumor volume was calculated in 2 dimensions using the following equation: volume = [length x (width2)] / 2.

[0534] Tumor growth inhibition (TGI) was calculated using the formula (1 - [VT / VC])X100, where VT is the average tumor volume of the treatment group on the last day of treatment and Vc is the average tumor volume of the control group on the last day of treatment. A partial response is defined as tumor volume < 50% initial tumor volume for 2 consecutive measurements and a complete response is defined as tumor measuring < 3 mm x 3 mm (or < 27 mm3) for 2 consecutive measurements. Statistical analyses were performed using GraphPad Prism software (v9.3.1 ; GraphPad Software, Boston, MA). Two-way ANOVA with Dunnett's multiple comparisons test was used to determine statistical differences between the treatment groups compared to the vehicle control group and monotherapy groups.

[0535] LS513 Pharmacodynamic Model

[0536] Female NSG-SCID mice (Jackson Labs, aged 8-10 weeks) were inoculated subcutaneously with 5 x 106LS513 cells suspended in 50% phosphate buffered saline and 50% Matrigel® (354234 Corning®). For the pharmacodynamic portion of the study, treatment of tumor-bearing mice started 22 days after inoculation for the 4 hour collection and 28 days after inoculation for the 24 hour collection, when tumor volume reached approximately 700 mm3(4hr) or 560 mm3(24hr). The tumor volume was calculated in 2 dimensions using the following equation: volume = [length x (width2)] / 2.

[0537] LS513 inoculated mice were randomized by tumor volume into groups of n = 4. They were then administered a single dose of monotherapy with either Compound 1 (30 mg / kg QD PO or 100 mg / kg QD PO) or cetuximab (3 mg / kg BIW IP), both agents in combination at both dose concentrations of Compound 1 , or vehicle PO. Plasma and tumor samples were collected 4 hours and 24 hours post dose following CO2 asphyxiation. Blood was collected into ethylenediaminetetraacetic acid (450480 Greiner Bio-One) tubes. The plasma was analyzed for drug levels. Tumor fragments were collected from each individual and weighed into Omni Bead Ruptor tubes (19-628 Omni International) and flash frozen. One tumor piece was lysed at a 1 :5 ratio with homogenization solution (water:acetonitrile:formic acid, 95:5:0.1 , v:v:v) for drug concentration analysis. A second tumor piece was then lysed at a 1 :5 ratio with lysis buffer (64KL1 FD, Cisbio) with added protease inhibitors (A32957 and A32965, Thermo Fisher) and Blocking Reagent (64KB1AAC, Cisbio) on a Bead Ruptor Elite homogenizer (19-042E, Omni International, Kennesaw, GA). Tumor lysates were spun at 10,000 revolutions per minute for 10 minutes at 4°C. The protein concentration was determined using the Pierce™ BCA Protein Assay method according to the manufacturer's protocol (23227 Thermo Fisher Scientific). The lysates were diluted with additional lysis buffer to a final concentration of 0.4 pg / pL. Samples were analyzed using the MesoScale Discovery Platform on the Phospho / Total ERK1 / 2 Whole Cell Lysate Kit (K15107D, MesoScale Discovery, Rockville, MD). The pERK levels were first normalized to total ERK for each sample and then to the average pERK / tERK ratio of the vehicle control group.

[0538] Pharmacokinetic Sample Analysis

[0539] Plasma and tumor concentrations of Compound 1 were determined with a calibration curve prepared in plasma. Quality control samples prepared in vehicle tumor homogenate were included to confirm the accuracy of plasma as a surrogate matrix for the tumor homogenate samples. Plasma and tumor homogenate study sample aliquots (25 pL volume) were deproteinized with vigorous mixing with 200 pL of 50 nM Compound 1 in acetonitrile. After centrifugation, 100 pL of the supernatants were transferred to a 96-well plate containing 200 pL of water, mixed well, and analyzed by LC-MS / MS. Chromatography was performed using 5 pL injections of extracts with an ACE C18-AR HPLC column (50 x 2.1 mm, 3 pm, at 45°C) under gradient conditions (see Table 1) with a flow rate of 0.75 mL / minute. All tumor samples were above quantitation limit (5000 nM) for Compound 1 , additionally, Compound 1 signal saturated on mass spectrometer. Thus, all samples for Compound 1 were re-injected at 2 pL. All tumor samples with concentrations above the upper limit of quantification were reinjected at 0.5 pL (along with a set of QCs) to bring the peak areas within the linear range. Water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid were used for Mobile Phase A and B, respectively. The LC- MS / MS analysis was performed using a Shimadzu Nexera Ultra High-Performance Liquid Chromatography system coupled to the electrospray ionization source (in positive ion MRM mode) of a SCI EX Triple Quad 6500+ mass spectrometer. Peak areas for the MRM transitions 628.228 m / z 517.228 m / z for Compound 1 (retention time = 1.18 min), 370.792 m / z 296.652 m / z for methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H- pyrrolo[3,2-c]quinolin-2-yl)pyrrolidine-1-carboxylate (“Compound 2”) (retention time = 1.30 min) as Internal Standard for Compound 1 were used to create linear regression calibration equations with 1 / x2weighting. SCI EX Analyst® software (v1.7.2) was used to acquire the raw data and to calculate calibration curves and study sample concentrations. The assay range was adjusted for anticipated study concentrations, ranging from 1 to 5000 nM. Table 1 : High-Performance Liquid Chromatography Gradient Elution Scheme

[0540] Note: Post-column divert valve: 0.8 to 1.6 minutes flow to mass spectrometry, all else to waste.

[0541] RESULTS

[0542] Antitumor Activity of Compound 1 + Cetuximab in the LS513 Colorectal Xenograft Tumor Model

[0543] The antitumor activity of the combination of Compound 1 and Cetuximab was evaluated in the LS513 colorectal model. Mice were administered monotherapy with either Compound 1 (30 mg / kg QD PO, 100 mg / kg QD PO) or Cetuximab (3 mg / kg BIW IP), both agents in combination at both dose concentrations of Compound 1 , or vehicle PO. When assessed on day 32, following the final treatment day, 30 mg / kg Compound 1 resulted in a TGI of 73% when compared to vehicle (p < 0.0001), while 100 mg / kg Compound 1 resulted in a TGI of 93% when compared to vehicle (p < 0.0001). All 10 mice in the 100 mg / kg Compound 1 monotherapy group achieved partial responses. Cetuximab IP BIW yielded 64% TGI (p=0.0001). The combination of 3 mg / kg of Cetuximab BIW IP with 30 mg / kg of Compound 1 induced 96% TGI (p < 0.0001) compared to vehicle (see Figure 1) and resulted in 3 complete responses and 7 partial responses. The combination of 3 mg / kg Cetuximab BIW IP with 100 mg / kg Compound 1 generated 100% TGI compared to vehicle (p < 0.0001) and resulted in complete responses in all animals (10 of 10). When compared to monotherapy Compound 1 , combination treatment with cetuximab resulted in significantly decreased tumor growth (p < 0.0001 when comparing 30 mg / kg Compound 1 monotherapy vs 30 mg / kg Compound 1 + cetuximab combination and p = 0.0006 when comparing 100 mg / kg Compound 1 monotherapy vs 100 mg / kg Compound 1 + cetuximab combination). Each treatment type was tolerated, as illustrated by lack of body weight loss across treatment groups (see Figure 2 and Table 2).

[0544] In Figure 1 , NSG-SCID mice bearing subcutaneous LS513 tumors were treated with monotherapy of either Compound 1 (30 mg / kg PO QD, 100 mg / kg PO QD) or cetuximab (3 mg / kg IP BIW), both agents in combination at both dose concentrations of Compound 1 , or vehicle PO. Dose administration began on Day 11 and ended on Day 31. n = 10 mice / group. Cetuximab was given on days 11 , 15, 18, 22, 25, and 29 post tumor implant. PR - Partial response -tumors that had a volume < 50% of the initial tumor volume for 2 consecutive measurements. CR - Complete response - tumors that measured < 3 mm x 3 mm (or < 27 mm3) for 2 consecutive measurements. ** - p-value = 0.0019; *** - p-value = 0.0001 ; **** - p- value < 0.0001 (all in comparison to Group 1 - Vehicle). # - Cetuximab + 30 mg / kg Compound 1 - p-value < 0.0001 in comparison to Compound 1 monotherapy (30 mg / kg QD). & - Cetuximab + 100 mg / kg Compound 1 - p-value= 0.0003 in comparison to Compound 1 monotherapy (100 mg / kg QD).

