ANTI-PMEL17 ANTIBODIES AND THEIR CONJUGATES

MX434666BActive Publication Date: 2026-06-12NOVARTIS AG
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
MX2021007593
Authority / Receiving Office
MX · MX
Patent Type
Patents
Current Assignee / Owner
Priority Date
2019-02-08
Filing Date
2021-06-21
Publication Date
2026-06-12
Estimated Expiration
2039-12-18

AI Technical Summary

Technical Problem

Current antibody-drug conjugates (ADCs) targeting PMEL17 and GNAQ/GNA11 for cancer treatment face challenges in achieving optimal binding affinity, stability, and efficacy due to variations in target-mediated disposition, antibody-dependent cell-mediated cytotoxicity, and linker stability, necessitating improved antibodies and cytotoxic payloads.

Method used

Development of antibodies with specific CDR sequences (SEQ ID NOs) that bind to PMEL17 and GNAQ/GNA11, conjugated with cleavable and non-cleavable linkers to form ADCs, including GNAQ/GNA11 inhibitors, to enhance targeted delivery and cytotoxicity.

Benefits of technology

The ADCs demonstrate potent anti-cancer activity by selectively targeting PMEL17-expressing cancers and GNAQ/GNA11-mutated tumors, inducing apoptosis and inhibiting signaling pathways, with improved bioavailability and reduced off-target effects.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

This application describes anti-PMEL17 antibodies, antigen-binding fragments thereof, and antibody-drug conjugates of said antibodies or antigen-binding fragments conjugated to a GNAQ / GNA11 inhibitor. The invention further relates to methods for treating or preventing cancer using the antibodies, antigen-binding fragments, and antibody-drug conjugates. It also describes methods for preparing the antibodies, antigen-binding fragments, and antibody-drug conjugates, and methods for using the antibodies and antigen-binding fragments as diagnostic reagents.
Need to check novelty before this filing date? Find Prior Art

Description

ANTI-PMEL17 ANTIBODIES AND CONJUGATES THEREOF LIST OF SEQUENCES This application contains a Sequence Listing that has been submitted electronically in ASCII format which is fully incorporated by reference. Said copy in ASCII, created on December 6, 2019, is called PAT058359-WO-PCT_SL.txt and is 285,253 bytes in size. FIELD OF THE INVENTION The present invention relates generally to anti-PMEL17 antibodies, or fragments thereof, conjugates thereof, including a GNAQ / GNA11 inhibitor, conjugates thereof, and their uses for the treatment or prevention of cancer. BACKGROUND OF THE INVENTION PMEL17 (also known as gp100 and SILV) is a single-pass type I transmembrane protein produced by melanocytes and involved in melanin synthesis. Throughout its maturation, PMEL17 is transiently expressed on the cell surface before being trafficked into melanosomes, where PMEL17 is degraded into several domains that multiplies to form fibrillar sheets. Such a pattern then serves as a support for trapping melanin. PMEL17 expression in melanosomes is regulated by MITF, a lineage oncogene, and has been found to be upregulated in a variety of uveal and subcutaneous primary and metastatic melanomas. The transient cell surface expression and subsequent internalization of PMEL17 make it a suitable target to develop an antibody-drug conjugate (ADC) for the treatment of melanoma. PMEL17 and Cancer Throughout its maturation, PMEL17 is extensively processed by proprotein convertases. The protein is cleaved between V467 / K468 forming two subdomains, Μα at the N-terminus and Μβ at the C-terminus, presumably held through a disulfide bond. After leaving the Golgi apparatus, some PMEL17 molecules are transiently expressed on the cell surface. The majority of PMEL17 is then redirected to a melanocyte for further maturation, while some PMEL17 appears to be deleted. After further enzymatic cleavages, PMEL17 degrades into several domains that rearrange and form fibrillar sheets where melanin polymerizes (Valencia JC, et al. Sorting of Pme!17 to melanosomes through the plasma membrane by 1 CRC / nn / Lznz / E / Yii ΑΡ1 and ΑΡ2: evidence for the polarized nature of melanocytes. J Cell Sci. 2006 Mar 15;119(Pt 6):108091; Theos AC, et al. The Silver locus product Pmell 7 / gp100 / Silv / ME20: controversy! in name and in function. Pigment Cell Res. 2005 Oct;18(5):322-36). PMEL17 constitutes a potential therapeutic target for the treatment of melanoma. PMEL17 is a direct transcriptional target of MITF, a melanoma lineage oncogene, as observed by mRNA expression studies (Du J, et al. MLANA / MART1 and SILV / PMEL17 / GP100 are transcriptionally regulated by MITF in melanocytes and melanoma Am J Pathol. 2003 Jul;163(1):33343). PMEL17 expression is limited to the melanocyte lineage which includes skin melanocytes, hair bulb melanocytes, retinal pigment epithelium, ciliary pigment epithelium, and possibly the choroidal melanocytes in the retina. PMEL17 is also highly expressed in subcutaneous and uveal melanoma melanocyte lineage tumors. In contrast, mRNA studies have shown that PMEL17 expression is limited in other types of tumors and normal tissues. (Wagner SN, Wagner C, Schultewolter T, Goos M. Analysis of Pmel17 / gp100 expression in primary human tissue specimens: implications for melanoma immuno-and gene-therapy. Cancer Immunol Immunother. 1997 Jun;44(4):239-47 ). Furthermore, ADC and ImmTAC compounds targeting PMEL17 have previously been described to specifically induce melanoma death in vivo and in vitro and are currently being evaluated in clinical trials (Chen Y, et al. The melanosomalprotein PMEL17as a target forantibody drug conjugate therapy in melanoma. J Biol Chem. 2012 Jul 13;287(29):24082-91. doi:10.1074 / jbc.M112.361485. Epub 2012 May 21). GNAQ / GNA11 and Cancer The GNAQ and GNA11 genes encode the alpha subunit of the Gq / 11 heterotrimeric G proteins, which are expressed nearly ubiquitously and act as binary molecular switches that alternate between active guanosine triphosphate (GTP)-binding and guanosine-binding states. diphosphate (GDP) inactive. Gaq and Ga11 bound to GTP activate the β isoforms of phospholipase C, which activates a series of signal transduction pathways through the generation of second messengers IP3 and DAG. Signaling termination is triggered by GTP hydrolysis mediated by the intrinsic GTPase activity of these Ga proteins. Gq and G11 have been shown to be involved in a wide range of physiological functions, including platelet activation, myocardial hypertrophy, and smooth muscle tone. Oncogenic mutations in GNAQ or GNA11 occur in up to 90% of uveal melanoma (UM) cases and in ~2-3% of cutaneous melanoma. Approximately 95% of these mutations affect codons 209 (Q209) in the Ras-like domain, resulting in a complete or partial loss of GTPase activity and thus blocking GNAQ / 11 in its active state. Q209 GNAQ / 11 are CAC / nn / Lznz / E / Yii dominant-acting oncogenes that transform melanocytes by triggering activation of multiple pathways including PKC / MAPK, Rho / Rac, β-catenin, and YAP. Although the PKC / MAPK pathway has been shown to be a contributing factor in GNAQ-mediated oncogenesis, multiple lines of evidence suggest that mutant GNAQ / 11 governs additional pathways that may also play a role in UM tumor genesis (i.e. YAP, β-catenin). Interestingly, another somatic activating mutation in GNAQ (R183Q) has recently been described as the cause of Sturge-Weber syndrome (SWS), a neurocutaneous disorder characterized by capillary malformation (port-wine stains) and choroidal and leptomeningeal vascular malformations. Therefore, GNAQ and GNA11 constitute potential therapeutic targets for the treatment of uveal and cutaneous melanoma. Antibody Drug Conjugates Antibody-drug conjugates ("ADCs") have been used for local delivery of cytotoxic agents in the treatment of cancer (see, eg, Lambed, Curr. Opinion In Pharmacology 5:543-549, 2005). ADCs allow targeted administration of the remainder of the drug, with maximum efficacy being achieved with minimal toxicity. ADCs include an antibody selected for its ability to bind to a target cell for therapeutic intervention, linked to a drug selected for its cytostatic or cytotoxic activity. Binding of the antibody to the target cell therefore delivers the drug to the site where its therapeutic effect is needed. Many antibodies that recognize and selectively bind target cells, eg, cancer cells, have been reported for use in ADCs. Despite the extensive work on ADCs, the binding of antibodies to a particular target of interest is not sufficient to predict success in ADC applications. Examples of factors that can affect the therapeutic effectiveness of ADCs (besides the intrinsic characteristics of the target) include various aspects that need custom tuning, such as optimal antibody affinity as a balance between target-mediated disposition (TMDD) and exposure driving efficacy, assessment of Fe-mediated functions (antibody-dependent cell-mediated cytotoxicity, ADCC), method of conjugation (site-specific or not), ratio of drug / payload molecules that are conjugated to each antibody (DAR or drug-antibody ratio), the cleavability or stability of the linker, the stability of the ADC, and the tendency of an ADC to aggregate. There remains a need for antibodies, binding methods, and cytotoxic payloads with improved properties for use as effective ADC therapeutic compositions and methods. BRIEF DESCRIPTION OF THE INVENTION CRC / nn / Lznz / E / Yii In one embodiment, the present application discloses an antibody or antigen-binding fragment thereof that binds to PMEL17 comprising: to. a heavy chain variable region comprising a heavy chain CDR1 (Complementarity Determining Region 1) of SEQ ID NO: 1, 4, 5 or 7, a heavy chain CDR2 (Complementarity Determining Region 2) of SEQ ID NO: 2, 6 or 8, and a heavy chain CDR3 (Complementarity Determining Region 3) of SEQ ID NO: 3 or 9; and a light chain variable region comprising a light chain CDR1 (Complementarity Determining Region 1) of SEQ ID NO: 14, 17 or 20, a light chain CDR2 (Complementarity Determining Region 2) of SEQ ID NO: 15 or 18, and a light chain CDR3 (Complementarity Determining Region 3) of SEQ ID NO: 16 or 19; b. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 33, 36, 37 or 39, a heavy chain CDR2 of SEQ ID NO: 34, 38 or 40; a heavy chain CDR3 of SEQ ID NO: 35 or 41; a light chain CDR1 of SEQ ID NO: 46, 49 or 52; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 48 or 51; c. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 5, 7, 57 or 60, a heavy chain CDR2 of SEQ ID NO: 58, 61 or 62; a heavy chain CDR3 of SEQ ID NO: 59 or 63; a light chain CDR1 of SEQ ID NO: 68, 71 or 74; a light chain CDR2 of SEQ ID NO: 69 or 72; and a light chain CDR3 of SEQ ID NO: 70 or 73; d. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 79, 82, 83 or 85, a heavy chain CDR2 of SEQ ID NO: 80, 84 or 86; a heavy chain CDR3 of SEQ ID NO: 81 or 87; a light chain CDR1 of SEQ ID NO: 92, 95 or 98; a light chain CDR2 of SEQ ID NO: 93 or 96; and a light chain CDR3 of SEQ ID NO: 94 or 97; and. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 103,106,107 or 109, a heavy chain CDR2 of SEQ ID NO: 104,108 or 110; a heavy chain CDR3 of SEQ ID NO: 105 or 111; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 117 or 118; F. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 123,126,127 or 129, a heavy chain CDR2 of SEQ ID NO: 124,128 or 130; a heavy chain CDR3 of SEQ ID NO: 125 or 131; a string CDR1 CAC / nn / Lznz / E / Yii light from SEQ ID NO: 136,139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a light chain CDR3 of SEQ ID NO: 138 or 141; g. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 123,126,127 or 129, a heavy chain CDR2 of SEQ ID NO: 124,128 or 130; a heavy chain CDR3 of SEQ ID NO: 147 or 148; a light chain CDR1 of SEQ ID NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a light chain CDR3 of SEQ ID NO: 155 or 157; h. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 103,106,107 or 109, a heavy chain CDR2 of SEQ ID NO: 104,108 or 110; a heavy chain CDR3 of SEQ ID NO: 163 or 164; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 169 or 170; Yo. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 175,178,179 or 181, a heavy chain CDR2 of SEQ ID NO: 176,180 or 182; a heavy chain CDR3 of SEQ ID NO: 177 or 183; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 188 or 189; j. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 194 or 195; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 200 or 201; k. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 208 or 214; a light chain CDR1 of SEQ ID NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a light chain CDR3 of SEQ ID NO: 219 or 220; I. a heavy chain variable region comprising a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 225 or 226; a light chain CDR1 of SEQ ID NO: 136,139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a light chain CDR3 of SEQ ID NO: 231 or 232; m. a heavy chain variable region comprising a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, 209, 210 or 212, a HCDR2 CRC / nn / Lznz / E / Yii of SEQ ID NO: 207, 211 or 213, and a HCDR3 of SEQ ID NO: 237 or 238; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 243, 245 or 247, an LCDR2 of SEQ ID NO: 47 or 50, and an LCDR3 of SEQ ID NO: 244 or 246; no. a heavy chain variable region comprising a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, 209, 210 or 212, a HCDR2 of SEQ ID NO: 207, 211 or 213, and a HCDR3 of SEQ ID NO: 252 or 253; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 153, 156 or 158, an LCDR2 of SEQ ID NO: 50 or 154, and an LCDR3 of SEQ ID NO: 258 or 259; either. a heavy chain CDR1 of SEQ ID NO: 1, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a CDR2 light chain of SEQ ID NO: 15, and a CDR3 light chain of SEQ ID NO: 16; p. a heavy chain CDR1 of SEQ ID NO: 4, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a CDR2 light chain of SEQ ID NO: 15, and a CDR3 light chain of SEQ ID NO: 16; Q. a heavy chain CDR1 of SEQ ID NO: 5, a heavy chain CDR2 of SEQ ID NO: 6, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 17, a CDR2 light chain of SEQ ID NO: 18, and a CDR3 light chain of SEQ ID NO: 19; r. a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 8, a heavy chain CDR3 of SEQ ID NO: 9, a light chain CDR1 of SEQ ID NO: 20, a CDR2 light chain of SEQ ID NO: 18, and a CDR3 light chain of SEQ ID NO: 16; s. a heavy chain CDR1 of SEQ ID NO: 33, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 46, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 48; t. a heavy chain CDR1 of SEQ ID NO: 36, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 46, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 48; or. a heavy chain CDR1 of SEQ ID NO: 37, a heavy chain CDR2 of SEQ ID NO: 38, a heavy chain CDR3 of SEQ ID NO: 35, a heavy chain CDR1 of CAC / nn / Lznz / E / Yii light from SEQ ID NO: 49, a CDR2 light chain from SEQ ID NO: 50, and a CDR3 light chain from SEQ ID NO: 51; v. a heavy chain CDR1 of SEQ ID NO: 39, a heavy chain CDR2 of SEQ ID NO: 40, a heavy chain CDR3 of SEQ ID NO: 41, a light chain CDR1 of SEQ ID NO: 52, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 48; w. a heavy chain CDR1 of SEQ ID NO: 57, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a CDR2 light chain of SEQ ID NO: 69, and a CDR3 light chain of SEQ ID NO: 70; x. a heavy chain CDR1 of SEQ ID NO: 60, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a CDR2 light chain of SEQ ID NO: 69, and a CDR3 light chain of SEQ ID NO: 70; and. a heavy chain CDR1 of SEQ ID NO: 5, a heavy chain CDR2 of SEQ ID NO: 61, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 71, a CDR2 light chain of SEQ ID NO: 72, and a CDR3 light chain of SEQ ID NO: 73; z. a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 62, a heavy chain CDR3 of SEQ ID NO: 63, a light chain CDR1 of SEQ ID NO: 74, a CDR2 light chain of SEQ ID NO: 72, and a CDR3 light chain of SEQ ID NO: 70; ah. a heavy chain CDR1 of SEQ ID NO: 79, a heavy chain CDR2 of SEQ ID NO: 80, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO : 92, a CDR2 light chain of SEQ ID NO: 93, and a CDR3 light chain of SEQ ID NO: 94; bb. a heavy chain CDR1 of SEQ ID NO: 82, a heavy chain CDR2 of SEQ ID NO: 80, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 92, a CDR2 light chain of SEQ ID NO: 93, and a CDR3 light chain of SEQ ID NO: 94; DC. a heavy chain CDR1 of SEQ ID NO: 83, a heavy chain CDR2 of SEQ ID NO: 84, a heavy chain CDR3 of SEQ ID NO: 81, a heavy chain CDR1 of CRC / nn / Lznz / E / Yii light chain of SEQ ID NO: 95, a CDR2 light chain of SEQ ID NO: 96, and a CDR3 light chain of SEQ ID NO: 97; dd. a heavy chain CDR1 of SEQ ID NO: 85, a heavy chain CDR2 of SEQ ID NO: 86, a heavy chain CDR3 of SEQ ID NO: 87, a light chain CDR1 of SEQ ID NO: 98, a CDR2 light chain of SEQ ID NO: 96, and a CDR3 light chain of SEQ ID NO: 94; ee a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 116; a light chain CDR2 of SEQ ID NO: 47; and a light chain CDR3 of SEQ ID NO: 117; ff. a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 117; gg. a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 118; H H. a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 111, a light chain CDR1 of SEQ ID NO: 52 a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 117; Yo. a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 138; jj. a heavy chain CDR1 of SEQ ID NO: 126, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 138; kk. a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 139, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 141; CAC / nn / Lznz / E / Yii II. a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 131, a light chain CDR1 of SEQ ID NO: 142, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 138; mm. a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 155; nn. a heavy chain CDR1 of SEQ ID NO: 126, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 155; oh. a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 156, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 157; pp. a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 148, a light chain CDR1 of SEQ ID NO: 158, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 155; qq. a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 169; rr. a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 169; H.H. a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 170; tt. a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 164, a heavy chain CDR1 of CAC / nn / Lznz / E / Yii light from SEQ ID NO: 52, a CDR2 light chain from SEQ ID NO: 50, and a CDR3 light chain from SEQ ID NO: 169; uu. a heavy chain CDR1 of SEQ ID NO: 175, a heavy chain CDR2 of SEQ ID NO: 176, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 188; vv. a heavy chain CDR1 of SEQ ID NO: 178, a heavy chain CDR2 of SEQ ID NO: 176, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 188; ww. a heavy chain CDR1 of SEQ ID NO: 179, a heavy chain CDR2 of SEQ ID NO: 180, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 189; xx. a heavy chain CDR1 of SEQ ID NO: 181, a heavy chain CDR2 of SEQ ID NO: 182; a heavy chain CDR3 of SEQ ID NO: 183, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: :188; yy. a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 200; zz. a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 200; aaa. a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 201; bbb. a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 195, a light chain CDR1 of SEQ ID NO: 52, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 200; pRC / nn / Lznz / E / Yi ccc. a heavy chain CDR1 of SEQ ID NO: 206, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 219; ddd. a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 219; eee. a heavy chain CDR1 of SEQ ID NO: 210, a heavy chain CDR2 of SEQ ID NO: 211, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 156, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 220; fff. a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 214, a light chain CDRI of SEQ ID NO: 158 , a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 219; ggg. a heavy chain CDR1 of SEQ ID NO: 206, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 231; hhh. a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 231; iii. a heavy chain CDR1 of SEQ ID NO: 210, a heavy chain CDR2 of SEQ ID NO: 211, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 139, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 232; lol. a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 226, a light chain CDR1 of SEQ ID NO: 142; a light chain CDR2 of SEQ ID NO: 140; and a light chain CDR3 of SEQ ID NO: 231; kkk. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 237, and a region CRC / nn / Lznz / E / Yii light chain variable comprising an LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; III. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 209, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 237, and a light chain variable region comprising a LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; Hmm. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 210, a HCDR2 of SEQ ID NO: 211, and a HCDR3 of SEQ ID NO: 237, and a light chain variable region comprising a LCDR1 of SEQ ID NO: 245, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 246; nnn. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 212, a HCDR2 of SEQ ID NO: 213, and a HCDR3 of SEQ ID NO: 238; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 247, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 244; ooo. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 252, and a light chain variable region comprising a LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; dpi. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 209, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 252, and a light chain variable region comprising a LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; qqq. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 210, a HCDR2 of SEQ ID NO: 211, and a HCDR3 of SEQ ID NO: 252, and a light chain variable region comprising a LCDR1 of SEQ ID NO: 156, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 259; or rrr. a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 212, a HCDR2 of SEQ ID NO: 213, and a HCDR3 of SEQ ID NO: 253; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 158, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 258. An antibody or antigen-binding fragment thereof that binds PMEL17 of the present application may further comprise: CRC / nn / Lznz / E / Yii sss. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 21; ttt. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 25; uuu. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 29; vvv. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 42, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53; www. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 64, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 75; xxx. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 88, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 99; yyy. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 112, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 119; zzz. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 132, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 143; aaaa. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 149, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 159; bbbb. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 165, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 171; cccc. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 184, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 190; CRC / nn / Lznz / E / Yii dddd. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 196, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 202; eeee. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 215, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 221; ffff. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 227, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 233; gggg. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 239, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 248; or hhhh. A heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 254, and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 260. In another embodiment, the antibody or antigen-binding fragment thereof that binds to PMEL17 comprises: iiii. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 23; jjjj. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 27; kkkk. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 31; lili. A heavy chain comprising the amino acid sequence of SEQ ID NO: 44, and a light chain comprising the amino acid sequence of SEQ ID NO: 55; MMM. A heavy chain comprising the amino acid sequence of SEQ ID NO: 66, and a light chain comprising the amino acid sequence of SEQ ID NO: 77; nnnn. A heavy chain comprising the amino acid sequence of SEQ ID NO: 90, and a light chain comprising the amino acid sequence of SEQ ID NO: 101; oooo. A heavy chain comprising the amino acid sequence of SEQ ID NO: 114, and a light chain comprising the amino acid sequence of SEQ ID NO: 121.; pAC / nn / Lznz / E / Yii pppp. A heavy chain comprising the amino acid sequence of SEQ ID NO: 134, and a light chain comprising the amino acid sequence of SEQ ID NO: 145; qqqq. A heavy chain comprising the amino acid sequence of SEQ ID NO: 151, and a light chain comprising the amino acid sequence of SEQ ID NO: 161; rrrr. A heavy chain comprising the amino acid sequence of SEQ ID NO: 167, and a light chain comprising the amino acid sequence of SEQ ID NO: 173; ssss. A heavy chain comprising the amino acid sequence of SEQ ID NO: 186, and a light chain comprising the amino acid sequence of SEQ ID NO: 192; tttt. A heavy chain comprising the amino acid sequence of SEQ ID NO: 198, and a light chain comprising the amino acid sequence of SEQ ID NO: 204; uuuu. A heavy chain comprising the amino acid sequence of SEQ ID NO: 217, and a light chain comprising the amino acid sequence of SEQ ID NO: 223; vvvv. A heavy chain comprising the amino acid sequence of SEQ ID NO: 229, and a light chain comprising the amino acid sequence of SEQ ID NO: 235; wwww. A heavy chain comprising the amino acid sequence of SEQ ID NO: 241, and a light chain comprising the amino acid sequence of SEQ ID NO: 250; or xxxx. A heavy chain comprising the amino acid sequence of SEQ ID NO: 256, and a light chain comprising the amino acid sequence of SEQ ID NO: 262. The antibody or antigen-binding fragment thereof according to the present may comprise one or more cysteine ​​substitutions. In one embodiment, the antibody or antigen-binding fragment thereof comprises one or more cysteine ​​substitutions selected from S152C, S375C, or both S152C and S375C of the heavy chain of the antibody or antigen-binding fragment thereof, wherein the position is numbered according to the UE system. An antibody according to the present may be a monoclonal antibody. In one aspect, the Antibody-Drug Conjugate of the invention is a conjugate of Formula (C): Ab-(LA-(D)n)y(C) CRC / nn / Lznz / E / Yii where: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; The is a linker; n is 1,2, 3, or 4, and y is 1,2, 3, or 4, wherein the Linker-Drug moiety -(LA-(D)n) is covalently attached to the antibody or antigen-binding fragment thereof. In another aspect of the Antibody-Drug Conjugate of Formula (C), LA is a cleaved linker comprising one or more linker components selected from a self-immolative spacer, a phosphate group, a carbonate group and a bivalent peptide linker. In another aspect, the Antibody-Drug Conjugate of Formula (C) is a conjugate of Formula CAC / nn / Lznz / E / Yii where: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; 0, where the * of Y1 indicates the point of attachment to X2 and the ** of Y1 indicates the point of attachment to D; L1 is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. The present application further discloses pharmaceutical compositions comprising the antibodies, or antigen-binding fragments thereof, described herein and a pharmaceutically acceptable carrier. The present application further discloses pharmaceutical compositions comprising the antibody-drug conjugates according to the present and a pharmaceutically acceptable carrier. The present application further discloses methods of treating or preventing cancer in a patient in need thereof, comprising administering to said patient the antibody-drug conjugates or pharmaceutical compositions disclosed herein, wherein the cancer expresses PMEL17, contains a GNAQ or GNA11 gene mutation, or the cancer expresses PMEL17 and contains a GNAQ or GNA11 mutation, or both. In some embodiments of cancer treatment or prevention methods, the antibody-drug conjugate or pharmaceutical composition is administered to the patient in combination with one or more additional therapeutic compounds. In one embodiment, the single or more additional therapeutic compounds are selected from a standard of care chemotherapeutic, MDM2 inhibitor, MRC2 inhibitor, PKC inhibitor, MAPK inhibitor, costimulatory molecule, or trigger point inhibitor. control. In one embodiment, the costimulatory molecule is selected from an agonist of 0X40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a / CD18), ICOS (CD278), 4-1 BB (CD137), GITR, CD30 , CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, STING, or CD83 ligand. In another embodiment, the checkpoint inhibitor is selected from an inhibitor of PD-1, PD-L1, PD-L2, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, and / or TGFR beta. . The present application further discloses the antibody-drug conjugates or pharmaceutical compositions disclosed herein, for use as a medicament. In one embodiment, the antibody-drug conjugates or pharmaceutical compositions disclosed herein are for use in the treatment or prevention of a cancer expressing PMEL17 or a cancer containing a GNAQ or GNA11 gene mutation in a patient who you need it. In one embodiment, the application discloses the use of the antibodies or antigen-binding fragments thereof, the antibody-drug conjugate, or the pharmaceutical composition accordingly, to treat or prevent a PMEL17-expressing cancer in a patient. who needs it. In one embodiment, the application discloses the use of the antibodies or antigen-binding fragments thereof, the antibody-drug conjugates, or the pharmaceutical compositions herein, to treat or prevent a cancer expressing PMEL17 or a cancer containing a GNAQ or GNA11 gene mutation in a patient who needs it. In one embodiment, the application discloses the use of the antibodies or antigen-binding fragments thereof, the conjugates of CRC / nn / Lznz / E / Yii antibody drug, or pharmaceutical compositions accordingly, in the manufacture of a drug. In one embodiment, the cancer expresses PMEL17 or contains a GNAQ or GNA11 gene mutation. In one embodiment, the cancer is uveal melanoma, subcutaneous melanoma, hepatocellular carcinoma, or a metastatic cancer thereof. The present application further discloses nucleic acids encoding the antibodies or antigen-binding fragments according to the present. In one embodiment, the nucleic acid comprises the nucleotide sequence of SEQ ID NOs: 13, 24, 28, 32, 45, 56, 67, 78, 91, 102, 115, 122, 135, 146, 152, 162, 168, 174, 187, 193, 199, 205, 218, 224, 230, 236, 242, 251, 257, or 26. The present application also describes vectors comprising the nucleic acids and host cells comprising the vectors or nucleic acids. . The present application also discloses a process for producing the antibodies or antigen-binding fragments according to the present which comprises culturing the host cell and recovering the antibody from the cell culture. In one embodiment, the process of recovering the antibody from the cell culture comprises the steps of: a) remove the cells and filter the culture; b) purifying the culture by affinity chromatography; c) inactivate any virus in the culture by adjusting the pH to 3.4-3.6, then readjust the pH to 5.8-6.2 and filter the culture; d) purifying the culture by cation exchange chromatography and performing a column reduction of the culture; e) running an anion exchange chromatography on the culture; f) removing viruses by nanofiltration; g) filtering the culture containing the antibody; and h) obtaining purified antibody. The present application further discloses a process for producing an anti-PMEL17 antibody-drug conjugate comprising: (a) preforming a linker-drug moiety of the following Formula (B): R8-LB-(D)n(B) where: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; R8 is a reactive group; You have a cleavable and non-cleavable linker, and n is 1, 2, 3, or 4; CAC / nn / Lznz / E / Yii (b) conjugating said linker-drug moiety to antibody recovered from cell culture using the process for producing an antibody or antigen-binding fragment disclosed herein to produce an antibody-drug conjugate; and (c) purifying the antibody-drug conjugate. The present application further discloses a diagnostic reagent comprising an antibody or antigen-binding fragment thereof according to the present. In some embodiments, the antibody or antigen-binding fragment thereof is labeled with a radiolabel, fluorophore, chromophore, imaging agent, or metal ion. BRIEF DESCRIPTION OF THE DRAWINGS Figures 1A-1B illustrate examples of data on the in vitro anti-UM activity of the GNAQ / 11 inhibitors Compound (A1) and Compound (A2). Figure 2 illustrates exemplary data on the activity of the GNAQ / 11 inhibitors Compound (A1) and Compound (A2) in inducing apoptosis in uveaL melanoma cells. Figures 3A-3C illustrate examples of data on GNAQ / 11 inhibition by Compound (A1) and Compound (A2). Compound (A1) and Compound (A2) reduced IP1 levels (Figure 3A) and relative proliferation (Figure 3B) in 92.1 cells. Immunoblots of 92.1 cells treated with Compound (A1) and Compound (A2) showed reduced ERK signaling (Figure 3C). Figures 4A-4D illustrate examples of data on the metabolic stability and PK properties of Compound (A1). Both the disappearance of Compound (A1) (Figure 4A) and the appearance of the open ring form of Compound (A8) (Figure 4B) were monitored for 24h. With the exception of the rat, adding the remaining % of Compound (A1) and the formed % of Compound (A8) show stoichiometry over 24h (Figure 4C). The PK of Compound (A1) after intravenous administration in mice is characterized by very high clearance and moderate to high volume of distribution (Figure 4D). Figures 5A-5D illustrate exemplary data on the metabolic stability and PK properties of Compound (A1) and Compound (A2). The in vitro stability of Compound (A2) was tested in plasma and blood of different species (Figure 5A). Compound (A2) showed good chemical stability in three different systems (Figure 5B). The PK of Compound (A2) in female balb / c mice showed high clearance and a short elimination half-life (Figure 5C). Compound (A1) and Compound (A2) were stable in buffer at pH 5.6 and in lysosomes for 4h (Figure 5D). eAC / nn / Lznz / E / Yu Figures 6A-6B illustrate examples of data on the in vitro anti-uveal melanoma activity of anti-PMEL17-(B1) ADCs. Data are presented as the mean of three independent replicates and relative to PBS-treated cells (control). Figure 7 illustrates examples of data on anti-PMEL17-(B1) ADCs inducing apoptosis in uveaL melanoma cells. Data are presented as the mean of 3 independent replicates. Figures 8A-8B illustrate examples of data on the in vitro anti-uveal melanoma activity of anti-PMEL17-(B2) ADCs and anti-PMEL17 mAbs. Data are presented as the mean of three independent replicates and relative to PBS-treated cells (control). Figure 9 illustrates exemplary data on GNAQ / 11 inhibition by anti-PMEL17-(B1) and anti-PMEL17-(B2) ADCs in uveal melanoma cells. IP1 levels (nM) are presented as the mean of 3 independent replicates. Figures 10A-10D illustrate examples of data on the binding activity of antiPMEL17 antibodies to intact platelets and uveal melanoma cells. Figures 11A-11C illustrate exemplary data on the impact of Compound (A1) and antiPMEL17-(B1) ADCs on human platelet aggregation. Figures 12A-12E illustrate examples of data on the in vivo antitumor activity of antiPMEL17-(B1) ADCs. G1 -(B1) inhibited tumor growth in a dose-dependent manner (Figure 12A). Values ​​are mean ± SEM; sample size, (n=5-12 mice per group). Initial tumor volume at day 0 was approximately 200-250 mm3. No loss of body weight was observed up to 14 days after treatment (Figure 12B). Values ​​are mean ± SEM; sample size, (n=4 mice per group). Treatment with G1 -(B1) resulted in inhibition of GNAQ signaling and inhibition of tumor cell proliferation as indicated by reduced levels of pERK and K¡67, respectively (Figure 12C). In addition, G1 -(B1) induced cell apoptosis compared to vehicle-treated mice and isotype 3207-(B1) control, which correlated with the accumulation of G1 -(B1) ADC tumor cells as detected by labeled with IgG (Figure 12C). No changes in MITF and PMEL17 levels