[0545] In Figure 2, body weight was measured throughout the study. No toxicity, as measured by body weight loss, was observed with Compound 1 ± cetuximab. SEM = standard error of the mean, n = 10 mice / group.

[0546] Table 2: Mean (± SEM) Body Weight of LS513 Tumor-Bearing Mice Administered Compound 1 ± Cetuximab

[0547] Pharmacodynamics of Compound 1 ± cetuximab in LS513 Tumor-Bearing Mice

[0548] Plasma and tumors were collected 4 & 24 hours post single oral and IP dose with either monotherapy Compound 1 (30 mg / kg QD PO, 100 mg / kg QD PO) or Cetuximab (3 mg / kg BIW IP), both agents in combination at both dose concentrations of Compound 1 , or vehicle PO. Levels of total and phosphorylated ERK were measured from the tumor samples. Treatment with Compound 1 at 30 or 100 mg / kg induced dose dependent pERK inhibition in this model. In this single-dose setting, pERK inhibition was greater at 4 hours (near Cmax) than at 24 hours (Ctrough). Cetuximab as a monotherapy had little impact on pERK levels by 4-hours post dose, but by 24-hours post dose was inducing pERK inhibition on par with single-agent Compound 1. Combination treatment with Compound 1 + cetuximab tended to increase the degree of pERK inhibition observed, but not by a statistically significant amount. Figure 3 summarizes these results wherein NSG-SCID mice bearing subcutaneous LS513 tumors were treated with monotherapy of either Compound 1 at 30 mg / kg PO QD, 100 mg / kg PO QD, or Cetuximab at 3 mg / kg IP BIW, both agents in combination at both dose concentrations of Compound 1, or vehicle PO. Tumor samples were collected 4 & 24 hours post single oral or IP dose. The percent inhibition of pERK / ERK relative to vehicle control is plotted in bars, n = 4 mice / group Pharmacodynamics of Compound 1 ± cetuximab in LS513 Tumor-Bearing Mice

[0549] Plasma and tumor were collected after a single oral dose from N = 4 mice from each

[0550] Compound 1 treated group at 4 and 24 hours post dose following CO2 asphyxiation. The data collected is shown in Table 3.

[0551] Table 3: Plasma and Tumor Concentration Relative to pERK inhibition The data demonstrate that dosing Compound 1 in combination with cetuximab resulted in additional tumor growth inhibition in the LS513 Xenograft model. Cetuximab and Compound 1 is synergistic (at both dose levels of Compound 1) as determined using the “survival curves” described in E. Demidenko, et al., PLoS ONE, 2019, 74(11): e0224137. Increased efficacy from the combination was due to activity not associated with inhibition of pERK signaling.

[0552] RESULTS

[0553] Antitumor Activity of Compound 2 + Cetuximab in the LS513 Colorectal Xenograft Tumor Model

[0554] The antitumor activity of the combination of Compound 2 and Cetuximab was evaluated in the LS513 colorectal model. Mice were administered monotherapy with either Compound 2 (10 mg / kg QD PO, 30 mg / kg QD PO) or Cetuximab (3 mg / kg BIW IP), both agents in combination at both dose concentrations of Compound 2, or vehicle PO. When assessed on day 34, all treatment groups were found to have significantly inhibited tumor growth, compared to the vehicle control (p < 0.0002). Combining Compound 2 with Cetuximab resulted in superior efficacy compared to the relevant monotherapy groups. The combination of Compound 2 at 10 mg / kg + cetuximab significantly inhibited tumor growth compared to both monotherapy with Compound 2 (10 mg / kg) or with cetuximab (p < 0.0008). Likewise, the combination of Compound 2 at 30 mg / kg + cetuximab significantly inhibited tumor growth compared to both monotherapy with Compound 2 (30 mg / kg) or with cetuximab (p < 0.0003).

[0555] Example 5: Antitumor Efficacy and Pharmacodynamics Compound 1 ± Cetuximab in the HPAFII Pancreatic Cancer Xenograft Mouse Model

[0556] HPAFII Xenograft Efficacy Model

[0557] Female NCr nude mice (Taconic Biosciences, aged 8-10 weeks) were inoculated subcutaneously with 1 x 107HPAFII cells suspended in 50% phosphate buffered saline and 50% Matrigel® (354234 Corning®). For the efficacy portion of the study, treatment of tumorbearing mice started 13 days after inoculation, when tumor volume reached approximately 280 mm3. HPAFII inoculated mice were randomized by tumor volume into groups of n = 10. They were then administered monotherapy with either Compound 1 (30 mg / kg QD PO or 100 mg / kg QD PO) or cetuximab (3 mg / kg BIW IP), both agents in combination (at either 30 mg / kg QD or 100 mg / kg QD Compound 2), or vehicle PO. Treatment was continuous throughout the study and ended on day 32 post-tumor implant. Mice were weighed and tumor measurements taken twice a week thru the end of the study on day 32 post-tumor implant. The tumor volume was calculated in 2 dimensions using the following equation: volume = [length x (width2)] / 2.

[0558] Tumor growth inhibition (TGI) was calculated using the formula (1 - [VT / VC])X100, where VT is the average tumor volume of the treatment group on the last day of treatment and Vc is the average tumor volume of the control group on the last day of treatment. A partial response is defined as tumor volume < 50% initial tumor volume for 2 consecutive measurements and a complete response is defined as tumor measuring < 3 mm x 3 mm (or < 27 mm3) for 2 consecutive measurements. Statistical analyses were performed using GraphPad Prism software (v9.3.1; GraphPad Software, Boston, MA). Two-way ANOVA with Tukey’s multiple comparisons test was used to determine statistical differences between the treatment groups compared to the vehicle control group and monotherapy groups.

[0559] RESULTS

[0560] Antitumor Activity of Compound 1 + Cetuximab in the HPAFII Pancreatic Cancer Xenograft Tumor Model

[0561] The antitumor activity of the combination of Compound 1 and Cetuximab was evaluated in the HPAFII pancreatic cancer model. Mice were administered monotherapy with either Compound 1 (30 mg / kg QD PO, 100 mg / kg QD PO) or Cetuximab (3 mg / kg BIW IP), both agents in combination at both dose concentrations of Compound 1, or vehicle PO. When assessed on day 32, animals treated with Compound 1 monotherapy at 100 mg / kg or with compound 2 (at either 30 or 100 mg / kg) + cetuximab had significantly decreased tumor growth compared to the vehicle control (p < 0.0202); animals treated with Compound 1 monotherapy at 30 mg / kg had decreased tumor growth compared to the vehicle control group but the decrease was not statistically significant (Figure 5). Tumor growth in the group treated with monotherapy cetuximab did not differ meaningfully from tumor growth in the vehicle control group. Combining Compound 1 with Cetuximab resulted in superior efficacy compared to the relevant monotherapy groups, though due to intra-group variability and the high-degree of tumor-growth inhibition generated by monotherapy Compound 1 (82% TGI for Compound 1 at 100 mg / kg) this did not reach statistical significance. That said, treatment with compound 1 (100 mg / kg) + cetuximab did result in significantly decreased tumor growth compared to the lower dose combination group (compound 1 at 30 mg / kg + cetuximab).

[0562] The disclosed subject matter is not to be limited in scope by the specific embodiments and examples described herein. Indeed, various modifications of the disclosure in addition to those described will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims.

[0563] All references e.g., publications or patents or patent applications) cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each individual reference {e.g., publication or patent or patent application) was specifically and individually indicated to be incorporated by reference in its entirety for all purposes. Other embodiments are within the following claims.

Claims

CLAIMSWhat is claimed is:

1. A method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or pharmaceutically acceptable salt thereof.

2. The method of claim 1 , wherein the EGFR inhibitor is an anti-EGFR antibody.

3. The method of claim 1 or 2, wherein the EGFR inhibitor is selected from cetuximab, matuzumab, necitumumab, nimotuzumab, panitumumab, and zalutumumab.

4. The method of any one of claims 1 to 3, wherein the EGFR inhibitor is cetuximab.

5. The method of claim 1, wherein the EGFR inhibitor is a small molecule inhibitor.

6. The method of claim 1 or 5, wherein the EGFR inhibitor is selected from afatinib, brigatinib, dacomitinib, erlotinib, gefitinib, icotinib, lapatinib, mobocertinib, neratinib, osimertinib, and vandetanib.

7. The method of any one of claims 1 to 6, wherein the G12D inhibitor has an IC50 of about 100 nM or lower.

8. The method of any one of claims 1 to 7, wherein the G12D inhibitor is selective for inhibiting G12D versus wild-type KRAS.

9. The method of any one of claims 1 to 8, wherein the KRAS G12D inhibitor is a compound of Formula I:I or a pharmaceutically acceptable salt thereof, wherein:Y is N or OR6;R1is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa1; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;R2is selected from H, C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, and ORa2; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 or 2 substituents independently selected from Rg;Cy1is selected from C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl and 6-10 membered heteroaryl; wherein the 4-10 membered heterocycloalkyl and 6-10 membered heteroaryl each has at least one ring-forming carbon atom and 1 , 2, 3, or 4 ringforming heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of 6-10 membered heteroaryl and 4-10 membered heterocycloalkyl is optionally substituted by oxo to form a carbonyl group; and wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 , 2, 3, or 4 substituents independently selected from R10;R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-ecycloalkyl-Ciw alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, ORf3, C(O)NRc3Rd3, NRc3Rj3, and NRc3C(O)Rb3; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;R5is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa5; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;R6is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-9 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-ecycloalkyl-Ciw alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, D, CN, ORa6, and C(O)NRc6Rd6; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-9 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene are each optionally substituted with 1 or 2 substituents independently selected from R60;R7is selected from H, C1-3 alkyl, C1-3 haloalkyl, cyclopropyl, halo, D, CN, and ORa7; wherein said C1-3 alkyl and cyclopropyl are each optionally substituted with 1 or 2 substituents independently selected from Rg;Cy2is selected from(R2°)n and -Cy2-b wherein n is 0, 1 , or 2; each R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa1°, C(O)Rb1°, C(O)NRc10Rd1°, C(O)ORa1°, NRc10Rd1°, and S(O)2Rb1°; each R20is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa20; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)Rb3°, C(O)NRc30Rd3°, C(O)ORa3°, NRc30Rd3°, and S(O)2Rb30; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa31, C(O)Rb31, C(O)NRc31Rd31, C(O)ORa31, NRc31Rd31, and S(O)2Rb31; each R33is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4- membered heterocycloalkyl, 6-membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)NRc30Rd3°, and NRc30Rd3°; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-membered heterocycloalkyl, 6-membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb6°; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa61, and NRc61Rd61;Ra1is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;each Rb3, Rc3and Rd3is independently selected from H, C1-3 alkyl, Ci-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said , C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rd3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R30;Rj3is selected from C1-3 alkyl, Ci-s haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said , C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rj3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R30;Rf3is selected from Ci-s haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; orRf3is selected fromwherein Rxis H or C1-2 alkyl and Ryis C1-2 alkyl; or Rxand Ry, together with the C atom to which they are attached, form a 3-, or 4- membered cycloalkyl group;Ra5is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6, Rc6and Rd6is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60;Ra7is selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra1°, Rb1°, Rc1° and Rd1° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;Rb2° is selected from NH2, C1-3 alkyl, and Ci-3 haloalkyl; each Ra3°, Rb3°, Rc3° and Rd3° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra31, Rb31, Rc31and Rd31is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61; and each Ra61, Rc61, and Rd61, is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; and each Rgis independently selected from D, OH, CN, halo, C1-3 alkyl, C1-3 haloalkyl, Cis alkoxy, C1-3 haloalkoxy, amino, C1-3 alkylamino, and di(Ci-3 alkyl)amino.

10. The method of claim 9, whereinY is CR6;R1is selected from H, C1-3 alkyl, and C1-3 haloalkyl;R2is selected from H, C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa2; wherein said C1-3 alkyl is optionally substituted with 1 or 2 substituents independently selected from Rg;Cy1is selected from C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl; wherein the 4-10 membered heterocycloalkyl and 6-10 membered heteroaryl each has at least one ring-forming carbon atom and 1 , 2, 3, or 4 ringforming heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of 6-10 membered heteroaryl and 4-10 membered heterocycloalkyl is optionally substituted by oxo to form a carbonyl group; and wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 , 2, 3, or 4 substituents independently selected from R10;R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, C(O)NRc3Rd3, and NRc3C(O)Rb3; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;R5is selected from H, C1-3 alkyl, C1-3 haloalkyl, and halo;R6is selected from H, C1-3 haloalkyl, C3-6 cycloalkyl, 4-8 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa6, and C(O)NRc6Rd6; wherein said C3-6 cycloalkyl, 4-8 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60;R7is selected from H, C1-3 alkyl, C1-3 haloalkyl, halo, and CN;Cy2is selected fromCy2-a Cy2-b wherein n is 0, 1 , or 2; each R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa1°, C(O)Rb1°, C(O)NRc10Rd1°, C(O)ORa1°, NRc10Rd1°, and S(O)2Rb1°; each R20is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa20; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa3°, C(O)Rb3°, C(O)NRc30Rd3°, C(O)ORa3°, NRc30Rd3°, and S(O)2Rb3°; wherein said C1-3 alkyl, C3-6 cycloalkyl,4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa31, C(O)Rb31, C(O)NRc31Rd31, C(O)ORa31, NRc31Rd31, and S(O)2Rb31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb6°; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, ORa61, and NRc61Rd61; each Ra2is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Rb3, Rc3and Rd3is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said , C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 memberedheteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30; or Rc3and Rd3attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted withI , 2, or 3 substituents independently selected from R30; each Ra6, Rc6and Rd6is independently selected from H, C1-3 alkyl, Ci-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60; each Ra1°, Rb1°, Rc1° and Rd1° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;Rb2° is selected from NH2, C1-3 alkyl, and C1-3 haloalkyl; each Ra3°, Rb3°, Rc3° and Rd3° is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra31, Rb31, Rc31and Rd31is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61; and each Ra61, Rc61, and Rd61, is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; and each Rgis independently selected from D, CN, halo, C1-3 alkyl, and C1-3 haloalkyl.I I . The method of claim 9 or 10, whereinY is CR6;R1is H;R2is selected from C1-3 alkyl, C1-3 haloalkyl, halo, CN, and -CH2CH2CN;Cy1is selected from C3-10 cycloalkyl, Ce- aryl and 6-10 membered heteroaryl; wherein the 6-10 membered heteroaryl has at least one ring-forming carbon atom and 1 , ring-forming heteroatoms independently selected from N and S; and wherein the C3-10cycloalkyl, Ce- aryl and 6-10 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R10;R3is selected from H, C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R30;R5is selected from H and halo;R6is selected from H, C1-3 haloalkyl, 4-8 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said 4-8 membered heterocycloalkyl and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R60; orR7is halo;Cy2iseach R10is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, D, CN, and ORa1°; each R30is independently selected from C1-3 alkyl, C1-3 haloalkyl, 4-6 membered heterocycloalkyl, halo, D, CN, ORa3°, C(O)NRc30Rd3°, and NRc30Rd3°; wherein said C1-3 alkyl and 4-6 membered heterocycloalkyl are each optionally substituted with 1 or 2 substituents independently selected from R31; each R31is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, CN, ORa31, and NRc31Rd31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, D, CN, ORa6°, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, NRc60Rd6°, NRc60S(O)2Rb6°, and S(O)2Rb60; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from C1-3 alkyl, C1-3 haloalkyl, halo, and CN; each Ra1° is independently selected from H and C1-3 alkyl; each Ra3°, Rc3° and Rd3° is independently selected from H and C1-3 alkyl; each Ra31, Rc31and Rd31is independently selected from H and C1-3 alkyl; each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl;wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc60and Rd60attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61.