were observed after GNAQ inhibition (Figure 12C). No inhibition of platelet aggregation was observed in mice treated with G1 -(B1) for up to 7 days (Figures 12D & E). Figures 13A-13C illustrate examples of data on the effect of ADC G1-(B1) in a mouse model of liver and lung metastasis of uveal melanoma. Individual images of each mouse are presented at day 45 after an i.v. injection. from luciferase-labeled 92.1 cells (just before the start of treatment) and 12 days after treatment (Figures 13A and 13B); sample size, (n=6 mice per group). The baseline BLI for liver metastases at day 0 was approximately 2.8 *109 p / sec / cm2. Lung tumors (bioluminescence signal) in Figure 13B are indicated with CRC / nn / Lznz / E / Yii a black arrow. Corresponding body weight modulation (% vs day 15) was assessed 2-3 times per week before and after treatment with G1 - (B1) 20 mg / kg (gray circles). Values ​​in Figure 13C are mean ± SEM; sample size, (n=5-6 mice per group). Initial body weight at day 15 was approximately 21 g. Figures 14A-14E illustrate examples of data on the PK properties of G1 -(B1) ADCs. The pharmacokinetic profile (total IgG levels) of G1-(B1) showed a slightly over-proportional increase in exposure at doses between 7.5 and 30 mg / kg in nude mice (Figure 14A). In tumor-bearing mice, free payload concentrations were measured after dose of target-binding G1-(B1) or isotype control 3207-(B1). A clear increase (>4-fold) in the delivery to the tumor of the Compound (A1) payload could be observed using targeted ADC ( Figure 14B ). Conversion of Compound (A1) (open circles) to its ring-opened form Compound (A8) (solid circles) while conjugated to antibody was shown in vivo in mice ( Figure 14C ). Exposures in an in vivo efficacy study, comparing two different DAR2 formats with the G1-(B1) DAR4 format and the DAR4 Fc-silent format, showed the lowest clearance for DAR2 (E152C) and DAR4 Fc ADCs. -silent, while exposure to DAR2 (S375C) decreases faster (Figure 14D). Figure 14E illustrates the concentration of the DAR4 Fc-silent conjugates 3207 (isotype control antibody)-(B 1) DAR4 (E152C, S375C) and 3207 (isotype control antibody) (B1) DAR4 over time. Figures 15A-15C illustrate examples of data on the in vitro stability of anti-PMEL17GNAQ / 11i ADCs in buffer, mouse, rat, and human plasma and on the in vivo stability of anti-PMEL17-GNAQ / 11i ADCs in mouse. Figures 16A-16B illustrate examples of in vivo efficacy data of G1-E152C-DAR2-(B1), G1-S375C-DAR2-(B1), G1-(B1) Fc-silent in a xenograft model of uveal melanoma. Values ​​represent mean ± SEM; sample size, (n=5-6 mice per group). Initial tumor volume at day 0 was approximately 300-325 mm3. Figures 17A-17B illustrate examples of data on the in vitro anti-uveal melanoma activity of anti-PMEL17-(B1) ADCs. Data are presented as the mean of three independent replicates and relative to PBS-treated cells (control). Figure 18 illustrates examples of data on the in vivo antitumor activity of anti-PMEL17(B1) ADCs. Figures 19A-19B illustrate examples of data on an immunohistochemical analysis of tumor biopsies from patients with metastatic uveal melanoma. Figures 20A-20C show data from exemplary sensorgrams for evaluating anti-PMEL antibody epitope clustering. Figure 20A illustrates the binding steps. Figure 20B shows CAC / nn / Lznz / E / Yii the sensorgram when the G1 3J LC antibody is first immobilized and flowed onto 17A9. Figure 20C shows the sensorgram when 17A9 first immobilizes and G1 3J LC flows. In both cases, binding is observed when the second antibody flows, suggesting that G1 3J LC and 17A9 bind to different epitopes of human PMEL. Detailed description of the invention Definitions Unless otherwise indicated, the following terms and phrases, as used herein, have the following meanings: The term "alkyl" refers to a monovalent saturated hydrocarbon chain having the specified number of carbon atoms. For example, CrCe alkyl refers to an alkyl group having 1 to 6 carbon atoms. Alkyl groups can be linear or branched. Representative branched alkyl groups have one, two, or three branches. Examples of alkyl groups include, but are not limited to, methyl, ethyl, propyl (n-propyl and isopropyl), butyl (n-butyl, isobutyl, sec-butyl and t-butyl), pentyl (n-pentyl, isopentyl and neopentyl) and hexyl. Cleavable, as used herein, refers to a linking group or linker component that connects two moieties by covalent bonds, but which is cleaved to sever the covalent connection between the moieties under physiologically relevant conditions, typically a cleavable linking group is cleaves in vivo more rapidly in an intracellular environment than when outside of a cell, causing payload release to occur preferentially within a target cell. Cleavage can be enzymatic or non-enzymatic, but generally releases a payload of an antibody without degrading the antibody. Cleavage can leave a portion of a linker group or linker component attached to the payload, or it can release the payload without any linker group residue. "Non-cleavable" as used herein refers to a linking group or linker component that is not especially susceptible to breakdown under physiological conditions, eg, is at least as stable as the antibody or the portion of the fragment binding to conjugate antigen. Such linking groups are sometimes referred to as stable, meaning that they are resistant enough to degradation to keep the payload attached to the antibody or antigen-binding fragment until the antibody or antigen-binding fragment is degraded at least partially itself, ie, degradation of the antibody or antigen-binding fragment precedes cleavage of the binding group in vivo. Degradation of the antibody portion of an ADC that has a stable or non-cleavable linker may leave part or all of the linker, CRC / nn / Lznz / E / Yii eg one or more amino acid groups of an antibody, bound to the payload or to the rest of the drug that is delivered in vivo. The term "antibody" as used herein refers to a polypeptide of the immunoglobulin family that is capable of binding a corresponding antigen in a non-covalent, reversible and specific manner. For example, a natural IgG antibody is a tetramer comprising at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. Each heavy chain is composed of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is composed of three domains, CH1, CH2, and CH3. Each light chain is composed of a light chain variable region (abbreviated VL) and a light chain constant region. The light chain constant region is composed of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs arranged from the amino terminus to the carboxyl terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The heavy and light chain variable regions contain a binding domain that interacts with an antigen. The constant regions of antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (eg, effector cells) and the first component (Clq) of the classical complement system. The term "antibody" includes, but is not limited to, monoclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies, and anti-idiotypic (anti-ld) antibodies (including, for example, anti-ld antibodies for antibodies of the invention). Antibodies can be of any isotype / class (eg, IgG, IgE, IgM, IgD, IgA, and IgY), or subclass (eg, IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2). Complementarity determining domains or complementarity determining regions (CDRs) refer interchangeably to the hypervariable regions of VL and VH. CDRs are the target protein binding site of antibody chains that harbor specificity for that target protein. There are three CDRs (CDR1 -3, numbered sequentially from the N-terminus) in each human VL or VH, constituting approximately 15-20% of the variable domains. CDRs are structurally complementary to the epitope of the target protein and are therefore directly responsible for binding specificity. The remaining stretches of the VL or VH, the so-called framework regions, exhibit less variation in amino acid sequence (Kuby, Immunology, 4th ed., Chapter 4. W.H. Freeman & Co., New York, 2000). CRC / nn / Lznz / E / Yii The positions of the CDRs and framework regions can be determined using a number of definitions well known in the art, for example, Kabat, Chothia, International ImMunoGeneTics database (IMGT) (on the internet see www.imgt.org / ), and AbM (see eg Johnson et al., Nucleic Acids Res., 29:205-206 (2001), Chothia and Lesk, J. Mol. BioL, 196:901-917 (1987), Chothia et al., Nature, 342 :877-883 (1989), Chothia et al., J. Mol. BioL, 227:799-817 (1992), Al-Lazikani et al., J. Mol. BioL, 273:927-748 (1997)). Definitions of antigen combining sites are also described in: Ruiz et al., Nucleic Acids Res., 28:219-221 (2000 ); and Lefranc, M.P., Nucleic Acids Res., 29:207-209 (2001); MacCallum et al., J. Mol. BioL, 262:732-745 (1996); and Martin et al., Proc. nati. Acad. Sci. USA, 86:9268-9272 (1989); Martin et al., Methods EnzymoL, 203:121-153 (1991); and Rees et al., In Sternberg M.J.E. (ed.), Protein Structure Prediction, Oxford University Press, Oxford, 141-172 (1996). The light and heavy chains are divided into regions of structural and functional homology. The terms constant and variable are used functionally. In this regard, it will be noted that the variable domains of the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity. Reciprocally, the constant domains of the light chain (CL) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental motility, Fe receptor binding, complement binding and the like. By convention, the numbering of constant region domains increases as they become more distal to the antigen-binding site or the amino terminus of the antibody. The N-terminus is a variable region and the C-terminus is a constant region; the CH3 and CL domains actually comprise the carboxy-terminal domains of the heavy and light chain, respectively. The term "antigen-binding fragment" as used herein refers to one or more portions of an antibody that retain the ability to specifically interact (eg, through binding, steric hindrance, stabilization / destabilization, spatial distribution). with an epitope of an antigen. Examples of binding fragments include, but are not limited to, single chain Fvs (scFv), camelid antibodies, disulfide-linked Fvs (sdFv), Fab fragments, F(abj) fragments, a monovalent fragment consisting of the domains VL, VH, CL and CH1; an F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of consists of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., Nature 341:544-546, 1989), consisting of a VH domain; and an isolated complementarity determining region (CDR ) or other epitope-binding fragments of an antibody. In addition, although the two domains of the Fv fragment, VL and VH, are encoded by separate genes, they can be joined, by recombinant methods, by a synthetic linker that allows them to be formed. CAC / nn / Lznz / E / Yii as a single protein chain in which the VL and VH regions pair up to form monovalent molecules (known as single-chain Fvs (“scFvs”); see, for example, Bird et al. ., Science 242:423-426, 1988; and Huston et al., Proc. Nati. Acad. Sci. 85:5879-5883, 1988). Such single chain antibodies also fall within the scope of the term "antigen-binding fragment." These antigen-binding fragments are obtained using standard techniques known to those skilled in the art, and the fragments are selected for utility in the same manner as intact antibodies. Antigen-binding fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, single domain antibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NARs, and bis-scFvs (see, for example, Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005). Antigen-binding fragments can be grafted onto scaffolds based on polypeptides such as fibronectin type III (Fn3) (see US Patent No. 6,703,199, which describes fibronectin polypeptide monobodies). Antigen-binding fragments can be incorporated into single-chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen-binding regions. (Zapata et al., Protein Eng. 8:1057-1062, 1995; and US Patent No. 5,641,870). The term "monoclonal antibody" or "monoclonal antibody composition" as used herein refers to polypeptides, including antibodies and antigen-binding fragments that have a substantially identical amino acid sequence or are derived from the same genetic source. This term also includes preparations of antibody molecules of unique molecular composition. A monoclonal antibody composition displays a unique binding affinity and specificity for a particular epitope. The term "antibody" as used herein includes antibodies having variable regions in which both the framework region and the CDRs are derived from sequences of human origin. In addition, if an antibody contains a constant region, the constant region is also derived from such human sequences, for example, human germline sequences, or mutated versions of human germline sequences or antibody-containing consensus framework sequences derived from analysis of human framework sequences, eg, as described in Knappik et al., J. Mol. BioL 296:57-86, 2000). Also included are antibodies derived from human sequences where one or more CDRs have been mutated for purposes of affinity maturation or preparation / payload conjugation. See, Kilpatrick et al., “Rapid development of affinity matured monoclonal antibodies using RIMMS,” Hybridoma. 1997 Aug;16(4):381-9. CRC / nn / Lznz / E / Yii Human antibodies of the invention may include amino acid residues not encoded by human sequences (for example, mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or preparation ). The term "recognize" as used herein refers to an antibody or antigen-binding fragment thereof that encounters and interacts (eg, binds) its epitope, whether the epitope is linear or conformational. The term epitope refers to a site on an antigen to which an antibody or antigen-binding fragment of the invention specifically binds. Epitopes can be formed from both contiguous amino acids and juxtaposed non-contiguous amino acids by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost upon treatment with denaturing solvents. An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids in a single spatial conformation. Methods for determining the spatial conformation of epitopes include techniques available in the art, for example, X-ray crystallography and two-dimensional nuclear magnetic resonance (see, for example, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris , Ed. (1996)). The term "affinity" as used herein refers to the strength of the interaction between the antibody and the antigen at unique antigenic sites. Within each antigenic site, the variable region of the antibody arm interacts through weak noncovalent forces with the antigen at numerous sites; the more interactions, the stronger the affinity. The term "isolated antibody" refers to an antibody that is substantially free of other antibodies having different antigenic specificities. However, an isolated antibody that specifically binds to one antigen may cross-react with other antigens. On the other hand, an isolated antibody can be substantially free of other cellular materials and / or chemicals. The term "corresponding human germline sequence" refers to a nucleic acid sequence encoding a human variable region amino acid sequence or subsequence that shares the highest determined amino acid sequence identity with a variable region amino acid sequence or subsequence. reference variable compared to all other known variable region amino acid sequences encoded by human germline immunoglobulin variable region sequences. The corresponding human germline sequence may also refer to a human variable region amino acid sequence or subsequence with the highest amino acid sequence identity to a sequence or CRC / nn / Lznz / E / Yii reference variable region amino acid subsequence compared to all other variable region amino acid sequences evaluated. The corresponding human germline sequence may be framework regions only, complementary determining regions only, framework and complementary determining regions, a variable segment (as defined), or other combinations of sequences or subsequences that comprise a variable region. Sequence identity can be determined using the methods described herein, for example, by aligning two sequences using BLAST, ALIGN, or another alignment algorithm known in the art. The corresponding human germline nucleic acid or amino acid sequence may be at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100 % sequence identity with reference to the amino acid or nucleic acid sequence of the variable region. Corresponding human germline sequences can be determined, for example, via the international publicly accessible database ImMunoGeneTics (IMGT) (see on the Internet at www.imgt.org / ) and V-base (see on the Internet at at vbase.mrc-cpe.cam.ac.uk). The phrase binds specifically or binds selectively when used in the context of describing the interaction between an antigen (eg, a protein) and an antibody, antibody fragment, or antibody-derived binding agent, refers to a binding reaction that is determinative of the presence of the antigen in a heterogeneous population of proteins and other biological products, eg, in a biological sample, eg, a blood, serum, plasma, or tissue sample. Thus, under certain designated immunoassay conditions, antibodies or binding agents with a particular binding specificity bind to a particular antigen at least twice the background and do not substantially bind to any significant amount to other antigens present in the sample. . In one embodiment, under specified conditions, the antibody or binding agent with a particular binding specificity, binds to a particular antigen at least ten (10) times background and does not substantially bind to any significant degree to other antigens present on the sample. Specific binding to an antibody or binding agent under such conditions may require that the antibody or agent be selected for its specificity for a particular protein. As desired or appropriate, this selection can be accomplished by subtracting out antibodies that cross-react with molecules from other species (eg, mouse or rat) or other subtypes. Alternatively, in some embodiments, antibodies or antibody fragments are selected that cross-react with certain desired molecules. A variety of immunoassay formats can be used to select for antibodies specifically immunoreactive with a particular protein. For example, solid phase ELISA immunoassays are routinely used to select for antibodies specifically immunoreactive with a protein {see, for example, Harlow & Lane, Using Antibodies, A Laboratory CAC / nn / Lznz / E / Yii Manual (1998), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Typically, a specific or selective binding reaction will produce a signal at least twice the background signal and more commonly at least 10 to 100 times the background. The term "equilibrium dissociation constant (Kd, M)" refers to the dissociation rate constant (kd, time1) divided by the association rate constant (ka, time1, M1). Equilibrium dissociation constants can be measured using any method known in the art. Antibodies of the present invention generally have an equilibrium dissociation constant of less than about 10-7 or 10-8M, eg, less than about 10-9Μ or 10-10M, in some embodiments, less than about 10-11Μ. , 10-12Μ or 10-13M. The term bioavailability refers to the systemic availability (ie, blood / plasma levels) of a given amount of drug administered to a patient. Bioavailability is an absolute term indicating the measurement of both the time (velocity) and the total amount (extent) of drug reaching the general circulation from an administered dosage form. As used herein, the phrase "consisting essentially of" refers to the genera or species of active pharmaceutical agents included in a method or composition, as well as any inactive carriers or excipients for the intended purposes of the methods or compositions. In some embodiments, the phrase "consisting essentially of" expressly excludes the inclusion of one or more additional active agents other than an antibody-drug conjugate of the invention. In some embodiments, the phrase "consisting essentially of" expressly excludes the inclusion of one or more additional active agents other than an antibody-drug conjugate of the invention and a co-administered second agent. The term amino acid refers to natural and synthetic amino acids, and non-natural amino acids, as well as amino acid analogs and amino acid mimetics that function in a similar manner to natural amino acids. Natural amino acids are those encoded by the genetic code, as well as amino acids that are subsequently modified, for example, hydroxyproline, and carboxyglutamate and O-phosphoserine. Amino acid analogues refer to compounds that have the same basic chemical structure as a natural amino acid, i.e., a carbon to which is attached a hydrogen, a carboxyl group, an amino group, and an R group, for example, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (eg, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a natural amino acid. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a similar way to a natural amino acid. CAC / nn / Lznz / E / Yii The term conservatively modified variant is applied to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refer to those nucleic acids that encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids code for any given protein. For example, the codons GCA, GCC, GCG, and GCU code for the amino acid alanine. Thus, at each position at which a codon specifies an alanine, the codon can be altered to any of the corresponding described codons without altering the encoded polypeptide. These nucleic acid variations are silent variations, which are kind of conservatively modified variations. Each nucleic acid sequence herein that encodes a polypeptide also describes each possible silent variation of the nucleic acid. One of skill in the art will recognize that every codon in a nucleic acid (except AUG, which is normally the only codon for methionine, and TGG, which is normally the only codon for tryptophan) can be modified to produce a functionally identical molecule. Consequently, each silent variation of a nucleic acid encoding a polypeptide is implicit in each described sequence. In terms of polypeptide sequences, conservatively modified variants include individual substitutions, deletions, or additions to a polypeptide sequence that result in the substitution of one amino acid with a chemically similar amino acid. Tables of conservative substitutions that provide functionally similar amino acids are well known in the art. Said conservatively modified variants are additional and do not exclude polymorphic variants, interspecies homologues and alleles of the invention. The following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic Acid (D), Glutamic Acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine ​​(C), Methionine (M) (see, eg, Creighton, Proteins (1984)). In some embodiments, the term "conservative sequence modifications" is used to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing amino acid sequence. The term "optimized" as used herein refers to a nucleotide sequence that has been altered to encode an amino acid sequence using codons that are preferred in the cell or organism of production, generally a eukaryotic cell, e.g., a cell Yeast cell, Pichia cell, Fungal cell, Trichoderma cell, Ovary cell CAC / nn / Lznz / E / Yii Chinese Hamster (CHO) or a human cell. The optimized nucleotide sequence is designed to fully or to the greatest extent possible retain the amino acid sequence originally encoded by the initial nucleotide sequence, which is also known as the parent sequence. The terms percent identical or percent "identity," in the context of two or more nucleic acid or polypeptide sequences, refer to the degree to which two or more sequences or subsequences are the same sequences. Two sequences are identical if they have the same amino acid or nucleotide sequence over the region being compared. Two sequences are substantially identical if two sequences have a specific percentage of nucleotide or amino acid residues that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%). , 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum match over a comparison window, or designated region, measured with one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 30 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more). amino acids) in length. For sequence comparison, typically one sequence acts as a reference sequence, against which the test sequences are compared. When using a sequence comparison algorithm, the test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and the program parameters of the sequence algorithm are designated. The program's default parameters can be used or alternative parameters can be designated. The sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters. A "comparison window," herein, includes reference to a segment of any of the contiguous positions selected from the group consisting of 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 where a sequence it can be compared to a reference sequence of the same number of contiguous positions once the two sequences are optimally aligned. Sequence alignment methods for comparison are well known in the art. Optimal sequence alignment for comparison purposes can be performed, for example, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c (1970), using the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by searching the similarity method of Pearson and Lipman (1988) Proc. nati. Acad. CAC / nn / Lznz / E / Yu Sci. USA 85:2444, by computer implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wl), or by manual alignment and inspection visual (see, for example, Brent et al., Current Protocols in Molecular Biology, 2003). Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. J. Mol. Biol. 215:403-410, 1990, respectively. The software for performing BLAST analysis is public and can be accessed through the National Center for Biotechnology Information. This algorithm involves first identifying high-scoring sequence (HSP) pairs by identifying short words of length W in the query sequence that match or satisfy a threshold score of positive value T when aligned with a word in the query sequence. same length in a sequence in the database. T is called the neighbor word score threshold (Altschul et al., Supra). These initial neighborhood word matches act as seeds to initiate searches to find longer HSPs containing them. Word matches are extended in both directions along each sequence until the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatched residues; always < 0). For amino acid sequences, a scoring matrix is ​​used to calculate the cumulative score. The spread of word matches in each direction stops when: the cumulative alignment score drops by the amount X from its maximum reached value; the cumulative score goes to zero or less, due to the accumulation of one or more negative-scoring residue alignments; or the end of any of the sequences is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) defaults to a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program defaults to a wordlength of 3 and an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Nati. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both chains. The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, for example, Karlin and Altschul, Proc. Nati. Acad. Sci. USA 90:5873-5787, 1993). A measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability that a match will occur between two sequences of data. CRC / nn / Lznz / E / Yii nucleotides or amino acids by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and even more preferably less than about 0.001. Percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci. 4: 11-17 (1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residual table, a gap length penalty of 12, and a gap penalty of 4. In addition, the percentage of Identity between two amino acid sequences can be determined using the algorithm of Needleman and Wunsch, J. Mol. Biol. 48: 444-453 (1970) which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a BLOSUM62 matrix or a PAM250 matrix, and a gap weight of 16, 14,12,10, 8, 6, or 4 and a length weight of 1,2, 3, 4, 5, or 6. In addition to the percent sequence identity noted above, another indication that two nucleic acid or polypeptide sequences are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with antibodies generated against the polypeptide encoded by the first nucleic acid. second nucleic acid, as described below. Thus, one polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence. The term nucleic acid is used herein interchangeably with the term polynucleotide and refers to deoxyribonucleotides or ribonucleotides and their polymers in single-stranded or double-stranded form. The term encompasses nucleic acids that contain known nucleotide analogs or modified backbone residues or linkages, that are synthetic, natural, and non-natural, that have similar binding properties to the reference nucleic acid, and that are metabolized in a similar manner to nucleotides. reference. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methylphosphonates, chiral-methylphosphonates, 2-O-methyl ribonucleotides, peptidenucleic acids (PNAs). Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (eg, degenerate codon substitutions) and complementary sequences, as well as the explicitly indicated sequence. CRC / nn / Lznz / E / Yii Specifically, as discussed below, degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more (or all) of selected codons is replaced by mixed base and / or deoxyinosine residues (Batzer et al., (1991) Nucleic Acid Res. 19:5081, Ohtsuka et al., (1985) J. Biol. Chem. 260:2605-2608, and Rossolini et al., (1994) Mol. Cell. Probes 8:91-98). The term "operably linked" in the context of nucleic acids refers to a functional relationship between two or more segments of polynucleotides (eg, DNA). Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcript sequence. For example, a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates transcription of the coding sequence in an appropriate host cell or other expression system. In general, promoter transcriptional regulatory sequences that are operably linked to a transcript sequence are physically contiguous with the transcript sequence, ie, they act in cis. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous or located near the coding sequences whose transcription they enhance. The terms polypeptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residues is an artificial chemical mimetic of a corresponding natural amino acid, as well as to natural amino acid polymers and non-natural amino acid polymers. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof. The term "antibody-drug conjugate" or "immunoconjugate" as used herein refers to the binding of an antibody or antigen-binding fragment thereof to another agent, such as a chemotherapeutic agent, toxin, immunotherapeutic agent, imaging probe and the like. The bond can be made up of covalent bonds or non-covalent interactions, such as through electrostatic forces. Various linkers, known in the art, can be employed to form the antibody-drug conjugate. In addition, the antibody-drug conjugate can be provided in the form of a fusion protein that can be expressed from a polynucleotide encoding the immunoconjugate. As used herein, "fusion protein" refers to proteins created through the joining of two or more genes or gene fragments that originally encoded separate proteins (including peptides and polypeptides). Translation of the fusion gene results in a single protein with functional properties derived from each of the original proteins. pRC / nn / Lznz / B / Yi The term "subject" includes human and non-human animals. Non-human animals include all vertebrates, eg, mammals and non-mammals, such as non-human primates, sheep, dogs, cows, chickens, amphibians, and reptiles. Except where indicated, the terms patient and subject are used interchangeably herein. The term cytotoxin, or cytotoxic agent as used herein, refers to any agent that is detrimental to the growth and proliferation of cells and can act to reduce, inhibit, or kill a cell or malignancy. The term anticancer agent herein refers to any agent that can be used to treat or prevent a cell proliferative disorder such as cancer, including but not limited to, cytotoxic agents, chemotherapeutic agents, radiation therapy and radiotherapeutic agents, anticancer agents targeted and immunotherapeutic agents. The term drug moiety or payload herein refers to a chemical moiety that is conjugated to an antibody or antigen-binding fragment of the invention, and can include any therapeutic or diagnostic agent, for example, an agent anticancer, anti-inflammatory, anti-infective (eg, antifungal, antibacterial, antiparasitic, antiviral), or anesthetic. For example, the drug moiety can be an anticancer agent, such as a cytotoxin. In certain embodiments, a drug moiety is a target inhibitory compound. In addition, a payload can be a biophysical probe, a fluorophore, a spin tag, an infrared probe, an affinity probe, a chelator, a spectroscopic probe, a radioactive probe, a lipid molecule, a polyethylene glycol, a polymer, a spin tag, DNA, RNA, a protein, a peptide, a surface, an antibody, an antibody fragment, a nanoparticle, a quantum dot, a liposome, a PLGA particle, a saccharide or a polysaccharide. In some embodiments, the drug moiety or payload is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In some embodiments, a GNAQ / 11 inhibitor is a molecule that inhibits GNAQ / 11-mediated IP3 production and / or exhibits a dose-responsive antiproliferative effect in cells dependent on GNAQ / 11 signaling (i.e., GNAQ / 11 mutant uveal melanoma cells). In some embodiments, a GNAQ / 11 inhibitor is a compound that stabilizes GNAQ / 11 in the inactive GDP-binding state and prevents GDP release, or binds in the active GDP-binding state and prevents GNAQ / 11 interaction. 11 with the effectors downstream. In some embodiments, a GNAQ / 11 inhibitor functions by inhibiting a GNAQ and / or GNA11 mutant, such as one comprising a Q209L / P mutation. Methods for joining such drug moieties to a linker compatible with the targeting moiety are provided herein, along with methods known in the art. CRC / nn / Lznz / E / Yii See, for example, Singh et al., (2009) Therapeutic Antibodies: Methods and Protocols, vol. 525, 445457. GNAQ (G guanine nucleotide binding protein G(q) alpha subunit, also known as CMC1, G-ALPHA-q, GAQ, SWS, and G protein q alpha subunit) and GNA11 (G protein q subunit alpha 11). guanine nucleotide binding protein, also known as FBH, FBH2, FHH2, GNA11, HHC2, HYPOC2, and G protein subunit alpha 11) are closely related GTPases that constitute heterotrimeric G protein α-subunits that act downstream of G protein-coupled receptors (GPCRs). The α subunits act as a switch for the activation of G proteins by exchanging guanosine diphosphate (GDP) for guanosine triphosphate (GTP), leading to the activation of various downstream effectors. Activation is terminated by intrinsic GTPase activity, as GTP is hydrolyzed to GDP (Van Raamsdonk et al., 2010, N Engl J Med.; 363(23):2191-9). Classic activation of the Gq protein cascade occurs via phospholipase C-β (PLC-β), which hydrolyzes the phospholipase phosphatidylinositol 4,5bisphosphate to release two potent second messengers: D-myoinositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). Following the transient increase in intracellular Ca2+, IP3 is rapidly transformed into IP2, IP1, and myo-inositol. On the other hand, DAG activates protein kinase C (PKC), leading to a phosphorylation cascade of RAF, MEK, and ERK, which is translocated to the nucleus to regulate cell proliferation and survival. (Krantz et al, 2017, Clin OphthalmoL; 11:279-289). The nucleic acid and amino acid sequences of human GNAQ are published in GenBank under the following Accession Numbers: NP 002063 (SEQ ID NO: 268) mtlesimacc Iseeakearr indeierqlr rdkrdarrel kllllgtges gkstfikqmr iihgsgysde dkrgftklvy qniftamqam iramdtlkip ykyehnkahaqlvrevdvek 121 vsafenpyvd aikslwndpg iqecydrrre yqlsdstkyy Indldrvadp aylptqqdvl 181 rvrvpttgii eypfdlqsvi frmvdvggqr serrkwihcf envtsimflv alseydqvlv 241 esdnenrmee skalfrtiit ypwfqnssvi Iflnkkdlle ekimyshlvd yfpeydgpqr 301 daqaarefil kmfvdlnpds dkiiyshftc atdtenirfv faavkdtilq Inlkeynlv NM 002072 (SEQ ID NO: 269) agactatccg ctcccaccgc gcccccggcc cacctggtgg ccccggccct ggccgccgcc cccgcggcgg ttcccggagc tcgtcccgga cgcgcgcccg ggcggcgggg gctcggcggc pAC / nn / Lznz / E / Yii 121 caccgctgcc tcgggggagc gagggcggga gggtgtgtgt gcgcgctgtg agcagggggt 181 gccggcgggg ctgcagcgga ggcactttgg aagaatgact ctggagtcca tcatggcgtg 241 ctgcctgagc gaggaggcca aggaagcccg gcggatcaac gacgagatcg agcggcagct 301 ccgcagggac aagcgggacg cccgccggga gctcaagctg ctgctgctcg ggacaggaga 361 gagtggcaag agtacgttta tcaagcagat