12. The method of any one of claims 9 to 11 , whereinY is CR6;R1is H;R2is -CH2CH2CN;Cy1is phenyl; wherein the phenyl is optionally substituted with 1 or 2 substituents independently selected from R10;R3is selected from H, C1-3 alkyl, phenyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2 or 3 substituents independently selected from R30;R5is selected from H and halo;R6is selected from 4-8 membered heterocycloalkyl; wherein said 4-8 membered heterocycloalkyl is optionally substituted with 1 or 2 substituents independently selected from R60; orR6is selected from C1-3 alkyl; wherein said C1-3 alkyl is substituted with 1 or 2 substituents independently selected from R60;R7is halo;Cy2iseach R10is independently selected from C1-3 alkyl and halo; each R30is independently selected from C1-3 alkyl, halo, D, OH, and C(O)NRc30Rd3°; wherein said C1-3 alkyl is optionally substituted with 1 substituent independently selected from R31; each R31is ORa31; each R60is independently selected from C1-3 alkyl, C1-3 haloalkoxy, 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, halo, C(O)Rb6°, C(O)NRc60Rd6°, NRc60C(O)Rb6°, C(O)ORa6°, NRc60C(O)ORa6°, and NRc60S(O)2Rb60; wherein said C1-3 alkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61;each R61is independently selected from C1-3 alkyl, and halo; each Rc30and Rd3° is independently selected from H and C1-3 alkyl; each Ra31is independently selected from H and C1-3 alkyl; and each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl; wherein said C1-3 alkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 or 2 substituents independently selected from R61.

13. The method of any one of claims 9 to 12, whereinY is CR6;R1is H;R2is -CH2CH2CN;Cy1is phenyl; wherein the phenyl is optionally substituted with 1 or 2 substituents independently selected from R10;R3is selected from H, methyl, ethyl, phenyl, 1 ,2,4-triazolyl, pyrazyl, and pyridyl; wherein said methyl, phenyl, 1 ,2,4-triazolyl, pyrazyl, and pyridyl are each optionally substituted with 1 , 2 or 3 substituents independently selected from R30;R5is selected from H and chloro;R6is selected from pyrrolidinyl, 2-azabicyclo[3.1.0]hexanyl, 2- azabicyclo[2.2.1]heptanyl, and 5-oxo-1 ,2,3,5-tetrahydroindolizin-3-yl; wherein said pyrrolidinyl, 2-azabicyclo[3.1.0]hexanyl, 2-azabicyclo[2.2.1]heptanyl ,and 5-oxo-1 , 2,3,5- tetrahydroindolizin-3-yl are optionally substituted with 1 or 2 substituents independently selected from R60;R7is fluoro;Cy2iseach R10is independently selected from methyl, fluoro, and chloro; each R30is independently selected from methyl, fluoro, OH, D, and C(O)NRc30Rd3°; wherein said methyl is optionally substituted with 1 substituent that is R31; each R31is ORa31;each R60is independently selected from methyl, fluoro, C1-2 haloalkoxy, 3- oxomorpholinyl, 2-oxopyrazin-1(2H)-yl), C(O)Rb60, C(O)NRc60Rd60, NRc60C(O)Rb60, C(O)ORa6°, NRc60C(O)ORa6°, and NRc60S(O)2Rb6°; wherein said 3-oxomorpholinyl, and 2- oxopyrazin-1(2 / 7)-yl) are each optionally substituted with 1 or 2 substituents independently selected from R61; each R61is independently selected from methyl and fluoro; each Rc30and Rd3° is independently selected from H and methyl; each Ra31is independently selected from H and methyl; and each Ra6°, Rb6°, Rc6° and Rd6° is independently selected from H, C1-2 alkyl, Ci haloalkyl, cyclopropyl, tetrahydrofuranyl, and thiazolyl; wherein said C1-2 alkyl, cyclopropyl, tetrahydrofuranyl, and thiazolyl are each optionally substituted with 1 or 2 substituents independently selected from R61; or any Rc6° and Rd6° attached to the same N atom, together with the N atom to which they are attached, form an azetidinyl group optionally substituted with 1 or 2 substituents independently selected from R61.

14. The method of any one of claims 9 to 13, wherein the compound of Formula I is a compound of Formula II:or a pharmaceutically acceptable salt thereof.

15. The method of any one of claims 9 to 14, wherein the compound of Formula I is a compound of Formula III:III or a pharmaceutically acceptable salt thereof. no16. The method of any one of claims 1 to 15, wherein the KRAS G12D inhibitor is selected from3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(7-chloro-3-hydroxynaphthalen-1- yl)-6-fluoro-2-methyl-4-(1 H-1 ,2,4-triazol-1-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(5,7-difluoro-1 H-indol-3-yl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(6-fluoro-5-methyl-1 / 7- indol-3-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(2-(3-(Azetidin-1-yl)-3-oxopropyl)-1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (2,3-dichlorophenyl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-((1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-8-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)methyl)oxazolidin-2-one;8-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-2,8-dimethyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1 -naphthonitrile;1-((2S,4S)-1-Acetyl-2-(cyanomethyl)piperidin-4-yl)-7-(8-cyanonaphthalen-1-yl)-6- fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinoline-8-carbonitrile;8-(1-((7R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-8-methyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-2-((3-oxomorpholino)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1- naphthonitrile;3-(7-(Benzo[b]thiophen-3-yl)-1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-((7R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-4-(((S)-1-(dimethylamino)propan-2- yl)oxy)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;8-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-2-methyl- 4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-4-((3- fluoro-1-methylazetidin-3-yl)methoxy)-7-(3-hydroxynaphthalen-1-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)- / V, / V-dimethylpropanamide;Ill3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-2-methyl-4-(5-methylpyrazin-2-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-methyl-2-((4-methyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-4- ethoxy-6-fluoro-2-((4-isopropyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-4-(3-(dimethylamino)-3- methylazetidin-1-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((3-oxomorpholino)methyl)-1 / 7- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-4-ethoxy-6-fluoro-7-(3- hydroxynaphthalen-1-yl)-2-(1-(3-oxomorpholino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((endo)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1-yl)-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-(pyridin-3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (7,8-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (6,7-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;1-(1-((2S,4S)-1-Acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)isoquinoline-8-carbonitrile;8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)-1 -naphthonitrile;3-(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-(1 / 7-1,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;(2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-A / , A / - dimethylpyrrolidine-1 -carboxamide; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3- methylphenyl)-8-(2-cyanoethyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Methyl (1S,3R,5S)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-(5-oxo-1 ,2,3,5-tetrahydroindolizin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2-c] quinolin-2- yl)pyrrolidine-1 -carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3-fluorophenyl)-2-((R)-1- (cyclopropanecarbonyl)pyrrolidin-2-yl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;8-(2-((R)-1-Acetylpyrrolidin-2-yl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6- fluoro-8-methyl-4-(2-methylpyridin-4-yl)-1 H-pyrrolo[3,2-c]quinolin-7-yl)-1 , 2,3,4- tetrahydronaphthalene-1-carbonitrile;5-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-8-(2- cyanoethyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;Methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(5-fluoro-6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Ethyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-4-(methyl-d3)-1 H-pyrrolo[3,2-c]quinolin- 8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;5-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-7-(7- fluoronaphthalen-1-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;Methyl (1 R,3R,5R)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6- (2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1 (2 / 7)-yl)ethyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;Methyl (2R,4S)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-4-fluoropyrrolidine-1 -carboxylate;Methyl (2R,5R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-5-methylpyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-3-chloro-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7- pyrrolo[3,2-c]quinolin-2-yl)pyrrolidine-1-carboxylate;4-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2 / - / )-yl)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-4- yl)-2-fluoro- / V-methylbenzamide;Methyl ((1R)-1-(1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)carbamate; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide;(2S)- / V-((1 / ?)-1-(1-((1 / ?,4 / ?,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)tetrahydrofuran-2- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)ethyl)cyclopropanesulfonamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)thiazole-4- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)- / \ / - methylcyclopropanecarboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- methylcyclopropane-1-carboxamide;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1- hydroxyethyl)-2-((1R,3R,5 / ?)-2-(1-methylcyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan- 3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3R,5R)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-(1- hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3R,5R)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-methyl- 1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclopropane-1-carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclobutane-1 -carboxamide;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-2-(1- (2,6-dimethyl-3-oxo-2,3-dihydropyridazin-4-yl)ethyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyrimidine-4- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyridazine-3- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-3,3-difluoroazetidine- 1 -carboxamide;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-((R)-1-((1-methyl-1 / 7-pyrazol-4-yl)amino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;5-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(1-fluorocyclopropane-1-carbonyl)pyrrolidin-2-yl)-1 / 7- pyrrolo[3,2-c]quinolin-4-yl)-N,N-dimethylpicolinamide; and methyl (2R)-2-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(4-((dimethylamino)methyl)-2,3-difluorophenyl)-6-fluoro-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate; and pharmaceutically acceptable salts thereof.

17. The method of any one of claims 1 to 16, wherein the KRAS G12D inhibitor is 3-(1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

18. The method of any one of claims 1 to 17, wherein the KRAS G12D inhibitor is 3-(1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

19. The method of any one of claims 1 to 18, wherein the KRAS G12D inhibitor is 3- ((F?a)-1-((1F?,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

20. The method of any one of claims 1 to 18, wherein the KRAS G12D inhibitor is 3- ((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

21. The method of any one of claims 1 to 8, wherein the KRAS G12D inhibitor is a compound of Formula IV:or a pharmaceutically acceptable salt thereof, wherein:Gy1is phenyl optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, OH, C1-3 alkoxy, and C1-3 haloalkoxy;R1is halogen;R2is selected from H, D, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-5 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, Cs-e cycloalkyl- C1-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3 alkylene, phenyl-Ci-3 alkylene, 5-6 membered heteroaryl-Ci-3 alkylene, halo, CN, ORa2, C(O)Rb2, C(O)NRc2Rd2, NRc2Re2, and NRc2C(O)Rb2; wherein the C3-5 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, 4-6 membered heterocycloalkyl-Ci-3alkylene, phenyl-Ci-3 alkylene, and 5-6 membered heteroaryl-Ci-3 alkylene forming R2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, and 4-6 membered heterocycloalkyl-Ci-3 alkylene forming R2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl, 5-6 membered heteroaryl, C3-6 cycloalkyl-Ci-3 alkylene, and 4-6 membered heterocycloalkyl-Ci-3 alkylene forming R2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each Ra2is independently selected from C1-6 alkyl, C2-6 alkenyl, C2-6 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl forming Ra2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Ra2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Ra2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-6 alkyl, C2-6 alkenyl, and C2-6 alkynyl forming Ra2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each Rb2, Rc2, and Rd2is independently selected from H, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Rb2, Rc2, and Rd2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming Rb2, Rc2, and Rd2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; or any Rc2and Rd2attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R2B;each Re2is independently selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl; wherein the C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl and 5-6 membered heteroaryl forming Re2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2A; wherein the ring-forming atoms of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Re2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-6 membered heterocycloalkyl and 5-6 membered heteroaryl forming Re2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl, forming Re2are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; orRc2and Re2attached to the same N atom, together with the N atom to which they are attached, form a 4-, 5-, or 6-membered heterocycloalkyl group optionally substituted with 1 , 2, or 3 substituents independently selected from R2B; each R2Ais independently selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, and R2B, wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl, forming R2Aare each optionally substituted with 1 , 2 or 3 substituents independently selected from R2B; each R2Bis independently selected from C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa2B, C(O)Rb2B, C(O)NRc2BRd2B, C(O)ORa2B, NRc2BRd2B, and S(O)2Rb2B; wherein the C1.3 alkyl, C3-6cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, and 5-6 membered heteroaryl are each optionally substituted with 1 , 2, or 3 substituents independently selected from R2C; each R2Cis independently selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C1-3 haloalkyl, C3-6 cycloalkyl, 4-6 membered heterocycloalkyl, phenyl, 5-6 membered heteroaryl, halo, D, CN, ORa2C, C(O)Rb2C, C(O)NRc2CRd2C, C(O)ORa2C, NRc2CRd2C, and S(O)2Rb2C; each Ra2B, Rb2B, Rc2Band Rd2Bis independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; each Ra2C, Rb2C, Rc2Cand Rd2Cis independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;R3is selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, 5-10 membered heteroaryl, OR3A, and NR3BR3C; wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl C1-3 alkyl forming R3are each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl or 5-10 membered heteroaryl forming R3isoptionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3are each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;R3Ais selected from C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, and 5-10 membered heteroaryl; wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl C1-3 alkyl forming R3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Aconsist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl or 5-10 membered heteroaryl forming R3Ais optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;R3Bis selected from H, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce-w aryl, and 5-10 membered heteroaryl; wherein the C3-10 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl forming R3Bare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3D; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Bconsist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming R3Bis optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Bare each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E;R3Band R3C, together with the N atom to which they are both attached, optionally form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group that is optionally substituted with 1 , 2, or 3 substituents independently selected from independently selected from R3D;R3Cis selected from H, C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl; wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Care each optionally substituted with 1 , 2, or 3 substituents independently selected from R3E; each R3Dis independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, and R3E; wherein each of the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming R3Dis optionally substituted with 1 , 2, or 3 substituents independently selected from R3E; each R3Eis independently selected from D, halo, CN, ORa3, SRa3, C(O)Rb3, C(O)NRc3Rd3, C(O)ORa3, OC(O)Rb3, OC(O)NRc3Rd3, NRc3Rd3, NRc3C(O)Rb3,NRc3C(O)NRc3Rd3, NRc3C(O)ORa3, C(=NRe3)NRc3Rd3, NRc3C(=NRe3)NRc3Rd3, S(O)Rb3, S(O)NRc3Rd3, S(O)2Rb3, NRc3S(O)2Rb3, and S(O)2NRc3Rd3;Ra3, Rb3, Rc3, and Rd3are each independently selected from H, C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, Ce- aryl, C3-7 cycloalkyl, 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, Ce- ary l-C 1-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3are each optionally substituted with 1 , 2, 3, 4, or 5 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3alkynyl, halo, CN, ORa3A, SRa3A, C(O)Rb3A, C(O)NRc3ARd3A, C(O)ORa3A, OC(O)Rb3A, OC(O)NRc3ARd3A, NRc3ARd3A, NRc3AC(O)Rb3A, NRc3AC(O)NRc3ARd3A, NRc3AC(O)ORa3A, C(=NRe3A)NRc3ARd3A, NRc3AC(=NRe3A)NRc3ARd3A, S(O)Rb3A, S(O)NRc3ARd3A, S(O)2Rb3A, NRc3AS(O)2Rb3A, and S(O)2NRc3ARd3A; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3, Rb3, Rc3, and Rd3is optionally substituted by oxo to form a carbonyl group; orRc3and Rd3attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5-membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORa3A, SRa3A, C(O)Rb3A, C(O)NRc3ARd3A, C(O)ORa3A, OC(O)Rb3A, OC(O)NRc3ARd3A, NRc3ARd3A, NRc3AC(O)Rb3A, NRc3AC(O)NRc3ARd3A, NRc3AC(O)ORa3A, C(=NRe3A)NRc3ARd3A, NRc3AC(=NRe3A)NRc3ARd3A, S(O)Rb3A, S(O)NRc3ARd3A, S(O)2Rb3A, NRc3AS(O)2Rb3A, and S(O)2NRc3ARd3A;Ra3A, Rb3A, Rc3A, and Rd3Aare each independently selected from H, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, aryl, Ce- aryl-Ci-s alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the C1-6 alkyl, C1-6 haloalkyl, C2-6 alkenyl, C2-6 alkynyl Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Aare each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-6 alkyl, C1-6 alkoxy, C1-6 haloalkyl, and C1-6 haloalkoxy; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Aconsist of at least one carbon atom, and 1 , 2, 3, or 4 heteroatoms selected from O, N, and S; and wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming Ra3A, Rb3A, Rc3A, and Rd3Ais optionally substituted by oxo to form a carbonyl group; orRc3Aand Rd3Aattached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5-membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-6 alkyl, C1-6 alkoxy, C1-6 haloalkyl, and C1-6 haloalkoxy; Re3, and Re3Aare each, independently, H, CN or NO2; each R4is independently selected from H, D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, and ORa4; each Ra4is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, ORa5, C1-3 haloalkyl, C2-3 alkenyl, and C2-3 alkynyl; or, optionally, two other R5attached to the same carbon atom, together with the carbon atom to which they are both attached, form a spiro C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo;R5Ais H, D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, ORa5A, CN, or Cy2; wherein the C1-3 alkyl forming R5Ais optionally substituted with 1 , 2, 3 or 4 substituents each selected from R5Band also optionally substituted with Cy2, or, optionally, R5Aand R5attached to the same carbon atom, together with the carbon atom to which they are both attached, form a spiro C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; or, optionally, R5Aand R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 , 2, 3, or 4 substituents each selected from D, C1-3 alkyl, and halo; each R5Bis independently selected from D and halo; each Ra5is independently selected from H, C1-3 alkyl, and C1-3 haloalkyl;Ra5Ais selected from H, C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, 3 or 4 substituents each selected from R5Band also optionally substituted with Cy2;Cy2is selected from C3-7 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl; wherein the C3-7 cycloalkyl, 4-10 membered heterocycloalkyl,Ce- aryl, 5-10 membered heteroaryl, Ce- aryl, and 5-10 membered heteroaryl forming Cy2is optionally substituted with 1 , 2, 3, or 4 substituents independently selected from RCy2; wherein the ring-forming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming Cy2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 4- 10 membered heterocycloalkyl and 5-10 membered heteroaryl forming Cy2is optionally substituted by oxo to form a carbonyl group; each RCy2is independently selected from D, C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, 5-10 membered heteroaryl, halo, CN, ORaCy21, SRaCy21, C(O)RbCy21, C(O)NRcCy21RdCy21, C(O)ORaCy21,OC(O)RbCy21, OC(O)NRcCy21RdCy21, NRcCy21RdCy21, NRcCy21C(O)RbCy21,NRcCy21c(O)NRcCy21RdCy21, NRcCy21C(O)ORaCy21, C(=NReCy21)NRcCy21RdCy21,NRcCy21C(=NReCy21)NRcCy21RdCy21, S(O)RbCy21, S(O)NRcCy21RdCy21, S(O)2RbCy21,NRcCy2is(O)2RbCy21, and S(O)2NRcCy21RdCy21; wherein the C3-6 cycloalkyl, 4-10 membered heterocycloalkyl, Ce- aryl, and 5-10 membered heteroaryl forming RCy2are each optionally substituted by 1 , 2, 3, or 4 substituents independently selected from RCy2A; wherein the ringforming atoms of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming RCy2consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; wherein a ring-forming carbon atom of the 4-10 membered heterocycloalkyl and 5-10 membered heteroaryl forming RCy2is optionally substituted by oxo to form a carbonyl group; and wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming RCy2are each optionally substituted by 1 , 2, or 3 substituents independently selected from RCy2B. each RCy2Ais independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, and RCy2B; wherein the C1-3 alkyl, C2-3 alkenyl, and C2-3 alkynyl forming RCy2Aare each optionally substituted by 1 , 2, or 3 substituents independently selected from R0''26, each R0''26is independently selected from D, halo, CN, ORaCy21, SRaCy21, C(O)RbCy21,C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, Ce- aryl, C3-7 cycloalkyl, 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, Ce-w aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCy21, RCCY2Ianc| Rdcy2iare eac|1optionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN, ORaCy22, SRaCy22, C(O)RbCy22,C(O)NRcCy22RdCy22, C(O)ORaCy22, OC(O)RbCy22, OC(O)NRcCy22RdCy22, NRcCy22RdCy22,NRcCy22C(O)RbCy22, NRcCy22C(O)NRcCy22RdCy22, NRcCy22C(O)ORaCy22, C(=NReCy22)NRcCy22RdCy22,NRcCy22C(=NReCy22)NRcCy22RdCy22, S(O)RbCy22, S(O)NRcCy22RdCy22, S(O)2RbCy22,NRcCy22s(O)2RbCy22, and S(O)2NRcCy22RdCy22; wherein the ring-forming atoms each of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCv21, RCCY2I ,anc| Rdcy2i consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy21, RbCv21, RCCY2I ,anc| Rdcy2i jSoptionally substituted by oxo to form a carbonyl group; or RcCy21and RdCy21attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5- membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from C1-3 alkyl, C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, halo, CN,C1-3 haloalkyl, C2-3 alkenyl, C2-3 alkynyl, aryl, Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl- C1-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl; wherein the C1-3 alkyl, C2-3 alkenyl, C2-3 alkynyl, Ce- aryl-Ci-3 alkyl, 5-10 membered heteroaryl-Ci-3 alkyl, C3-7 cycloalkyl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCy22, Rccy22anc| Rdcy22aregg^ optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, N H(CI-3 alkyl), N(CI-3 alkyl)2, halo, C1-3 alkyl, C1-3 alkoxy, C1-3 haloalkyl, and C1-3 haloalkoxy; wherein the ring-forming atoms each of the 5- 10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCv22, RCCY22,anc| RdcY22 consist of at least one carbon atom and 1 , 2, 3, or 4 heteroatoms independently selected from N, O, and S; and wherein a ring-forming carbon atom of the 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl-Ci-3 alkyl, and 4-10 membered heterocycloalkyl-Ci-3 alkyl forming RaCy22, RbCy22, RCCY22,anc| Rdcy22 jSoptionally substituted by oxo to form a carbonyl group; orRcCy22and RdCy22attached to the same N atom, together with the N atom to which they are both attached, form a 4-, 5-, 6-, or 7-membered heterocycloalkyl group or 5- membered heteroaryl group, each optionally substituted with 1 , 2, or 3 substituents independently selected from OH, CN, amino, NH(CI-6 alkyl), N(CI-6 alkyl)2, halo, C1-3 alkyl, C1-3 alkoxy, C1-3 haloalkyl, and C1-3 haloalkoxy; andReCy21and ReCy22are each, independently, H, CN or NO2.