gagaatcatc catgggtcag gatactctga 421 tgaagataaa aggggcttca ccaagctggt gtatcagaac atcttcacgg ccatgcaggc 481 catgatcaga gccatggaca cactcaagat cccatacaag tatgagcaca ataaggctca 541 tgcacaatta gttcgagaag ttgatgtgga gaaggtgtct gcttttgaga atccatatgt 601 agatgcaata aagagtttat ggaatgatcc tggaatccag gaatgctatg atagacgacg 661 agaatatcaa ttatctgact ctaccaaata ctatcttaat gacttggacc gcgtagctga 721 ccctgcctac ctgcctacgc aacaagatgt gcttagagtt cgagtcccca ccacagggat 781 catcgaatac ccctttgact tacaaagtgt cattttcaga atggtcgatg tagggggcca 841 aaggtcagag agaagaaaat ggatacactg ctttgaaaat gtcacctcta tcatgtttct 901 agtagcgctt agtgaatatg atcaagttct cgtggagtca gacaatgaga accgaatgga 961 ggaaagcaag gctctcttta gaacaattat cacatacccc tggttccaga actcctcggt 1021 tattctgttc ttaaacaaga aagatcttct agaggagaaa atcatgtatt cccatctagt 1081 cgactacttc ccagaattg atggacccca gagagatgcc caggcagccc gagaattcat 1141 tctgaagatg ttcgtggacc tgaacccaga cagtgacaaa attatctact cccacttcac 1201 gtgcgccaca gacaccgaga atatccgctt tgtctttgct gccgtcaagg acaccatcct 1261 ccagttgaac ctgaaggagt acaatctggt ctaattgtgc ctcctagaca cccgccctgc 1321 ccttccctgg tgggctattg aagatacaca agagggactg tatttctgtg gaaaacaatt 1381 tgcataatac taatttattg ccgtcctgga ctctgtgtga gcgtgtccac agagtttgta 1441 gtaaatatta tgattttatt taaactattc agaggaaaaa cagaggatgc tgaagtacag 1501 tcccagcaca tttcctctct atcttttttt taggcaaaac cttgtgactc agtgtatttt 1561 aaattctcag tcatgcactc acaaagataa gacttgtttc tttctgtctc tctctctttt 1621 tcttttctat ggagcaaaac aaagctgatt tccctttttt cttcccccgc taattcatac 1681 ctccctcctg atgtttttcc caggttacaa tggcctttat cctagttcca ttcttggtca 1741 agtttttctc tcaaatgata cagtcaggac acatcgttcg atttaagcca tcatcagctt 1801 aatttaagtt tgtagttttt gctgaaggat tatatgtatt aatacttacg gttttaaatg 1861 tgttgctttg gatacacaca tagtttcttt tttaatagaa tatactgtct tgtctcactt 1921 tggactggga cagtggatgc ccatctaaaa gttaagtgtc atttctttta gatgtttacc 1981 ttcagccata gcttgattgc tcagagaaat atgcagaagg caggatcaaa gacacacagg 2041 agtcctttct tttgaaatgc cacgtgccat tgtctttcct cccttctttg cttctttttc 2101 ttaccctctc tttcaattgc agatgccaaa aaagatgcca acagacacta cattacccta CRC / nn / Lznz / E / Yl· 2161 atggctgcta cccagaacct ttttataggt tgttcttaat ttttttgttg ttgttgttca 2221 agcttttcct ttcttttttt tcttggtgtt tgggccacga ttttaaaatg acttttatta 2281 tgggtatgtg ttgccaaagc tggctttttg tcaaataaaa tgaatacgaa cttaaaaaat 2341 aaaagctggt atcttaaaat gtaagagagt aagactgtga agcctaaaat gactggctga 2401 gaatgaacca gaaatgccat ttgccaaaca gttgtaacta gaaatttgat tctcacggtc 2461 cattcttttc tttgtcctta agatgacatt gttagtgttc acgtcccatg ttcagtgtcc 2521 aaaccggcaa tgtaaaaagt atcctgtgtg gtttaacagg aaatctgttt atgtctcttt 2581 atttgaaacc agttttactc tcagtggttc tttaagttca atgaagtctg ccaggaacat 2641 tggttggtag tattattccg acacctttaa tttccaaaat ctgaagttcc tgctagttta 2701 ccaccttcat gatcttcttg aactggtaac tgattaggtt gaacttatgg aagatttgtg 2761 gacttaactc aaaagtaacc tctcagtgtt ctatagaaca tgtatttgtg taactgaacc 2821 taccaggaga aatgtttgga attctatatg tgcaattttt caacaaatgc aaaaaaaata 2881 cagcacatgt attgacaagc ttctgtcaag cagcttgagt tgaaatttga tttaagaaaa 2941 taaatcatga ttgttcaaag ctgctgggac gttagaatta ggccatgata ctggtctcat 3001 tttaactaca gtggtatttg gcactagtgt aaacttccat ataaatcact cttttggaac 3061 aacaaagggg gagggagaaa aatcacggcc tgttaaatga gtaccaaagc cgcccaacag 3121 taatgagatg ttctcatcct tgattctccc agcctcaaac aacacagctt actttttttt 3181 tcccttgctc agaaagtacc tgtaatttaa caaacagact gcctgtaggt atagtgcaat 3241 tacaaatgct ctaatcattg tacatacatc tctcttgata ttgcagcatc catactggct 3301 ttgtaatcat taattttttg gcagattgaa tgtgctgtat tgatatgtat ctatgtaatt 3361 gtattgtatg tctatagcta attcacgttt tgaataatgt tattttattt actttttttaa 3421 gagaggagaa tgtaaatttg tcagtttatt tctgactagg gatattttct ttccattag 3481 aaaagaagaa aaaaaaaaaa ccttactgtc atacagagcg gtactagcgt cgtgctgtat 3541 aaaatcattt gcacattcct gagtagaggt atactgatta taagacccaa aggtaatttc 3601 atagcaaaat acataaaatc agtcggagct tttatacaaa catggaaacc aactttgtag 3661 aacttttgcc atttgatcta ggattggaat atgagctttt atacaattca tattcttatt 3721 tggcaaatgc acagtttagt attacctctc tgatggcctt tactagaaag gcagttttag 3781 aagctattgt gatccactaa ggaaatgttt taacagctag agaccactgc ttgcctgaaa 3841 gggcgttctt aaatttggtg cagcaaaaaa aaaaaaaaaa aaaaaaaaaa ttaaacaaca 3901 acatttgaag gcctacagtg tgtatagaga aaacctcatc acaagatcat aagtgttaca 3961 gttttaggga atcaagatat tctattttaat agagctatag taaatgtagt caattaaacc 4021 tgatctcaaa gcttgaagaa gctgagcaaa acagggaaag attgttatat ttgtctttat 4081 gaaattggga tggaatttgc tatgcagaat tgaggtttgt ggcttcgctg ttcctgtagg 4141 gtgcatgaca agatcccttc tcttgagaaa ggaaaaaatt gatcacccta gcagcagtga CRC / nn / Lznz / E / Yl· 4201 tgcatagaaa cctaatttta gccacaccag tcaatcgaag ctaaaggatt ttcttttttg 4261 tttcttcggg gttttattga aggggctagg ggcgggacgg gattcttttc agttttgtat 4321 aaaaacaaag tttactcatg ctttatatta tattgtgatt gcaagcgtta taagcgtgtg 4381 ccactggcct cctattgttg atgcttaggt aatggaggcc tgtggtgagt tttatggtga 4441 cttgggcatg tcttattcaa aaacaaaaac ataaaacaca gaaacctttc ttcagcatac 4501 caaggcaagc agccatttca tgactcactt aacacattgc agtgtaccag tttacagatg 4561 atttttccct ttttgcgtga catggcagtt ctaaccccca gagaattcct tatttgtaaa 4621 ttggaagttt ctactatgcc ttacagagct taaattcaga agtttgtgcc tcatatctga 4681 aacaaaggga aataacacac ccattcaaaa gtaaataaat ctcctagaag tttttgtttt 4741 taacatttcc atataaagag ctctgttgaa tgtcatgaat agactggaaa aaaaaatttt 4801 aagaacctgc atatgttgtt tactagcaga tgacaactac aaaaggaatc tgaagaacac 4861 gtaaaacttg tattttttt tttttggtag attaactagc aggcctattt taaaaaggta 4921 attcagctaa agggcaattt acttttttgt acttcagact atcttgattg tcaaagtgta 4981 cgaactgtaa ttttaaaatt tatactgcca catgattgta aattttagtt gtcttaagtt 5041 aggaattggt gaaaagctat ttatgctgga tttgggtcaa aatgacttat ttgcaaaaaa 5101 ataaataatg ggaagaaagg gctgtataat gaaatactgc aagactcaca tattggttgg 5161 aaatttccct caaatcacct accgattacc cttgatttcc ctttgttttc agtttctcaa 5221 aacgaatgaa atgaaatata gcagaatgtt aacccatata aaaataaagt gtacccaaat 5281 attgtaatgt atattgctgc tcttcttcaa attaaataag ggtttaaaac cacttaattg 5341 gtaatcaaca tctcaattga tacaaataag gtgtgcttgg tatacattaa tattttcttc 5401 caaagatata tctttggtta gaaacacaaa aaaataaaac tagtaatatt gtatgtttat 5461 ctatctctac atatttccag catatgtagc gttaatagat ctgtcctggt aactgtgtct 5521 ttgggatttc attttggttc catcaaatta ggaaaagaaa tggcttagtt gtatatgatt 5581 agctagagat ttttggagcc agacacctgc tgtttagtag ataacttagt acagacccta 5641 aacttgtcat ttgtttttct cacagaatag ccatttcctg ctgtcttccc aatgatcact 5701 gccctttcaa taacactctt gcctctagaa tcatatgttc aaagtatgaa tacacaccta 5761 gcacatagta ggtgctcaaa tattaatttc ctccttgcct tccttatcta ccctgtgtcc 5821 tccatttccc cgtatgattc caacccaata tagcaaatga catttacatg ttatgaaaac 5881 atctattggg taaaatcaga tcttggataa agaaattctg acttttatat aagcttttgg 5941 tagacagaaa aaacagaaag gtattcgttg gtagaacatt tttaagttca ggaaagaaag 6001 ctggaataat actacgtaac tttgtccagg ttactttgac tgaaacacgt ttttggtgga 6061 tttcttttcc tcaaagaact ctctaaatgc aactccttgc tggattcctc acccatcatc 6121 ctgttggaaa cccttactag acctatgtat ttagggagtt ttgtcagaaa acatttttaa 6181 cttgcagtat ttaaaagaat atttactgtt cctaaaatgt cattcaaatg catgtactgt 6241 ctattgtttg gggatgggaa ctagttttgc aaaaaacacc taatgttgta taataatgcc 6301 ccaatgatct tgctggttaa aaatacagta tttttggcca taa The nucleic acid and amino acid sequence of human GNA11 are published in the Gen Bank under the following Accession Numbers:: NP 002058 (SEQ ID NO: 270) mtlesmmacc Isdevkeskr inaeiekqlr rdkrdarrel kllllgtges gkstfikqmr iihgagysee dkrgftklvy qniftamqam irametlkil ykyeqnkana llirevdvek 121 vttfehqyvs aiktlwedpg iqecydrrre yqlsdsakyy ltdvdriatl gylptqqdvl 181 rvrvpttgii eypfdlenii frmvdvggqr serrkwihcf envtsimflv alseydqvlv 241 esdnenrmee skalfrtiit ypwfqnssvi Iflnkkdlle dkilyshlvd yfpefdgpqr 301 daqaarefil kmfvdlnpds dkiiyshftc atdtenirfv faavkdtilq Inlkeynlv NM 002067 (SEQ ID NO: 271) aggttgtccg gcgctgtcgc tcggttgcgg cggctgcggt tggcggtggc tgcggcggcg gcgcgggctg agtgcggccg cgcgggagtc cgcggctggc gcggcccgag cggggacccg 121 gcggctcgcc aggcggcggc cgaggcgggg cgggccggcc cggggccgag ggccggtggc 181 cgaggccgga gggccgcggc gggcggcggc cgaggcggct ccggccaggg ccgggccggg 241 ggccgggggg cggcggcggg caggcggccg cgtcggccgg ggccggggacg atgactctgg 301 agtccatgat ggcgtgttgc ctgagcgatg aggtgaagga gtccaagcgg atcaacgccg 361 agatcgagaa gcagctgcgg cgggacaagc gcgacgcccg gcgcgagctc aagctgctgc 421 tgctcggcac gggcgagagc gggaagagca cgttcatcaa gcagatgcgc atcatccacg 481 gcgccggcta ctcggaggag gacaagcgcg gcttcaccaa gctcgtctac cagaacatct 541 tcaccgccat gcaggccatg atccgggcca tggagacgct caagatcctc tacaagtacg 601 agcagaacaa ggccaatgcg ctcctgatcc gggaggtgga cgtggagaag gtgaccacct 661 tcgagcatca gtacgtcagt gccatcaaga ccctgtggga ggacccgggc atccaggaat 721 gctacgaccg caggcgcgag taccagctct ccgactctgc caagtactac ctgaccgacg 781 ttgaccgcat cgccaccttg ggctacctgc ccacccagca ggacgtgctg cgggtccgcg 841 tgcccaccac cggcatcatc gagtaccctt tcgacctgga gaacatcatc ttccggatgg 901 tggatgtggg gggccagcgg tcggagcgga ggaagtggat ccactgcttt gagaacgtga 961 catccatcat gtttctcgtc gccctcagcg aatacgacca agtcctggtg gagtcggaca CRC / nn / Lznz / E / Yii 1021 acgagaaccg gatggaggag agcaaagccc tgttccggac catcatcacc tacccctggt 1081 tccagaactc ctccgtcatc ctcttcctca acaagaagga cctgctggag gacaagatcc 1141 tgtactcgca cctggtggac tacttccccg agttcgatgg tccccagcgg gacgcccagg 1201 cggcgcggga gttcatcctg aagatgttcg tggacctgaa cc ccgacagc gacaagatca 1261 tctactcaca cttcacgtgt gccaccgaca cggagaacat ccgcttcgtg ttcgcggccg 1321 tgaaggacac catcctgcag ctcaacctca aggagtacaa cctggtctga gcgcccaggc 1381 ccagggagac gggatggaga cacggggcag gaccttcctt ccacg gagcc tgcggctgcc 1441 gggcgggtgg cgctgccgag tccgggccgg ggcctctgcc cgcgggagga gatttttttt 1501 tttcatattt ttaacaaatg gtttttattt cacagttatc aggggatgta catctctccc 1561 tccgtacact tcgcgcacct tctcaccttt tgtcaacggc aaaggcagcc tttttctggc 1621 cttgacttat ggctcgcttt tttctaaaaa aaaaaaaaaa agaaagaaag aaaaaaagca 1681 acgaaacata aaacacacaa gcgccccgtg cccccagtga ctctgggcct cacagagccc 1741 ccgccagcca gcatggggcc ccgccctgca gccagtcacg cgcccccaca ccgcagcccc 1801 ccgtggctgt ccttccaacc ccacgtgctt tttctttctc ct gcccgctt cttttcttca 1861 tcacaaaagg cgtggagact cggagacgga cgtttttccc cttttttaag ttattgacgc 1921 ccagcgcgcc tcgcctcttc acccatcaac gctgtgcttt gcccactgga ctcctgaaga 1981 gggggtgggg ggctccctcg gtcgcccacc ctgggaagtg cctaaccttt tattttattt 2041 tatttttttg aggaaaaaga acgcctgact cacaggttga agaaacaccc tgggccctct 2101 ctcatggccg ggttccccgt ccctctgcag aggctgggaa gggtccccgg gctggagcca 2161 cgggggcttc tctgggctgt gcctccgggg ccaacactgg ctgcttgggg ctgcccgggg 2221 actccagagg gctgcacggc caccctgccc tggctagagc gcaccccacc ggagcccacg 2281 tgggctgggc ggctggaggg atggtccccc ggtgacactg ggagaaaggc cacttggatg 2341 ggggcgtttc tgttttgttc cgctttgtga tgtcaccaat ttggaaacag cgagggtggg 2401 tggggacttt tacagaatat tctcaggtgt gtacccgaga ggcagagaga gggacgtggc 2461 cggcagctct gtgcgtggcc ttgtcccaag cacttgcgcc cgcccccgag cgccgccccc 2521 ggggagcggg aagccagcac tcgcactttg gccaggggcg cgtggaaggt ggtggcaggc 2581 accggcctgg gcagcttcca ggcctggctg gccacgacca cggcccgagg gggagcccgc 2641 caggccacgc cgcactgagc cacagccccg ggggccgcct c ccggggccc cttgaggcac 2701 tgaggcaccg agactggttc tccccgagag actcggaagg tggggaacga ggggactgtg 2761 tttggggagg tggctttttc gtctgctgtt gactgaacac tacagcgccc tgtggttccg 2821 ggcttcgcac agctgtccca gggatggatc gcctgtgctg ccttcgcccg ccgccacacc 2881 gggaccctgc acggctgctt ctggcctcga cagatgacaa aagaaacagc cccaaaatac 2941 gaccactcca accagcagtt cccgcctgcc tgcccgccac tgtcaggcct gccctggcct 3001 cctcgtccgc agggctgtct gctggcttct gggggcagaa gagcggggag ccccgtggaa CRC / nn / Lznz / E / Yii 3061 gggtcagggg agaccaggtc agggcagcta catttctggt gatcagcccc atggggagac 3121 ggggctggcg ggataccccc cccccggctt cccacacca cttctgtctc acccggaagc 3181 gtcctttttt tgtgccaggt gtctacctaa gagggttggt gccagaagcc ccccatggcg 3241 agtgctgggg cccggcggtg ccctggggga gcagatgggg ccacccctgg cagggccgct 3301 acaacctttt ccagcagcgg agccctctgg ggggcctgtg cttgtggcat ctctgagggc 3361 ctagattgca caaggtgacc tggccgtggc ctgagggtgg agtcgcccag cacgcaggcc 3421 ggggcgctgc ggggctaagt attaggcctt cccagggagg gggcgtgcca agcatcccag 3481 agccgggctg ggaccgccaa aacgtcgtgg cctggatcct ctgggtctga gtgcctgatc 3541 ccctgccccc caaaaaagca gaggtaggtg ttgcaggccc agggcagggg tgcctgcccc 3601 aggagagtcc caggcagtgg ttctcgtgcc agtggcaccc aggggcaagg acagccaacc 3661 cccacccttg ccacgtgtgg ggccacgtgg gcatgtgggg tgtgtgtttt taccttggtg 3721 aatctcacct gccaacgatt tctcgtgagt gccgaccacc ttctccgacc atgttacgcc 3781 cgggcggcag cagcccccgg ccactgcaaa cccatgccct gggtcccccg gctcccccag 3841 ggaggcatcc ccgtgccaat gtcccccagt ggtggcagca gatcctgtgg ccggcctggc 3901 ggacgggacc cagtgatact tgtatattac acagtcctga tttcagacaa tttcaacctt 3961 aatctattta aaaaagaata ttctatacaa gctgttttta agccttttac catttgaaat 4021 gcatgtgttg tgcgcgttgg ggatgggagg aggggctgag gagcggctca gtgtcacctc 4081 ccacagccac cggccctgac ccttaatcca gacaccgatg gaagtcgact tttcatatct 4141 ttctcctgaa atgaactctg ttttaaattg gaataaattt tgttcctaaa “Tumor” refers to the growth and proliferation of neoplastic cells, whether malignant or benign, and all precancerous and cancerous cells and tissues. The term antitumor activity refers to a reduction in the rate of tumor cell proliferation, viability, or metastatic activity. For example, antitumor activity can be demonstrated through a decrease in the growth rate of abnormal cells arising during therapy or stability or reduction in tumor size, or increased survival due to therapy compared to control without. therapy. Such activity can be assessed using accepted in vitro or in vivo tumor models, including but not limited to xenograft models, allograft models, MMTV models, and other known models available in the art for investigating antitumor activity. The term malignancy refers to a non-benign tumor or cancer. As used herein, the term cancer includes a malignant neoplasm characterized by unregulated or uncontrolled cell growth. Examples of cancers include: carcinomas, sarcomas, leukemias, and lymphomas. CAC / nn / Lznz / E / Yii The term "cancer" includes primary malignant tumors (for example, those whose cells have not migrated to sites in the subject's body other than the original tumor site) and secondary malignant tumors (for example, those that arise from metastases, the migration of tumor cells to secondary sites that are different from the original tumor site). The term "PMEL17" (also denoted as premelanosome protein (PMEL), D12S53E, ME20, ME20-M, ME20M, P1, P100, gp100, SI, SIL, and silver locus protein homologue (SILV) refers to a single-pass Type I transmembrane protein produced by melanocytes and involved in melanin synthesis.The nucleic acid and amino acid sequence of human PMEL17 are published in GenBank under the following Accession Numbers: NP 008859, NP 001307050, NP 001307051 , NP_001186982, NP_001186983 (amino acid sequences), and NM_006928, NM 001200053, NM_001200054, NM_001320121, NM_001320122 (nucleotide sequences). ” is used to refer collectively to all naturally occurring isoforms of the PMEL17 protein, or a variant thereof. NP 008859 (SEQ ID NO: 272) mdlvlkrcll hlavigalla vgatkvprnq dwlgvsrqlr tkawnrqlyp ewteaqrldc wrggqvslkv sndgptliga nasfsialnf pgsqkvlpdg qviwvnntii ngsqvwggqp 121 vypqetddac ifpdggpcps gswsqkrsfv yvwktwgqyw qvlggpvsgl sigtgramlg 181 thtmevtvyh rrgsrsyvpl ahsssaftit dqvpfsvsvs qlraldggnk hflrnqpltf 241 alqlhdpsgy laeadlsytw dfgdssgtli sralvvthty lepgpvtaqv vlqaaiplts 301 cgsspvpgtt dghrptaeap nttagqvptt evvgttpgqa ptaepsgtts vqvpttevis 361 tapvqmptae stgmtpekvp vsevmgttla emstpeatgm tpaevsivvl sgttaaqvtt 421 tewvettare Ipipepegpd assimstesi tgslgplldg tatlrlvkrq vpldcvlyry 481 gsfsvtldiv qgiesaeilq avpsgegdaf eltvscqggl pkeacmeiss pgcqppaqrl 541 cqpvlpspacqlvlhqilkg gsgtyclnvs ladtnslavv stqlimpgqe aglgqvpliv 601 gillvlmavv lasliyrrrl mkqdfsvpql phssshwlrl prifcscpig enspllsgqq 661v NP 001307050 (SEQ ID NO: 273) mdlvlkrcll hlavigalla vgatkvprnq dwlgvsrqlr tkawnrqlyp ewteaqrldc wrggqvslkv sndgptliga nasfsialnf pgsqkvlpdg qviwvnntii ngsqvwggqp 121 vypqetddac ifpdggpcps gswsqkrsfv yvwktwgqyw qvlggpvsgl sigtgramlg 181 thtmevtvyh rrgsrsyvpl ahsssaftit dqvpfsvsvs qlraldggnk hflrnqpltf CRC / nn / Lznz / E / Yii 241 alqlhdpsgy laeadlsytw dfgdssgtli sralvvthty lepgpvtaqv vlqaaiplts 301 cgsspvpgtt dghrptaeap nttagqvptt evvgttpgqa ptaepsgtts vqvpttevis 361 tapvqmptae staaqvttte wvettarelp ipepegpdas simstesitg slgplldgta 421 tlrlvkrqvp Idcvlyrygs fsvtldivqg iesaeilqav psgegdafel tvscqgglpk 481 eacmeisspg cqppaqrlcq pvlpspacql vlhqilkggs gtyclnvsla dtnslavvst 541 qlimpvpgil Itgqeaglgq vplivgillv Imavvlasli yrrlmkqdf svpqlphsss 601 hwlrlprifc scpigenspl Isgqqv NP 001307051 (SEQ ID NO: 274) mdlvlkrcll hlavigalla vgatkvprnq dwlgvsrqlr tkawnrqlyp ewteaqrldc wrggqvslkv sndgptliga nasfsialnf pgsqkvlpdg qviwvnntii ngsqvwggqp 121 vypqetddac ifpdggpcps gswsqkrsfv yvwktwgqyw qvlggpvsgl sigtgramlg 181 thtmevtvyh rrgsrsyvpl ahsssaftit dqvpfsvsvs qlraldggnk hflrnqpltf 241 alqlhdpsgy laeadlsytw dfgdssgtli sralvvthty lepgpvtaqv vlqaaiplts 301 cgsspvpgtt dghrptaeap nttagqvptt evvgttpgqa ptaepsgtts vqvpttevis 361 tapvqmptae staaqvttte wvettarelp ipepegpdas simstesitg slgplldgta 421 tlrlvkrqvp Idcvlyrygs fsvtldivqg iesaeilqav psgegdafel tvscqgglpk 481 eacmeisspg cqppaqrlcq pvlpspacql vlhqilkggs gtyclnvsla dtnslavvst 541 qlimpgqeag Igqvplivgi llvlmavvla sliyrrrlmk qdfsvpqlph ssshwlrlpr 601 ifcscpigen spllsgqqv NP 001186982 (SEQ ID NO: 275) mdlvlkrcll hlavigalla vgatkgsqvw ggqpvypqet ddacifpdgg pcpsgswsqk rsfvyvwktw gqywqvlggp vsglsigtgr amlgthtmev tvyhrrgsrs yvplahsssa 121 ftitdqvpfs vsvsqlrald ggnkhflrnq pltfalqlhd psgylaeadl sytwdfgdss 181 gtlisralvv thtylepgpv taqvvlqaai pltscgsspv pgttdghrpt aeapnttagq 241 vpttevvgtt pgqaptaeps gttsvqvptt evistapvqm ptaestgmtp ekvpvsevmg 301 ttlaemstpe atgmtpaevs ivvlsgttaa qvtttewvet tarelpipep egpdassims 361 tesitgslgp lldgtatlrl vkrqvpldcv lyrygsfsvt Idivqgiesa eilqavpsge 421 gdafeltvsc qgglpkeacm eisspgcqpp aqrlcqpvlp spacqlvlhq ilkggsgtyc 481 Invsladtns lavvstqlim pgqeaglgqv plivgillvl mavvlasliy rrrlmkqdfs 541 vpqlphsssh wlrlprifcs cpigenspll sgqqv CAC / nn / Lznz / E / Yu ΝΡ 001186983 (SEQ ID NO: 276) mdlvlkrcll hlavigalla vgatkvprnq dwlgvsrqlr tkawnrqlyp ewteaqrldc wrggqvslkv sndgptliga nasfsialnf pgsqkvlpdg qviwvnntii ngsqvwggqp 121 vypqetddac ifpdggpcps gswsqkrsfv yvwktwgqyw qvlggpvsgl sigtgramlg 181 thtmevtvyh rrgsrsyvpl ahsssaftit dqvpfsvsvs qlraldggnk hflrnqpltf 241 alqlhdpsgy laeadlsytw dfgdssgtli sralvvthty lepgpvtaqvvlqaaiplts 301 cgsspvpgtt dghrptaeap nttagqvptt evvgttpgqa ptaepsgtts vqvpttevis 361 tapvqmptae stgmtpekvp vsevmgttla emstpeatgm tpaevsivvl sgttaaqvtt 421 tewvettare Ipipepegpd assimstesi tgslgplldg tatlrlvkrq vpldcvlyry 481 gsfsvtldiv qgiesaeilq avpsgegdaf eltvscqggl pkeacmeiss pgcqppaqrl 541 cqpvlpspacqlvlhqilkg gsgtyclnvs ladtnslavv stqlimpvpg illtgqeagl 601 gqvplivgil Ivlmavvlas liyrrrlmkq dfsvpqlphs sshwlrlpri fcscpigens 661 pllsgqqv NM 006928 (SEQ ID NO: 277) cccagcgctc ctccccgcaa