22. The method of any one of claims 1 to 8 and 21 , whereinCy1is phenyl optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;R1is halo;R2is C1-3 alkyl optionally substituted with OH;R3is C3-10 cycloalkyl optionally substituted with halo; each R4is H; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, and halo; andR5Ais H, halo, or ORa5A;Ra5Ais selected from C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D, and also optionally substituted with Cy2; and Cy2is selected from Ce-io aryl and 5-10 membered heteroaryl.

23. The method of any one of claims 1 to 8, 21 , and 22, whereinCy1is phenyl optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;R1is halo;R2is C1-3 alkyl optionally substituted with OH;R3is OR3Aor C3-10 cycloalkyl optionally substituted with halo;R3Ais C1-3 alkyl; each R4is H; one R5is R5A; and each other R5is independently selected from H, D, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl; or, optionally, two other R5attached to adjacent carbon atoms, together with the carbon atoms to which they are each attached, form a fused C3-6 cycloalkyl ring that is optionally substituted with 1 or 2 substituents each selected from D, C1-3 alkyl, and halo;R5Ais H, halo, or ORa5A;Ra5Ais selected from C1-3 alkyl, C1-3 haloalkyl, and Cy2, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D, and also optionally substituted with Cy2; andCy2is selected from Ce-io aryl and 5-10 membered heteroaryl.

24. The method of any one of claims 1 to 8 and 21 to 23, whereinCy1is phenyl optionally substituted with 1 or 2 substituents each selected from C1-3 alkyl, C1-3 haloalkyl, halo, OH, and C1-3 alkoxy;R1is halo;R2is C1-3 alkyl optionally substituted with OH;R3is OR3Aor C3-10 cycloalkyl optionally substituted with halo;R3Ais C1-3 alkyl; each R4is H; one R5is R5A; and each other R5is independently selected from H, halo, C1-3 alkyl, OC1-3 alkyl, C1-3 haloalkyl;R5Ais H, halo, or ORa5A; andRa5Ais selected from C1-3 alkyl and C1-3 haloalkyl, wherein the C1-3 alkyl forming Ra5Ais optionally substituted with 1 , 2, or 3 D.