atgatcccgc cccaggggcc tatcccagtc cccccagtgc ctttggttgc tggagggaag aacacaatgg atctggtgct aaaaagatgc cttcttcatt 121 tggctgtgat aggtgctttg ctggctgtgg gggctacaaa agtacccaga aaccaggact 181 ggcttggtgt ctcaaggcaa ctcagaacca aagcctggaa caggcagctg tatccagagt 241 ggacagaagc ccagagactt gactgctgga gaggtggtca agtgtccctc aaggtcagta 301 atgatgggcc tacactgatt ggtgcaaatg cctccttctc tattgccttg aacttccctg 361 gaagccaaaa ggtattgcca gatgggcagg ttatctgggt caacaatacc atcatcaatg 421 ggagccaggt gtggggagga cagccagtgt atccccagga aactgacgat gcctgcatct 481 tccctgatgg tggaccttgc ccatctggct cttggtctca gaagagaagc tttgtttatg 541 tctggaagac ctggggccaa tactggcaag ttctaggggg cccagtgtct gggctgagca 601 ttgggacagg cagggcaatg ctgggcacac acaccatgga agtgactgtc taccatcgcc 661 ggggatcccg gagctatgtg cctcttgctc attccagctc agccttcacc attactgacc 721 aggtgccttt ctccgtgagc gtgtcccagt tgcgggcctt ggatggaggg aacaagcact 781 tcctgagaaa tcagcctctg acctttgccc tccagctcca tgaccccagt ggctatctgg 841 ctgaagctga cctctcctac acctgggact ttggagacag tagtggaacc ctg atétete prc? nn / Lznz / E / YiAi 901 gggcacttgt ggtcactcat acttacctgg agcctggccc agtcactgcc caggtggtcc 961 tgcaggctgc cattcctctc acctcctgtg gctcctcccc agttccaggc accacagatg 1021 ggcacaggcc aactgcagag gcccctaaca ccacagctgg ccaagtgcct actacagaag 1081 ttgtgggtac tacacctggt caggcgccaa ctgcagagcc ctctggaacc acatctgtgc 1141 aggtgccaac cactgaagtc ataagcactg cacctgtgca gatgccaact gcagagagca 1201 caggtatgac acctgagaag gtgccagttt cagaggtcat gggtaccaca ctggcagaga 1261 tgtcaactcc agaggctaca ggtatgacac ctgcagaggt atcaattgt g gtgctttctg 1321 gaaccacagc tgcacaggta acaactacag agtgggtgga gaccacagct agagagctac 1381 ctatccctga gcctgaaggt ccagatgcca gctcaatcat gtctacggaa agtattacag 1441 gttccctggg ccccctgctg gatggtacag ccaccttaag gctggtgaag agacaagtcc 1501 ccctggattg tgttctgtat cgatatggtt ccttttccgt caccctggac attgtccagg 1561 gtattgaaag tgccgagatc ctgcaggctg tgccgtccgg tgagggggat gcatttgagc 1621 tgactgtgtc ctgccaaggc gggctgccca aggaagcctg catggagatc tcatcgccag 1681 ggtgccagcc ccctgcccag cggctgtgcc agcctgtgct acccagccca gcctgccagc 1741 tggttctgca ccagatactg aagggtggct cggggacata ctgcctcaat gtgtctctgg 1801 ctgataccaa cagcctggca gtggtcagca cccagcttat catgcctggt caagaagcag 1861 gccttgggca ggttccgctg atcgtgggca tcttgctggt gttgatggct gtggtccttg 1921 catctctgat atataggcgc agacttatga agcaagactt ctccgtaccc cagttgccac 1981 atagcagcag tcactggctg cgtctacccc gcatcttctg ctcttgtccc attggtgaga 2041 acagccccct cctcagtggg cagcaggtct gagtactctc atatgatgct gtgattttcc 2101 tggagttgac agaaacacct atatttcccc cagtcttccc tgggagacta ctattaactg 2161 aaataaatac tcagagcctg aaaaaaaaaaaaaaa CAC / nn / Lznz / E / Yl· NM001200053 (SEQ ID NO: 278) gggcctatcc cagtcccccc agtgcctttg gttgctggag ggaagaacac aatggatctg gtgctaaaaa gatgccttct tcatttggct gtgataggtg ctttgctggc tgtgggggct 121 acaaaaggga gccaggtgtg gggaggacag ccagtgtatc cccaggaaac tgacgatgcc 181 tgcatcttcc ctgatggtgg accttgccca tctggctctt ggtctcagaa gagaagcttt 241 gtttatgtct ggaagacctg gggccaatac tggcaagttc tagggggccc agtgtctggg 301 ctgagcattg ggacaggcag ggcaatgctg ggcacacaca ccatggaagt gactgtctac 361 catcgccggg gatcccggag ctatgtgcct cttgctcatt ccagctcagc cttcaccatt 421 actgaccagg tgcctttctc cgtgagcgtg tcccagttgc gggccttgga tggagggaac 481 aagcacttcc tgagaaatca gcctctgacc tttgccctcc agctccatga ccccagtggc 541 tatctggctg aagctgacct ctcctacacc tgggactttg gagacagtag tggaaccctg 601 atctctcggg cacttgtggt cactcatact tacctggagc ctggcccagt cactgcccag 661 gtggtcctgc aggctgccat tcctctcacc tcctgtggct cctccccagt tccaggcacc 721 acagatgggc acaggccaac tgcagaggcc cctaacacca cagctggcca agtgcctact 781 acagaagttg tgggtactac acctggtcag gcgccaactg cagagccctc tggaaccaca 841 tctgtgcagg tgccaaccac tgaagtcata agcactgcac ctgtgcagat gcca actgca 901 gagagcacag gtatgacacc tgagaaggtg ccagtttcag aggtcatggg taccacactg 961 gcagagatgt caactccaga ggctacaggt atgacacctg cagaggtatc aattgtggtg 1021 ctttctggaa ccacagctgc acaggtaaca actacagagt gggtg gagac cacagctaga 1081 gagctaccta tccctgagcc tgaaggtcca gatgccagct caatcatgtc tacggaaagt 1141 attacaggtt ccctgggccc cctgctggat ggtacagcca ccttaaggct ggtgaagaga 1201 caagtccccc tggattgtgt tctgtatcga tatggttcct tttccgt cac cctggacatt 1261 gtccagggta ttgaaagtgc cgagatcctg caggctgtgc cgtccggtga gggggatgca 1321 tttgagctga ctgtgtcctg ccaaggcggg ctgcccaagg aagcctgcat ggagatctca 1381 tcgccagggt gccagccccc tgcccagcgg ctg tgccagc ctgtgctacc cagcccagcc 1441 tgccagctgg ttctgcacca gatactgaag ggtggctcgg ggacatactg cctcaatgtg 1501 tctctggctg ataccaacag cctggcagtg gtcagcaccc agcttatcat gcctggtcaa 1561 gaagcaggcc ttgggcaggt tccgctgatc gtgggcatct tgctggtgtt gatggctgtg 1621 gtccttgcat ctctg atata taggcgcaga cttatgaagc aagacttctc cgtaccccag 1681 ttgccacata gcagcagtca ctggctgcgt ctaccccgca tcttctgctc ttgtcccatt 1741 ggtgagaaca gccccctcct cagtgggcag caggtctgag tactctcata tgatgctgtg 1801 attttcctgg agttgacaga aacacctata tttcccccag tcttccctgg gagactacta 1861 ttaactgaaa taaatactca gagcctgaaa aaaaaaaaa aa CRC / nn / Lznz / E / Yl· NM 001200054 (SEQ ID NO: 279) gggcctatcc cagtcccccc agtgcctttg gttgctggag ggaagaacac aatggatctg gtgctaaaaa gatgccttct tcatttggct gtgataggtg ctttgctggc tgtgggggct 121 acaaaagtac ccagaaacca ggactggctt ggtgtctcaa ggcaactcag aaccaaagcc 181 tggaacaggc agctgtatcc agagtggaca gaagcccaga gacttgactg ctggagaggt 241 ggtcaagtgt ccctcaaggt cagtaatgat gggcctacac tgattggtgc aaatgcctcc 301 ttctctattg ccttgaactt ccctggaagc caaaaggtat tgccagatgg gcaggttatc 361 tgggtcaaca ataccatcat caatgggagc caggtgtggg gaggacagcc agtgtatccc 421 caggaaactg acgatgcctg catcttccct gatggtggac cttgcccatc tggctcttgg 481 tctcagaaga gaagctttgt ttatgtctgg aagacctggg gccaatactg g caagttcta 541 gggggcccag tgtctgggct gagcattggg acaggcaggg caatgctggg cacacacacc 601 atggaagtga ctgtctacca tcgccgggga tcccggagct atgtgcctct tgctcattcc 661 agctcagcct tcaccattac tgaccaggtg cctttctccg tgagcgtgtc ccagttgcgg 721 gccttggatg gagggaacaa gcacttcctg agaaatcagc ctctgacctt tgccctccag 781 ctccatgacc ccagtggcta tctggctgaa gctgacctct cctacacctg ggactttgga 841 gacagtagtg gaaccctgat ctctcgggca cttgtggtca ctcatactta cctggagcct 901 ggcccagtca ctgcccaggt ggtcctgcag gctgccattc ctctcacctc ctgtggctcc 961 tccccagttc caggcaccac agatgggcac aggccaactg cagaggcccc taacaccaca 1021 gctggccaag tgcctactac agaagttgtg ggtactacac ctggtcaggc gccaactgca 1081 gagccctctg gaaccacatc tgtgcaggtg ccaaccactg aagtcataag cact gcacct 1141 gtgcagatgc caactgcaga gagcacaggt atgacacctg agaaggtgcc agtttcagag 1201 gtcatgggta ccacactggc agagatgtca actccagagg ctacaggtat gacacctgca 1261 gaggtatcaa ttgtggtgct ttctggaacc acagctgca c aggtaacaac tacagagtgg 1321 gtggagacca cagctagaga gctacctatc cctgagcctg aaggtccaga tgccagctca 1381 atcatgtcta cggaaagtat tacaggttcc ctgggccccc tgctggatgg tacagccacc 1441 ttaaggctgg tgaagagaca agtccccctg gattgtgttc tgtatcgata tggttccttt 1501 tccgtcaccc tggacattgt ccagggtatt gaaagtgccg agatcctgca ggctgtgccg 1561 tccggtgagg gggatgcatt tgagctgact gtgtcctgcc aaggcgggct gcccaaggaa 1621 gcctgcatgg agatctcatc gccagggtgc cagccccct g cccagcggct gtgccagcct 1681 gtgctaccca gcccagcctg ccagctggtt ctgcaccaga tactgaaggg tggctcgggg 1741 acatactgcc tcaatgtgtc tctggctgat accaacagcc tggcagtggt cagcacccag 1801 cttatcatgc ctgtgcctgg gattctt ctc acaggtcaag aagcaggcct tgggcaggtt 1861 ccgctgatcg tgggcatctt gctggtgttg atggctgtgg tccttgcatc tctgatatat 1921 aggcgcagac ttatgaagca agacttctcc gtaccccagt tgccacatag cagcagtcac 1981 tggctgcgtc taccccgcat cttctgctct tgtcccattg gtgagaacag ccccctcctc 2041 agtgggcagc aggtctgagt actctcatat gatgctgtga tt ttcctgga gttgacagaa 2101 acacctatat ttcccccagt cttccctggg agactactat taactgaaat aaatactcag 2161 agcctgaaaa aaaaaaaaaa a NM 001320121 (SEQ ID NO: 280) gggcctatcc cagtcccccc agtgcctttg gttgctggag ggaagaacac aatggatctg gtgctaaaaa gatgccttct tcatttggct gtgataggtg ctttgctggc tgtgggggct 121 acaaaagtac ccagaaacca ggactggctt ggtgtctcaa ggcaactcag aaccaaagcc 181 tggaacaggc agctgtatcc agagtggaca gaagcccaga gacttgactg ctggagaggt 241 ggtcaagtgt ccctcaaggt cagtaatgat gggcctacac tgattggtgc aaatgcctcc 301 ttctctattg ccttgaactt ccctggaagc caaaaggtat tgccagatgg gcaggttatc 361 tgggtcaaca ataccatcat caatgggagc caggtgtggg gaggacagcc agtgtatccc 421 caggaaactg acgatgcctg catcttccct gatggtggac cttgcccatc tggctcttgg 481 tctcagaaga gaagctttgt ttatgtctgg aagacctggg gccaatactg gcaagttcta 541 gggggcccag tgtctgggct gagcattggg acaggcaggg caatgctggg cacacacacc 601 atggaagtga ctgtctacca tcgccgggga tcccggagct atgtgcctct tgctcattcc 661 agctcagcct tcaccattac tgaccaggtg cctttctccg tgagcgtgtc ccagttgcgg 721 gccttggatg gagggaacaa gcacttcctg agaaatcagc ctctgacctt tgccctccag 781 ctccatgacc ccagtggcta tctggctgaa gctgacctct cctacacctg ggactttgga 841 gacagtagtg gaaccctgat ctctcgggca cttgtggtca ctcatactta cctggagcct 901 ggcccagtca ctgcccaggt ggtcctgcag gctgccattc ctctcacctc ctgtggctcc 961 tccccagttc caggcaccac agatgggcac aggccaactg cagaggcccc taacaccaca 1021 gctggccaag tgcctactac agaagttgtg ggtactacac ctggtcaggc gccaactgca 1081 gagccctctg gaaccacatc tgtgcaggtg ccaaccactg aagtcataag cact gcacct 1141 gtgcagatgc caactgcaga gagcacagct gcacaggtaa caactacaga gtgggtggag 1201 accacagcta gagagctacc tatccctgag cctgaaggtc cagatgccag ctcaatcatg 1261 tctacggaaa gtattacagg ttccctgggc cccctgctgg atggtaca gc caccttaagg 1321 ctggtgaaga gacaagtccc cctggattgt gttctgtatc gatatggttc cttttccgtc 1381 accctggaca ttgtccaggg tattgaaagt gccgagatcc tgcaggctgt gccgtccggt 1441 gagggggatg catttgagct gactgtgtcc tgccaaggcg ggctgcccaa ggaagcctgc 1501 atggagatct catcgccagg gtgccagccc cctgcccag c ggctgtgcca gcctgtgcta 1561 cccagcccag cctgccagct ggttctgcac cagatactga agggtggctc ggggacatac 1621 tgcctcaatg tgtctctggc tgataccaac agcctggcag tggtcagcac ccagcttatc 1681 atgcctgtgc ctgggattct tctcacaggt caagaagcag gccttgggca ggttccgctg 1741 atcgtgggca tcttgctggt gttgatggct gtggtccttg catctctgat atataggcgc 1801 agacttatga agcaagactt ctccgtaccc cagttgccac atagcagcag tcactggctg 1861 cgtctacccc gcatcttctg ctcttgtccc attggtgaga acagccccct cctcagtggg 1921 cagcaggtct gagtactctc atatgatgct gtgattttcc tggagtttgac agaaacacct 1981 atatttcccc cagtcttccc tgggagacta ctattaactg aaataaatac tcagagcctg CRC / nn / Lznz / E / Yl· 2041 to NM_001320122 (SEQ ID NO: 281) gggcctatcc cagtcccccc agtgcctttg gttgctggag ggaagaacac aatggatctg 61 gtgctaaaaa gatgccttct tcatttggct gtgataggtg ctttgctggc tgtgggggct 121 acaaaagtac ccagaaacca ggactggctt ggtgtctcaa ggcaactcag aaccaaagcc 181 tggaacaggc agctgtatcc agagtggaca gaagcccaga gacttgactg ctggagaggt 241 ggtcaagtgt ccctcaaggt cagtaatgat gggcctacac tgattggtgc aaatgcctcc 301 ttctctattg ccttgaactt ccctggaagc caaaaggtat tgccagatgg gcaggttatc 361 tgggtcaaca ataccatcat caatgggagc caggtgtggg gaggacagcc agtgtatccc 421 caggaaactg acgatgcctg catcttccct gatggtggac cttgcccatc tggctcttgg 481 tctcagaaga gaagctttgt ttatgtctgg aagacctggg gccaatactg gcaagttcta 541 gggggcccag tgtctgggct gagcattggg acaggcaggg caatgctggg cacacacacc 601 atggaagtga ctgtctacca tcgccgggga tcccggagct atgtgcctct tgctcattcc 661 agctcagcct tcaccattac tgaccaggtg cctttctccg tgagcgtgtc ccagttgcgg 721 gccttggatg gagggaacaa gcacttcctg agaaatcagc ctctgacctt tgccctccag 781 ctccatgacc ccagtggcta tctggctgaa gctgacctct cctacacctg ggactttgga 841 gacagtagtg gaaccctgat ctctcgggca cttgtggtca ctcatactta cctggagcct 901 ggcccagtca ctgcccaggt ggtcctgcag gctgccattc ctctcacctc ctgtggctcc 961 tccccagttc caggcaccac agatgggcac aggccaactg cagaggcccc taacaccaca 1021 gctggccaag tgcctactac agaagttgtg ggtactacac ctggtcaggc gccaactgca 1081 gagccctctg gaaccacatc tgtgcaggtg ccaaccactg aagtcataag cact gcacct 1141 gtgcagatgc caactgcaga gagcacagct gcacaggtaa caactacaga gtgggtggag 1201 accacagcta gagagctacc tatccctgag cctgaaggtc cagatgccag ctcaatcatg 1261 tctacggaaa gtattacagg ttccctgggc cccctgctgg atggtaca gc caccttaagg 1321 ctggtgaaga gacaagtccc cctggattgt gttctgtatc gatatggttc cttttccgtc 1381 accctggaca ttgtccaggg tattgaaagt gccgagatcc tgcaggctgt gccgtccggt 1441 gagggggatg catttgagct gactgtgtcc tgccaaggcg ggctgcccaa ggaagcctgc 1501 atggagatct catcgccagg gtgccagccc cctgcccag c ggctgtgcca gcctgtgcta 1561 cccagcccag cctgccagct ggttctgcac cagatactga agggtggctc ggggacatac 1621 tgcctcaatg tgtctctggc tgataccaac agcctggcag tggtcagcac ccagcttatc 1681 atgcctggtc aagaagcagg ccttg ggcag gttccgctga tcgtgggcat cttgctggtg 1741 ttgatggctg tggtcccttgc atctctgata tataggcgca gacttatgaa gcaagacttc FRCJ nn / I 7Ω7 / Ε / ΥΙΛ 1801 tccgtacccc agttgccaca tagcagcagt cactggctgc gtctaccccg catcttctgc 1861 tcttgtccca ttggtgagaa cagccccctc ctcagtgggc agcaggtctg agtactctca 1921 tatgatgctg tgattttcct ggagttgaca gaaacaccta tatttccccc agtcttccct 1981 gggagactac tattaactga aataaatact cagagcctga The term "variant" refers to a polypeptide that has an amino acid sequence substantially identical to a reference polypeptide, or is encoded by a substantially identical nucleotide sequence, and that is capable of having one or more activities of the reference polypeptide. For example, a variant may have approximately 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater sequence identity to a polypeptide of reference, while retaining one or more activities of the reference polypeptide. As used herein, the terms "treating," "treating," or "treatment" of any disease or disorder refer, in one modality, to ameliorating the disease or disorder (i.e., slowing or stopping or reducing the development of the disease). disease or at least one of its clinical symptoms). In another embodiment, "treating", "treating", or "treatment" refers to alleviating or improving at least one physical parameter including those that cannot be perceived by the patient. In yet another embodiment, "treating," "treating," or "treatment" refers to modulating the disease or disorder, either physically (eg, stabilization of a discernible symptom), physiologically (eg, stabilization of a physical parameter), or both. As used herein, the term "preventing, averting or prevention of any disease or disorder" refers to the prophylactic treatment of the disease or disorder, or delaying the onset or progression of the disease or disorder. The term "therapeutically acceptable amount" or "therapeutically effective dose" refers interchangeably to an amount sufficient to achieve the desired result (i.e., a reduction in tumor size, inhibition of tumor growth, prevention of metastasis, inhibition or prevention of a viral, bacterial, fungal or parasitic infection). In some embodiments, a therapeutically acceptable amount does not induce or cause undesirable side effects. In some embodiments, a therapeutically acceptable amount induces or causes side effects, but only those that are acceptable to physicians considering the patient's condition. A therapeutically acceptable amount can be determined by first administering a low dose and then gradually increasing that dose until the desired effect is achieved. A prophylactically effective dose and a therapeutically effective dose of the molecules of the invention can prevent the onset of, or result in a decrease in the severity of, respectively, symptoms of the disease, including symptoms associated with cancer. CRC / nn / Lznz / E / Yii The term "co-administer" refers to the presence of two active agents in the blood of an individual. Active agents that are co-administered can be administered simultaneously or sequentially. The present invention provides antibodies, antibody fragments (eg, antigen-binding fragments), and drug conjugates thereof, ie, antibody-drug conjugates or ADCs, that bind to PMEL17. In particular, the present invention provides antibodies and antibody fragments (eg, antigen-binding fragments) that bind to PMEL17, and are internalized upon such binding. The antibodies and antibody fragments (eg, antigen-binding fragments) of the present invention can be used to produce antibody-drug conjugates. In addition, the present invention provides antibody-drug conjugates that have desirable pharmacokinetics and other desirable attributes and, therefore, can be used to treat or prevent a cancer that expresses PMEL17. The present invention further provides pharmaceutical compositions comprising the antibody-drug conjugates of the invention, and methods of preparing and using such pharmaceutical compositions for the treatment or prevention of cancer. Rest of drug (D) In one aspect, the Drug (D) moiety of the Antibody-Drug Conjugate of the invention is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In another aspect, the Drug (D) moiety of the Antibody-Drug Conjugate of the invention is a GNAQ inhibitor. In another aspect, the Drug (D) moiety of the Antibody-Drug Conjugate of the invention is a GNA11 inhibitor. In another aspect, the Drug (D) moiety of the Antibody-Drug Conjugate of the invention is an inhibitor of GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In another aspect, the Drug moiety of the Antibody Drug Conjugate of the invention is a compound having the structure of Formula (A): CAC / nn / Lznz / E / Yii prc? nn / Lznz / E / YiA where Ro is methyl or ethyl, Ri is methyl or i-propyl, and R2 is methyl or ethyl. In another aspect, the Drug moiety of the Antibody Drug Conjugate of the invention is compound (A1) having the following structure: (A1). In another aspect, the Drug moiety of the Antibody Drug Conjugate of the invention is compound (A2) having the following structure: (Α2). prcz nn / Lznz / E / YiA In another aspect, the Drug moiety of the Antibody Drug Conjugate of the invention is compound (A3) having the following structure: (A3). Table 1 provides the inhibitory activity of compounds (A1), (A2) and (A3) obtained using the assay described in Example 5. Table 1 Compound GI50 (nM) 92.1 GNAQ Q209L A1 0.467 A2 22.1 Compound GI50 (nM) 92.1 GNAQ Q209L A3 9.3 CAC / nn / Lznz / E / Yii Linker-Drug Moiety (LA-(D)n) In a second aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the The single or more Drug residues are respectively and independently selected from a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the only or more Drug moieties are respectively and independently selected from a GNAQ inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties attached to a linker (LA), wherein the sole or more Drug residues are respectively and independently selected from a GNA11 inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the only or more Drug residues are respectively and independently selected from an inhibitor of GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a cleavable linker and the single or more Drug residues are respectively and independently selected from a GNAQ inhibitor, a GNA11 inhibitor or a GNAQ and GNA11 inhibitor (GNAQ / GNA11 inhibitor). In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a cleavable linker and the single or more Drug residues are respectively and independently selected from a GNAQ inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (La), wherein the linker (LA) is a cleavable linker and the single or more Drug residues are respectively and independently selected from a GNA11 inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a cleavable linker and the single or more Drug residues are respectively and independently selected from a GNAQ and GNA11 inhibitor (GNAQ / GNA11 inhibitor). In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a non-cleavable linker and the single or more Drug residues are respectively and independently selected from a GNAQ inhibitor, a GNA11 inhibitor or a GNAQ and GNA11 inhibitor (GNAQ / GNA11 inhibitor). In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a non-cleavable linker and the single or more Drug residues are respectively and independently selected from a GNAQ inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a non-cleavable linker and the single or more Drug residues are respectively and independently selected from a GNA11 inhibitor. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention comprises one or more Drug moieties covalently attached to a linker (LA), wherein the linker (LA) is a non-cleavable linker and the single or more Drug residues are respectively and independently selected from an inhibitor of GNAQ and GNA11 (GNAQ / GNA11 inhibitor). In another aspect, the linker (LA) of the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention has the following formula: CAC / nn / Lznz / E / Yii where: Xi is an oivalent linking group; X2 is a self-immolation spacer; YO ** . ** % / WVW» , / vw· *V=O Yi is θΗ, OH P=o ooh CRC / nn / Lznz / E / Yu , where the * of Yi indicates the junction point to X2 and the “ of Y1 indicates the other junction point; L1 is a bivalent peptide linker, and L2 is a bond or a linker. In another aspect, the Linker-Drug moiety, ((LA-(D)n))), of the Antibody-Drug Conjugate of the invention has the following formula: V L2 Xj D where: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; X1 is a bivalent linking group; X2 is a self-immolation spacer; YO ** JWWV» I Y1 is oh ** ooh ooh , where the * of Y1 indicates the point of attachment to X2 and the ** of Y1 indicates the point of attachment to D; L1 is a bivalent peptide linker, and L2 is a bond or a linker. Linker-Drug Compounds (Lb-IDW In one aspect the Linker-Drug of the invention is a compound having the structure of Formula (B), or stereoisomers or pharmaceutically acceptable salts thereof, R8-LB-(D)nen where: (B) D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; R8 is a reactive group; Either a linker cleaved it or a linker did not cleave it, and n is 1,2, 3, or 4. In one aspect the Linker-Drug of the invention has the structure of Formula (B), or stereoisomers or pharmaceutically acceptable salts thereof, wherein D is a GNAQ inhibitor, a GNA11 inhibitor or a GNAQ and GNA11 inhibitor; R8 is a reactive group; L is a cleaved linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, a carbonate group, and an equivalent peptide linker, and n is 1,2, 3, or 4. In one aspect the Linker-Drug of the invention is a compound having the structure of Formula (B-1), or stereoisomers or pharmaceutically acceptable salts thereof, L2 X2 D (Β-η where: D is a GNAQ inhibitor, a GNA11 inhibitor or a GNAQ and GNA11 inhibitor; R8 is a reactive group; X2 is a self-immolation spacer; CRC / nn / Lznz / E / Yii L L or O0O , where the * of Y1 indicates the point of attachment to X2 and the ** of Y1 indicates the point of attachment to D; L1 is an oivalent peptide linker, and L2 is a link or a linker. Certain aspects and examples of the Drug-Linker compounds of the invention are provided in the following list of additional embodiments. It will be recognized that features specified in each embodiment may be combined with other features specified to provide other embodiments of the present invention. Embodiment 1. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is an inhibitor of GNAQ. Embodiment 2. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is a GNA11 inhibitor. Embodiment 3. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is an inhibitor of GNAQ and GNA11. Embodiment 4. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is pRC / nn / Lznz / B / Yi (X / 0 HNO where R° is methyl or ethyl, IR1 is methyl or isopropyl, R2 is methyl or ethyl, and the indicates the point of attachment to LBo Yi. Embodiment 5. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is n or 'γ ΝΗ NH । EITHER. where the *** indicates the point of attachment to LBo Yi. Embodiment 6. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is *** i pRC / nn / Lznz / E / Yii where the *** indicates the binding site to LBo Yi. Embodiment 7. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, wherein D is *** | where the *** indicates the point of attachment to LBo Yi. Embodiment 8. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-2), or a pharmaceutically acceptable salt thereof : where: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl, and X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 9. The compound of Formula (B), Formula (B-1) or Formula (B-2), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-2a) , or a pharmaceutically acceptable salt thereof: where: X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 10. The compound of Formula (B), Formula (B-1) or Formula (B-2), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-2b) , or a pharmaceutically acceptable salt thereof: CRC / nn / Lznz / E / Yii where: X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 11. The compound of Formula (B), Formula (B-1) or Formula (B-2), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-2c) , or a pharmaceutically acceptable salt thereof: where: X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 12. The compound of Formula (B) or Formula (B-1), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-3), or a pharmaceutically acceptable salt thereof : CRC / nn / Lznz / E / Yii where: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl, and X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 13. The compound of Formula (B), Formula (B-1) or Formula (B-3), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-3a) , or a pharmaceutically acceptable salt thereof: where: X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 14. The compound of Formula (B), Formula (B-1) or Formula (B-3), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-3b) , or a pharmaceutically acceptable salt thereof: CRC / nn / Lznz / E / Yii where: X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 15. The compound of Formula (B), Formula (B-1) or Formula (B-3), or stereoisomers or a pharmaceutically acceptable salt thereof, having the structure of Formula (B-3c) , or a pharmaceutically acceptable salt thereof: where: (B-3c), X2, Li, L2 and R8 are as defined in the compounds of Formula (B-1) above. Embodiment 16. The compound of Formula (B-2) of Embodiment 8, Formula (B-3) of Embodiment 12, or a pharmaceutically acceptable salt thereof: wherein: CAC / nn / Lznz / E / Yu R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; X2 is a self-immolation spacer selected from Η , h h, oh, o oh, oh o oh , where the * of X2 indicates the point of attachment to Li and the ** of X2 indicates the point of union to the group 0Hor the point of union to the group ° ; Li is a bivalent peptide linker comprising 2 to 4 amino acid residues; L2 is a linker, R8 is selected from , -N3, -ONH2, -NR4C(=O)CH=CH2, SH, -SSR13, -S(=O)2(CH=CH2), NR4S(=O)2(CH=CH2), -NR4C( =O)CH2Br, -NR4C(=O)CH2I, -NHC(=O)CH2Br, -NHC(=O)CH2I, C(=O)NHNH2, -co2h, -nh2, each R4 is independently selected from H and Ci-Ce alkyl; frcj nn / ίζηζ / Ε / γΐΛ each R5 is independently selected from H, Ci-Ce alkyl, F, Cl, and -OH; each R6 is independently selected from H, CrCe alkyl, F, OI, -NH2, OCH3, OCH2CH3, -N(CH3)2, -CN, -NO2, and -OH, and each R7 is independently selected from H, C1-6 alkyl, fluoro, benzyloxy substituted with -C(=O)OH, benzyl substituted with -C(=O)OH, C1-4 alkoxy substituted with C(=O)OH, and alkyl C1-4 substituted with -C(=O)OH. Embodiment 17. The compound of any of Embodiments 1 to 16, wherein X2 is a o oh , where the * of X2 indicates the point of attachment to L1 and that of X2 indicates the point of o* Yo Vi=0 binding to Y1, the binding point to group 0H or the binding point to group °. Embodiment 18. The compound of any of Embodiments 1 to 17, wherein X2 is CRC / nn / Lznz / E / Yii H , where the * of X2 indicates the point of union to Li and the ** of X2 indicates the point of union o' to Yi, the point of union to the group °H or the point of union to the group O. Embodiment 19. The compound of any of Embodiment 1 to 18, wherein Li is a bivalent peptide linker comprising 2 to 4 amino acid residues. Embodiment 20. The compound of any one of Embodiments 1 to 18, wherein Li is a bivalent peptide linker comprising an amino acid residue selected from valine, citrulline, lysine, isoleucine, phenylalanine, methionine, asparagine, proline, alanine, leucine, tryptophan and tyrosine. Embodiment 21. The compound of any of Embodiments 1 to 18, wherein Li is a bivalent peptide linker comprising at least one valine (Val) or citrulline (Cit) residue. Embodiment 22. The compound of any of Embodiments 1 to 18, wherein Li is a bivalent dipeptide linker selected from ValCit, PheLys, ValAla, and ValLys. Embodiment 23. The compound of any of Embodiments 1 to 18, wherein Li is a bivalent dipeptide linker selected from nh2 (ValLys) and (ValCit), of Li indicates the point of attachment to L2 and the “ of Li indicates the point of attachment to X2. Embodiment 24. The compound of any of Embodiments 1 to 18, wherein Li is ValCit. Embodiment 25. The compound of any of Embodiments 1 to 18, wherein CRC / nn / Lznz / E / Yii Li is 0 NH2 (ValCit), where the * of Li indicates the binding site to L2 and the ** of Li indicates the binding site of X2. Embodiment 26. The compound of any of Embodiments 1 to 25, wherein L2 is a linker. Embodiment 27. The compound of any of Embodiments 1 to 25, wherein L2 is a linker selected from: -*C(=O)((CH2)mO)p(CH2)m**-, -*C(=O)(CH2)m**-, -*C(=O)(CH2)nNHC(= O)(CH2)m^ *C(=O)(CH2)mNHC(=O)((CH2)mO)p(CH2)m**-, -* ((CH2)mO)p(CH2)m* *-, -* ((CH2)mO)p(CH2)m**-, -(CH2)m-, -*(CH2)mNHC(=O)(CH2)m**-, -* (CH2) mNHC(=O)(CH2)mC(=O)NH(CH2)m**-, -* ((CH2)mO)p(CH2)mNHC(=O)(CH2)m**-, -* * ((CH2)mO)pCH2)mC(=O)NH(CH^ (CH2)mC(R3)2**-, y -* (CH2)mC(R3)2SS(CH2)mNHC(=O)(CH2 )m**-, where the * of L2 indicates the point of attachment to Li and the ** of L2 indicates the point of attachment to R3; and where: each R3 is independently selected from H and Ci-Ce alkyl; each m is independently selected from 1,2, 3, 4, 5, 6, 7, 8, 9, and 10, and each p is independently selected from 1,2, 3, 4, 5, 6, 7, 8, 9 , 10, 11, 12, 13 and 14. Embodiment 28. The compound of any of Embodiments 1 to 25, wherein L2 is *C(=O)((CH2)mO)p(CH2)rT1**- or -*C(=O)(CH2) m**-, where the * of L2 indicates the point of attachment to Li and the ** of L2 indicates the point of attachment to Re, and where each m is independently selected from 1,2, 3, 4, 5, 6, 7, 8, 9, or 10 and p is 1, 2, 3,4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14. Embodiment 29. The compound of any of Embodiments 1 to 25, wherein L2 is ° , ° , or ° , where the * of L2 indicates the point of attachment to Li and that of L2 indicates the point of attachment to R3. Embodiment 30. The compound of any of Embodiments 1 to 29, wherein R8 is CRC / nn / Lznz / E / Yii -N3, -ONH2, -NR4C(=O)CH=CH2, SH, -SSR13, -S(=O)2(CH=CH2), -NR4S(=O)2(CH=CH2), R4 NR4C(=O)CH2Br, -NR4C(=O)CH2I, -NHC(=O)CH2Br, -NHC(=O)CH2I, -C(=O)NHNH2, O each R4 is independently selected from H and Ci-Ce alkyl; each R5 is independently selected from H, Ci-Ce alkyl, F, Cl, and -OH; each R6 is independently selected from H, Ci-Ce alkyl, F, Cl, -NH2, -OCH3, OCH2CH3, -N(CH3)2, -CN, -NO2, and -OH, and each R7 is independently selected from H, C1-6 alkyl, fluoro, benzyloxy substituted with -C(=O)OH, benzyl substituted with -C(=O)OH, C1-4 alkoxy substituted with C(=O)OH, and alkyl C1-4 substituted with -C(=O)OH. Embodiment 31. The compound of any of Embodiments 1 to 29, wherein R8 is or Embodiment 32. The compound of any of Embodiments 1 to 29, wherein R8 is Embodiment 33. The compound of Formula (B-2) of Embodiment 8, or a pharmaceutically acceptable salt thereof: wherein: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; pRC / nn / Lznz / E / Yii X2 is h , where the * of X2 indicates the point of attachment to L1 and the ** of X2 indicates the point of attachment to the °H group L1 is 0 nh2 (ValCit), where the * of L1 indicates the binding site to L2 and the ** of L1 indicates the binding site to X2; L2 is 0o ° , where the * of L2 indicates the point of attachment to L1 and that of L2 indicates the point of attachment to Rs, R8 is O Embodiment 34. The compound of Formula (B-3) of Embodiment 12, or a pharmaceutically acceptable salt thereof: wherein: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; X2 is h , where the * of X2 indicates the point of attachment to L1 and the ** of X2 indicates the point of attachment to the group prc? nn / Lznz / E / YiA L1 is 0 NH2 (ValCit), where the * of L1 indicates the binding point to L2 and the ’* of L1 indicates the binding point to X2; L2 is ° or O , where the * of L2 indicates the point of attachment to L1 and that of L2 indicates the point of attachment to Rs, or Embodiment 35. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is prcz nn / Lznz / E / YiA Embodiment 36. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is Embodiment 37. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is prc? nn / Lznz / E / YiA Embodiment 38. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is Embodiment 39. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is frcj nn / ίζηζ / Ε / γΐΛ Embodiment 40. The compound of Formula (B), Formula (B-1) or Formula (B-2), wherein the compound is Embodiment 41. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is prcz nn / Lznz / E / YiA Embodiment 42. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is Embodiment 43. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is prc? nn / Lznz / E / YiA Embodiment 44. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is Embodiment 45. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is pac? nn / Lznz / E / YiA Embodiment 46. The compound of Formula (B), Formula (B-1) or Formula (B-3), wherein the compound is Antibody Conjugate Drugs In one aspect, the Antibody-Drug Conjugate of the invention is a conjugate of Formula (C): Ab-(LA-(D)n)y(C) where: D is a drug moiety; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; The is a linker; n is 1,2, 3, or 4, and y is 1,2, 3, or 4, wherein the Linker-Drug moiety (LA-(D)n) is covalently attached to the antibody or antigen-binding fragment thereof. In one aspect, the Antibody-Drug Conjugate of the invention has the structure of Formula (C), wherein: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; La is a cleaved linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, a carbonate group, and a bivalent peptide linker; n is 1,2, 3, or 4, and y is 1,2, 3, or 4, wherein the Linker-Drug moiety (LA-(D)n) is covalently attached to the antibody or antigen-binding fragment thereof. In one aspect, the Antibody-Drug Conjugate of Formula (C) is a conjugate of Formula (C-1): pAC / nn / Lznz / E / Yii where: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; frcj nn / ίζηζ / Ε / γΐΛ a D; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. In the conjugates of Formula (C), one or more Linker-Drug residues (LB-(D)n) may be covalently linked to the antibody or antigen-binding fragment thereof, Ab, whereby it covalently links one or more drug residues, D, to the antibody or antigen-binding fragment thereof, Ab, via the linker, LA. LA is any chemical moiety capable of linking the antibody or antigen-binding fragment thereof, Ab, to one or more drug moieties, D. Conjugates of Formula (C), wherein one or more drug moieties, D, are covalently linked to an antibody or antigen-binding fragment thereof, Ab, can be formed using a bifunctional or multifunctional linker reagent having one or more reactive functional groups that are the same or different. One of the reactive functional groups of the bifunctional or multifunctional linker reagent is used to react with a group on the antibody or antigen-binding fragment thereof, Ab, by way of example, a thiol or an amine (for example, a cysteine, an N-terminus or an amino acid side chain such as lysine) to form a covalent bond with one end of the LA linker. Such reactive functional groups of the bifunctional or multifunctional linker reagent include, but are not limited to, a maleimide, a thiol, and an NHS ester. The other reactive functional group(s) of the bifunctional or multifunctional linker reagent are used to covalently link one or more drug moieties, D, to the LA linker. In one aspect, LA is a cleavable linker. In another aspect, LA is a non-cleavable linker. In some aspects, LA is an acid labile linker, photo labile linker, peptidase cleavable linker, esterase cleavable linker, glucosidase cleavable linker, phosphodiesterase cleavable linker, a disulfide bond reducible linker, a hydrophilic linker, or a based on dicarboxylic acid. In one aspect, LA is a cleavable linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, a carbonate group, and a bivalent peptide linker. In one aspect, LA is a cleavable linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, a carbonate group, a bivalent peptide linker, and a bivalent coupling group. In one aspect, LA is a cleavable linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, and a bivalent peptide linker. In one aspect, LA is a cleavable linker comprising one or more linker components selected from a self-immolating spacer, a phosphate group, a bivalent peptide linker, and a bivalent coupling group. In another aspect, the linker (LA) has the following formula: τ. i-2 X2 where: X1 is a bivalent linking group; X2 is a self-immolation spacer; AC ** * X0, where the * of Y1 indicates the point of attachment to X2, and the ** of Y1 indicates the other point of attachment; L1 is a bivalent peptide linker, and L2 is a link or a linker. In another aspect, the linker (LA) has the following formula: Vxi^ / LK / Yv i-2 X2 X where: X1 is a bivalent linking group; X2 is a self-immolation spacer; prc? nn / Lznz / E / YiA Yi is ΟΗ,0Η, θΗor θΗ, where the * in Υι indicates the point of attachment to X2; Li is a bivalent peptide linker, and L2 is a link or a linker. In