25. The method of any one of claims 1 to 8 and 21 to 24, wherein the compound of Formula IV is a compound of Formula IV-A or Formula IV-B:or a pharmaceutically acceptable salt thereof.

26. The method of any one of claims 1 to 8 and 21 to 25, wherein the compound of Formula IV is selected from3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-methoxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-fluoro-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(6-(cyclopropanecarbonyl)-6- azatricyclo[3.2.1 ,02,4]octan-7-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(methoxy-d3)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-3-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(2-(5-(benzyloxy)-2-(cyclopropanecarbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-1-(2- azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(5-fluoro-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-4-((R)-1-hydroxyethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(difluoromethyl)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;5-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-4-yl)- N,N-dimethylpicolinamide;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2- yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;4-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-2-(2-(cyclopropanecarbonyl)-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-4-yl)- 2-fluoro-N-methylbenzamide;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-methyl-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-hydroxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-2-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-(pyridin-4-yloxy)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(5-fluoro-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-4-(1-hydroxyethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(5-chloro-2-(1-fluorocyclopropane-1-carbonyl)- 2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5- (trifluoromethoxy)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-2-(2-(cyclopropanecarbonyl)-5-cyclopropoxy-2- azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethoxy)-2- (1 -fluorocyclopropane- 1 -carbonyl)-2-azabicyclo[2.2.1 ]heptan-3-yl)-6-fluoro-4-(1 - hydroxyethyl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1 -(2-azabicyclo[2.1.1]hexan-5-yl)-2-(5-cyclopropoxy-2-(1-fluorocyclopropane-1- carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)- 1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;methyl 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-2-yl)-5-(trifluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate;3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2-(2-(1- fluorocyclopropane- 1-carbonyl)-5-(trifluoromethoxy)-2-azabicyclo[2.2.1 ]heptan-3-yl)-4- methyl-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; methyl 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)- 6-fluoro-4-methyl-1H-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethyl)-2- azabicyclo[2.2.1]heptane-2-carboxylate; and 3-(1-(2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-(5-(difluoromethyl)-2-(1- fluorocyclopropane-1-carbonyl)-2-azabicyclo[2.2.1]heptan-3-yl)-6-fluoro-4-methyl-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; and pharmaceutically acceptable salts thereof.

27. The method of any one of claims 1 to 8 and 21 to 26, wherein the compound of Formula IV is methyl (1R,3R,4R,5S)-3-(1-((1R,4F?,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5- (difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate, or a pharmaceutically acceptable salt thereof.

28. The method of any one of claims 1 to 27, wherein the KRAS G12D inhibitor is administered to the subject in a pharmaceutical composition comprising the KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

29. The method of any one of claims 1 to 28, wherein the EGFR inhibitor is administered to the subject in a pharmaceutical composition comprising the EGFR inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

30. A method of treating cancer in a subject in need thereof comprising administering to the subject: a pharmaceutical composition comprising a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient; and a pharmaceutical composition comprising an EGFR inhibitor, or pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable carrier or excipient.

31. A method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2- ((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

32. The method of claim 31, wherein the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

33. The method of claim 31 or 32, wherein the KRAS G12D inhibitor is 3-((Ra)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

34. The method of claim 31 or 32, wherein the KRAS G12D inhibitor is 3-((Sa)-1- ((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

35. A method of treating cancer in a subject in need thereof comprising administering to the subject a KRAS G12D inhibitor that is methyl (1R,3R,4R,5S)-3-(1-((1R,4R,5S)-2- azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7- pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2-azabicyclo[2.2.1]heptane-2-carboxylate, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor that is cetuximab.

36. The method of any one of claims 1 to 35, wherein the KRAS G12D inhibitor is administered twice daily (BID).

37. The method of any one of claims 1 to 35, wherein the KRAS G12D inhibitor is administered once daily (QD).

38. The method of any one of claims 1 to 37, wherein the KRAS G12D inhibitor is administered orally (PO).

39. The method of any one of claims 1 to 38, wherein the EGFR inhibitor is administered twice a week (BIW).

40. The method of any one of claims 1 to 39, wherein the EGFR inhibitor is administered as an intravenous injection (IV).

41. The method of any one of claims 1 to 40, wherein the cancer is selected from carcinomas, hematological cancers, sarcomas, and glioblastoma.

42. The method of any one of claims 1 to 41 , wherein the cancer is a cancer comprising abnormally proliferating cells having a KRAS G12D mutation.

43. The method of any one of claims 1 to 41 , wherein the method further comprises identifying that abnormally proliferating cells of the cancer comprise a KRAS G12D mutation.

44. The method of any one of claims 41 to 43, wherein the cancer is a hematological cancer selected from myeloproliferative neoplasms, myelodysplastic syndrome, chronic and juvenile myelomonocytic leukemia, acute myeloid leukemia, acute lymphocytic leukemia, and multiple myeloma.

45. The method of any one of claims 41 to 43, wherein the cancer is a carcinoma selected from pancreatic, colorectal, lung, bladder, gastric, esophageal, breast, head and neck, cervical, skin, and thyroid carcinomas.

46. The method of claim 45, wherein the carcinoma is colorectal carcinoma.

47. The method of claim 45, wherein the carcinoma is lung carcinoma.

48. The method of claim 45, wherein the carcinoma is pancreatic carcinoma.

49. The method of any one of claims 1 to 43, wherein the cancer is colorectal cancer.

50. The method of any one of claims 1 to 43, wherein the cancer is non-small cell lung cancer (NSCLC).

51. The method of any one of claims 1 to 43, wherein the cancer is pancreatic ductal adenocarcinoma.

52. The method of any one of claims 1 to 51, wherein the cancer is metastatic.

53. A pharmaceutical composition comprising a) a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof; b) an EGFR inhibitor, or a pharmaceutically acceptable salt thereof; andc) at least one pharmaceutically acceptable carrier or excipient.

54. The pharmaceutical composition of claim 53, wherein the KRAS G12D inhibitor is selected from3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(7-chloro-3-hydroxynaphthalen-1- yl)-6-fluoro-2-methyl-4-(1H-1 ,2,4-triazol-1-yl)-1H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(5,7-difluoro-1 H-indol-3-yl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(6-fluoro-5-methyl-1 / 7- indol-3-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(2-(3-(Azetidin-1-yl)-3-oxopropyl)-1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (2,3-dichlorophenyl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-((1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-8-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)methyl)oxazolidin-2-one;8-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-2,8-dimethyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1 -naphthonitrile;1-((2S,4S)-1-Acetyl-2-(cyanomethyl)piperidin-4-yl)-7-(8-cyanonaphthalen-1-yl)-6- fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinoline-8-carbonitrile;8-(1-((7R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-8-methyl-4-((S)-1-((S)-1- methylpyrrolidin-2-yl)ethoxy)-2-((3-oxomorpholino)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1- naphthonitrile;3-(7-(Benzo[b]thiophen-3-yl)-1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-((7R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-4-(((S)-1-(dimethylamino)propan-2- yl)oxy)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((2-oxopyrrolidin-1-yl)methyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;8-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-2-methyl- 4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-6- fluoro-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-4-((3- fluoro-1-methylazetidin-3-yl)methoxy)-7-(3-hydroxynaphthalen-1-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)- / V, / V-dimethylpropanamide;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1- yl)-2-methyl-4-(5-methylpyrazin-2-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-methyl-2-((4-methyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichloro-5-hydroxyphenyl)-4- ethoxy-6-fluoro-2-((4-isopropyl-2-oxopiperazin-1-yl)methyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-4-(3-(dimethylamino)-3- methylazetidin-1-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)-2-((3-oxomorpholino)methyl)-1 / 7- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-4-ethoxy-6-fluoro-7-(3- hydroxynaphthalen-1-yl)-2-(1-(3-oxomorpholino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((endo)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(3-hydroxynaphthalen-1-yl)-4- ((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-2-(pyridin-3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (7,8-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(2-(3-(azetidin-1-yl)-3-oxopropyl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7- (6,7-difluoronaphthalen-1-yl)-6-fluoro-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;1-(1-((2S,4S)-1-Acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)isoquinoline-8-carbonitrile;8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrrolo[3,2-c]quinolin-7-yl)-1-naphthonitrile;8-(1-((2S,4S)-1-acetyl-2-(cyanomethyl)piperidin-4-yl)-8-chloro-6-fluoro-4-((S)-1-((S)- 1-methylpyrrolidin-2-yl)ethoxy)-1 / 7-pyrazolo[4,3-c]quinolin-7-yl)-1 -naphthonitrile;3-(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-6-fluoro-7-(7-fluoro-3- hydroxynaphthalen-1-yl)-2-methyl-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 2-methyl-4-((S)-1-((S)-1-methylpyrrolidin-2-yl)ethoxy)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;(2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-A / , / V- dimethylpyrrolidine-1 -carboxamide; methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3- methylphenyl)-8-(2-cyanoethyl)-6-fluoro-4-(1 / 7-1 ,2,4-triazol-1-yl)-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Methyl (1S,3R,5S)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-(5-oxo-1 ,2,3,5-tetrahydroindolizin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2-c] quinolin-2- yl)pyrrolidine-1 -carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2-chloro-3-fluorophenyl)-2-((R)-1- (cyclopropanecarbonyl)pyrrolidin-2-yl)-6-fluoro-4-methyl-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;8-(2-((R)-1-Acetylpyrrolidin-2-yl)-1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-6- fluoro-8-methyl-4-(2-methylpyridin-4-yl)-1 H-pyrrolo[3,2-c]quinolin-7-yl)-1 , 2,3,4- tetrahydronaphthalene-1-carbonitrile;5-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-8-(2- cyanoethyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H- pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(2-oxopyrazin-1(2H)-yl)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(5-fluoro-6-(methylcarbamoyl)pyridin-3-yl)-1 H-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;Ethyl (2R)-2-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 H-pyrrolo[3,2-c]quinolin-2- yl)pyrrolidine-1 -carboxylate;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-4-(methyl-d3)-1 H-pyrrolo[3,2-c]quinolin- 8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-2-((R)-1-(3,3- difluoroazetidine-1-carbonyl)pyrrolidin-2-yl)-6-fluoro-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-6- fluoro-4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;5-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-6-fluoro-7-(7- fluoronaphthalen-1-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-4-yl)-N- methylpicolinamide;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;3-(1-((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-6-fluoro-7-(7-fluoronaphthalen-1-yl)- 4-(5-methylpyrazin-2-yl)-2-((R)-1-(3-oxomorpholino)ethyl)-1 H-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;Methyl (1 R,3R,5R)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)- 7-(2,3-dichlorophenyl)-4-(6-(dimethylcarbamoyl)pyridin-3-yl)-6-fluoro-1 H-pyrrolo[3,2- c]quinolin-2-yl)-2-azabicyclo[3.1 ,0]hexane-2-carboxylate;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6- (2-hydroxypropan-2-yl)pyridin-3-yl)-2-((R)-1-(2-oxopyrazin-1 (2 / - / )-yl)ethyl)-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile;Methyl (2R,4S)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-4-fluoropyrrolidine-1 -carboxylate;Methyl (2R,5R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)-5-methylpyrrolidine-1 -carboxylate;Methyl (2R)-2-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-3-chloro-8-(2- cyanoethyl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(6-(2-hydroxypropan-2-yl)pyridin-3-yl)-1 / 7- pyrrolo[3,2-c]quinolin-2-yl)pyrrolidine-1-carboxylate;4-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(2-oxopyrazin-1(2 / - / )-yl)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-4- yl)-2-fluoro- / V-methylbenzamide;Methyl ((1R)-1-(1-((7R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)carbamate; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-2,2-difluoroacetamide;(2S)- / V-((1 / ?)-1-(1-((1 / ?,4 / ?,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)tetrahydrofuran-2- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2- yl)ethyl)cyclopropanesulfonamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)thiazole-4- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)- / \ / - methylcyclopropanecarboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- methylcyclopropane-1-carboxamide;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-(1- hydroxyethyl)-2-((1R,3R,5R)-2-(1-methylcyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan- 3-yl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3R,5R)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-(1- hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile;3-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-2- ((1R,3R,5R)-2-(1-fluorocyclopropane-1-carbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-4-methyl- 1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-Azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclopropane-1-carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1 ,1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-(1-hydroxyethyl)-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-1- fluorocyclobutane-1 -carboxamide;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(3-chloro-2-methylphenyl)-2-(1- (2,6-dimethyl-3-oxo-2,3-dihydropyridazin-4-yl)ethyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyrimidine-4- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)pyridazine-3- carboxamide; / V-((1 R)-1 -(1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)ethyl)-3,3-difluoroazetidine- 1 -carboxamide;3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-2-((R)-1-((1-methyl-1 / 7-pyrazol-4-yl)amino)ethyl)-1 / 7-pyrrolo[3,2-c]quinolin-8- yl)propanenitrile;5-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-6-fluoro-2-((R)-1-(1-fluorocyclopropane-1-carbonyl)pyrrolidin-2-yl)-1 / 7- pyrrolo[3,2-c]quinolin-4-yl)-N,N-dimethylpicolinamide; and methyl (2R)-2-(1-((1R,4R,5S)-2-Azabicyclo[2.1.1]hexan-5-yl)-8-(2-cyanoethyl)-7-(2,3- dichlorophenyl)-4-(4-((dimethylamino)methyl)-2,3-difluorophenyl)-6-fluoro-1 / 7-pyrrolo[3,2- c]quinolin-2-yl)pyrrolidine-1 -carboxylate; and pharmaceutically acceptable salts thereof.

55. The pharmaceutical composition of claim 53 or 54, wherein the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)- 2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

56. The pharmaceutical composition of any one of claims 53 to 55, wherein the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

57. The pharmaceutical composition of any one of claims 53 to 56, wherein the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5F?)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

58. The pharmaceutical composition of any one of claims 53 to 56, wherein the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5F?)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

59. The pharmaceutical composition of claim 53, wherein the KRAS G12D inhibitor is methyl (1 R,3R,4R,5S)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1 ]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate, or a pharmaceutically acceptable salt thereof.

60. The pharmaceutical composition of any one of claims 53 to 59, wherein the EGFR inhibitor is cetuxmiab.

61. A pharmaceutical combination comprising a KRAS G12D inhibitor, or a pharmaceutically acceptable salt thereof, and an EGFR inhibitor, or pharmaceutically acceptable salt thereof.

62. The pharmaceutical combination of claim 61 , wherein the KRAS G12D inhibitor is 3- (1 -((1 R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2- azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile, or a pharmaceutically acceptable salt thereof.

63. The pharmaceutical combination of claim 61 or 62, wherein the KRAS G12D inhibitor is 3-(1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2-(cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2- c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

64. The pharmaceutical combination of any one of claims 61 to 63, wherein the KRAS G12D inhibitor is 3-((Ra)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

65. The pharmaceutical combination of any one of claims 61 to 63, wherein the KRAS G12D inhibitor is 3-((Sa)-1-((1R,4R,5S)-2-azabicyclo[2.1.1]hexan-5-yl)-2-((1R,3R,5R)-2- (cyclopropanecarbonyl)-2-azabicyclo[3.1.0]hexan-3-yl)-7-(2,3-dichlorophenyl)-6-fluoro-4- methyl-1 / 7-pyrrolo[3,2-c]quinolin-8-yl)propanenitrile hydrochloride dihydrate.

66. The pharmaceutical combination of claim 61 , wherein the KRAS G12D inhibitor is methyl (1 R,3R,4R,5S)-3-(1-((1 R,4R,5S)-2-azabicyclo[2.1.1 ]hexan-5-yl)-8-(2-cyanoethyl)-7- (2,3-dichlorophenyl)-6-fluoro-4-methyl-1 / 7-pyrrolo[3,2-c]quinolin-2-yl)-5-(difluoromethoxy)-2- azabicyclo[2.2.1]heptane-2-carboxylate, or a pharmaceutically acceptable salt thereof.

67. The pharmaceutical combination of any one of claims 61 to 66, wherein the EGFR inhibitor is cetuximab.