another aspect, the linker (La) has the following formula: where: Xi is a bivalent linking group; X2 is a self-immolation spacer; binding to X2; Li is a bivalent peptide linker, and L2 is a link or a linker. Although the drug / antibody ratio has an exact integer value for a specific conjugate molecule (for example, the product of n and y in Formula (C), it is understood that the value will often be an average value when used to describe a sample containing many molecules, due to some degree of heterogeneity, typically associated with the conjugation step.The average loading for a sample of a conjugate is referred to herein as drug / antibody ratio, or “DAR.” In some aspects, the DAR ranges from about 1 to about 5, and is typically about 1,2, 3, or 4. In some aspects, at least 50% of a sample by weight is a compound having an average DAR plus or minus 2, and preferably at least 50% of the sample is a conjugate containing the average DAR plus or minus 1. Other aspects include conjugates where the DAR is about 2. In some aspects, a DAR of 'about y' means that the measured value for DAR is within 20% of the product of n and y in Formula (I). In some respects, a DAR of 'about n' means that the measured value for DAR is within 20% of n in Formula (II). In one aspect, the average molar ratio of drug to antibody in the conjugates of Formula (C) (ie, the average value of the product of n and y, also known as the drug to antibody ratio (DAR)) ranges from about 1 to about 10, between about 180 and about 6 (for example, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1,2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1,3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1,4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0), between about 1 and about 5, between about 1.5 and about 4.5, or between about 2 and about 4. In one aspect according to the invention, the conjugate is of substantially high purity and has one or more of the following characteristics: (a) more than about 90% (eg, more than or as much as about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%), preferably more than about 95%, of the conjugate species are monomeric, (b) the level of unconjugated linker in the conjugate preparation is less than about 10% (for example, less than or as much as about 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0 %) (relative to total linker), (c) less than 10% of the species in the conjugate are crosslinked (eg, less than or as much as about 9%, 8%, 7%, 6%, 5%, 4 %, 3%, 2%, 1%, or 0%), (d) the level of free drug (ADP-induced platelet aggregation inhibitor, for example, a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of GNAQ and GNA11) in the conjugate preparation is less than about 2% (for example, less than or as much as about 1.5%, 1.4%, 1.3%, 1.2%, 1.1%, 1.0%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, or 0%) (mol / mol relative to total drug). Certain aspects and examples of the Antibody-Drug Conjugate of the invention are provided in the following list of additional embodiments. It will be recognized that features specified in each embodiment may be combined with other specified features to provide other embodiments of the present invention. Embodiment 47. The conjugate of Formula (C) or Formula (C-1), wherein D is a GNAQ inhibitor. Embodiment 48. The conjugate of Formula (C) or Formula (C-1), wherein D is a GNA11 inhibitor. Embodiment 49. The conjugate of Formula (C) or Formula (C-1), wherein D is an inhibitor of GNAQyGNAH. Mode 50. The conjugate of Formula (C) or Formula (C-1), where D is CRC / nn / Lznz / E / Yii prc? nn / Lznz / E / YiA where R° is methyl or ethyl, Ri is methyl or isopropyl, R2 is methyl or ethyl, and the indicates the point of attachment to La or Yi. Mode 51. The conjugate of Formula (C) or Formula (C-1), where D is *** i where the *** indicates the binding site to LAo Y1. Mode 52. The conjugate of Formula (C) or Formula (C-1), where D is *** I prc? nn / Lznz / E / YiA where the *** indicates the point of attachment to La or Yi. Modality 53. The conjugate of Formula (C) or Formula (C-1), where D is *** i where the *** indicates the point of attachment to La or Yi. Embodiment 54. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-2): where: (C-2), prcz nn / Lznz / E / YiA R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Ab is an antibody or antigen-binding fragment thereof that binds to the protein PMEL17 human; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 55. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-2a): frcj nn / ίζηζ / Ε / γΐΛ where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; L1 is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 56. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-2b): where: (C-2b), why? nn / Lznz / E / YiA Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 57. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-2c): prc? nn / ίζηζ / Ε / γΐΛ where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 58. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-3): frcj nn / ίζηζ / Ε / γΐΛ where: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 59. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-3a): where: (C-3a), why? nn / ίζηζ / Ε / γΐΛ Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 60. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-3b): pac? nn / ίζηζ / Ε / γΐΛ where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; L1 is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Embodiment 61. The conjugate of Formula (C) or Formula (C-1), having the structure of Formula (C-3c): prc? nn / Lznz / E / YiA where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Xi is a bivalent linking group; X2 is a self-immolation spacer; Li is a bivalent peptide linker; L2 is a link or a linker, and y is 1,2, 3, or 4. Modality 62. The conjugate of Formula (C-2) of Modality 54 or The conjugate of Formula (C3) of Modality 58: where: R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; Χ2 is a self-immolation spacer selected from Η , h o oh , where the * of X2 indicates the point of attachment to L1 and the ** of X2 indicates the point of union to the group °Ho the point of union to the group O ; L1 is a bivalent peptide linker comprising 2 to 4 amino acid residues; L2 is a linker; X1 is a bivalent mating group selected from -*NR4C(=O)CH2**-, -*NHC(=O)CH2**, -*S(=O)2CH2CH2**-, -* (CH2)2S(=O)2CH2CH2**-, *NR4C(=O)CH2CH2**-, -NH-, -0(=0)-, -*NHC(=O) -*NR4S(=O)2CH2CH2**-, -*CH2NHCH2CH2**-, *νηοη2οη2**-, -s-, prc? nn / Lznz / E / YiA , **-, where the * of Xi indicates the point of attachment to L2 and the ** of Xi indicates the point of attachment to Ab; and where: each R4 is independently selected from H and Ci-Ce alkyl; each R5 is independently selected from H, Ci-Ce alkyl, F, Cl, and -OH; each R6 is independently selected from H, Ci-Ce alkyl, F, Cl, -NH2, -OCH3, OCH2CH3, -N(CH3)2, -CN, -NO2, and -OH, and each R7 is independently selected from H, C1-e alkyl, fluoro, benzyloxy substituted with -C(=O)OH, benzyl substituted with -C(=O)OH, C1-4 alkoxy substituted with C(=O)OH, and alkyl C1-4 substituted with -C(=O)OH, and is 1,2, 3, or 4. Embodiment 63. The conjugate of any of Embodiments 54 to 62, wherein X2 is a selected self-immolation spacer , where the * of X2 indicates the point of attachment to L1 and the “ of X2 indicates the point of prc? nn / Lznz / E / YiA binding to Y1 or the binding point to the group °H or the binding point to the group Embodiment 64. The conjugate of any of Embodiments 54 to 63, where X2 is H , where the * of X2 indicates the point of attachment to L1 and the ** of X2 indicates the point of attachment to Y1 or the point of union to the group °Ho the point of union to the group Embodiment 65. The conjugate of any of Embodiments 54 to 64, wherein L1 is a bivalent peptide linker comprising 2 to 4 amino acid residues. Embodiment 66. The conjugate of any of Embodiments 54 to 65, wherein L1 is a bivalent peptide linker comprising an amino acid residue selected from valine, citrulline, lysine, isoleucine, phenylalanine, methionine, asparagine, proline, alanine, leucine, tryptophan and tyrosine. Embodiment 67. The conjugate of any of Embodiments 54-64, wherein L1 is a bivalent peptide linker comprising at least one valine (Val) or citrulline (Cit) residue. Embodiment 68. The conjugate of any of Embodiments 54 to 64, wherein L1 is a bivalent dipeptide linker selected from ValCit, PheLys, ValAla, and ValLys. Embodiment 69. The conjugate of any of Embodiments 54 to 64, wherein L1 is a bivalent dipeptide linker selected from (ValCit), nh2 pRC / nn / Lznz / E / Yii * of Li indicates the binding site to L2 and the “ of Li indicates the binding site of X2. Embodiment 70. The conjugate of any of Embodiments 54 to 64, where Li is ValCit. Modality 71. The conjugate of any of Embodiments 54 to 64, where WAHO T^NH Li is °nh2 (ValCit), where the * of Li indicates the point of attachment to l_2 and the ** of Li indicates the point of attachment to X2. Embodiment 72. The conjugate of any of Embodiments 54 to 71, wherein L2 is a linker. Embodiment 73. The conjugate of any of Embodiments 54 to 71, wherein L2 is a linker selected from: -*C(=O)((CH2)mO)p(CH2)m**-, -*C(=O)(CH2)m**-, -*C(=O)(CH2)nNHC(= O)(CH2)m**-, *C(=O)(CH2)mNHC(=O)((CH2)mO)p(CH2)m**-, -* ((CH2)mO)p(CH2 )m**-, -* ((CH2)mO)p(CH2)m**-, -(CH2)m-, -*(CH2)mNHC(=O)(CH2)m**-, -* (CH2)mNHC(=O)(CH2)mC(=O)NH(CH2)m**-, -* ((CH2)mO)p(CH2)mNHC(=O)(CH2)m**-, -* *((CH2)mO)pCH2)mC(=O)NH(CH2)m**-, (CH2)mC(R3)2**-, and -* (CH2)mC(R3)2SS(CH2 )mNHC(=O)(CH2)m^ where the * of L2 indicates the point of attachment to Li and the ** of L2 indicates the point of attachment to Xi; and where: each R3 is independently selected from H and Ci-Ce alkyl; each m is independently selected from 1,2, 3, 4, 5, 6, 7, 8, 9, and 10, and each p is independently selected from 1,2, 3, 4, 5, 6, 7, 8, 9 , 10, 11, 12, 13 and 14. Embodiment 74. The conjugate of any of Embodiments 54 to 71, wherein L2 is *C(=O)((CH2)mO)p(CH2)m**- or -*C(=O)(CH2) m**-, where the * of L2 indicates the point of attachment to Li and that of L2 indicates the point of attachment to Xi, and where each m is independently selected from among 1,2, 3, 4, 5, 6, 7, 8, 9 or 10 and p is 1, 2,3,4, 5, 6,7, 8, 9, 10, 11, 12, 13 or 14. Embodiment 75. The conjugate of any of Embodiments 54 to 71, where L2 is * or θ , where the of L2 indicates the point of CRC / nn / Lznz / E / Yii binding to Li and the ** of L2 indicates the point of binding to Xi. Modality 76. The conjugate of any of Embodiments 54 to 75, where Xi is a bivalent coupling group selected from o , O Yo , -*S(=O)2CH2CH2**-, -* (CH2)2S(=O)2CH2CH2**-, *NR4C(=O)CH2CH2**-, -NH-, -C(=O)- , -*NHC(=O) -*NR4C(=O)CH2**-, -*NHC(=O)CH2**-*NR4S(=O)2CH2CH2**-, -*ch2nhch2ch2**-, - , **-, where the * of Xi indicates the binding site to L2 and the ** of Xi indicates the binding site to Ab; and where: each R4 is independently selected from H and Ci-Ce alkyl; each R5 is independently selected from H, Ci-Ce alkyl, F, Cl, and -OH; each R6 is independently selected from H, Ci-Ce alkyl, F, Cl, -NH2, -OCH3, OCH2CH3, -N(CH3)2i-CN, -NO2, and -OH, and each R7 is independently selected from H, Ci-e alkyl, fluoro, benzyloxy substituted with -C(=O)OH, benzyl substituted with -C(=O)OH, C1-4 alkoxy substituted with C(=O)OH, and alkyl C1-4 substituted with -C(=O)OH. Modality 77. The conjugate of any of Embodiments 54 to 75, prc? nn / Lznz / E / YiAi EITHER ** where X1 is a bivalent coupling group selected from or point of binding to L2 and the ** of X1 indicates the point of binding to Ab. Embodiment 78. The conjugate of any of Embodiments 54 to 75, wherein Xi is a bivalent coupling group selected from , where the * of X1 indicates the binding site to L2 and the “ of X1 indicates the binding site to Ab. Modality 79. The conjugate of Formula (C-2) of Modality 54 where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Xl is a bivalent coupling group selected from o or ** X2 to Ab O or , where the * of X1 indicates the junction point to L2 and the “ of X1 indicates the junction point is h , where the * of X2 indicates the point of attachment to L1 and the ** of X2 indicates the frcj nn / ίζηζ / Ε / γΐΛ O' point of union to the group °H NH is 0 NH2 (ValCit), where the * of L1 indicates the binding site for L2 and the ** of L1 indicates the binding site for X2; L2 is θ ** ** , where the * of L2 indicates the binding point to L1 and that of L2 indicates the binding point to FU, and y is 1,2, 3 or 4. Modality 80. The conjugate of Formula (C-3) of Modality 58 where: Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; R° is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Xi is a bivalent mating group selected from frcj nn / ίζηζ / Ε / γΐΛ to Ab , where the * of Xi indicates the point of attachment to L2 and the “ of Xi indicates the point of attachment No. X2 is H , where the * of X2 indicates the point of attachment to Li and the ** of X2 indicates the O' point of union to the group °; NH Li is °nh2 (ValCit), where the * of Li indicates the point of attachment to L2 and the ** of Li indicates the point of attachment to X2; L2 is ° o o , where the * of L2 indicates the point of attachment to Li and the ** of L2 indicates the point of attachment to FU, and y is 1,2, 3, or 4. Embodiment 81. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: pac? nn / ίζηζ / Ε / γΐΛ where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 82. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. 100 Embodiment 83. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: CAC / nn / Lznz / E / Yii where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 84. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: where: and is 2 or 4 and 101 Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 85. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: pRC / nn / Lznz / E / Yii where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 86. The conjugate of Formula (C), Formula (C-1), or Formula (C-2) having the structure: 102 where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 87. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure: CRC / nn / Lznz / E / Yii where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 88. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure: 103 prc? nn / Lznz / E / YiA where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 89. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure: where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. 104 Embodiment 90. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure eAC / nn / Lznz / E / Yu: where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 91. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure: where: and is 2 or 4 and 105 Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. Embodiment 92. The conjugate of Formula (C), Formula (C-1), or Formula (C-3) having the structure: CAC / nn / Lznz / E / Yii where: and is 2 or 4 and Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein. In addition, the antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention can be conjugated to a drug moiety that modifies a given biological response. Drug moieties are not to be construed as limited to classical chemical therapeutic agents. For example, the moiety of the drug can be a protein, peptide, or polypeptide that possesses a desired biological activity. Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin, a protein such as tumor necrosis factor, interferon a, interferon β, nerve growth factor, factor derived growth agent, tissue plasminogen activator, a cytokine, an apoptotic agent, an antiangiogenic agent, or a biological response modifier such as a lymphokine. In one embodiment, the antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention are conjugated to a drug moiety, such as a cytotoxin, drug (eg, immunosuppressant), or a radiotoxin. Examples of cytotoxins include, but are not limited to, taxanes (see, for example, Patent Applications 106 International (PCT) Nos. WO 01 / 38318 and PCT / US03 / 02675), DNA alkylating agents (for example, CC-1065 analogues), anthracyclines, tubulisin analogues, duocarmycin analogues, auristatin E, auristatin F, maytansinoids, pyrrolobenzodiazipines (PBDs), and cytotoxic agents comprising a reactive polyethylene glycol moiety (see, for example, Sasse et al., J. Antibiot. (Tokyo), 53, 879-85 (2000), Suzawa et al., Bioorg. Med. Chem., 8, 2175- 84 (2000), Ichimura et al., J. Antibiot (Tokyo), 44, 1045-53 (1991), Francisco et al., Blood (2003) (electronic publication before print publication), US Patent Nos. 5,475,092 , 6,340,701, 6,372,738, and 6,436,931, U.S. Patent Application Publication No. 2001 / 0036923 A1, Pending U.S. Patent Application Nos. 10 / 024,290 and 10 / 116,053, and International Patent Application (PCT) No. WO 01 / 49698 ), taxon, cytochalasin B, gramicidin D, ethidium bromide, emetin, mitomycin, etoposide, tenoposide, vincristine, vinblastine, t. colchicine, doxorubicin, daunorubicin, dihydroxy anthracine dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol and puromycin and analogs or homologues thereof. Therapeutic agents further include, for example, antimetabolites (for example, methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), ablation agents (for example, mechlorethamine, thiotepa chlorambucil, meifalan, carmustine (BSNU), and lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum(II) (DDP), cisplatin, anthracyclines (for example, daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (for example, dactinomycin (formerly actinomycin ), bleomycin, mithramycin and anthramycin (AMC)) and antimitotic agents (eg vincristine and vinblastine) (See eg Seattle Genetics US20090304721). Other examples of cytotoxins that can be conjugated to the antibodies, antibody fragments (antigen-binding fragments), or functional equivalents of the invention include duocarmycins, calicheamicins, maytansins, and auristatins, and their derivatives. Various types of cytotoxins, linkers, and methods for conjugating therapeutic agents to antibodies are known in the art, see, for example, Salto et al., (2003) Adv. Drug Deliv. Rev 55:199-215; Trail et al., (2003) Cancer Immunol. Immunother. 52:328-337; Payne, (2003) Cancer Cell 3:207-212; Alien, (2002) Nat. Rev. Cancer 2:750-763; Pastan and Kreitman, (2002) Curr. Opinion. research Drugs 3:1089-1091; Senter and Springer, (2001) Adv. Drug Deliv. Rev 53:247-264. The antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention may also be conjugated with a radioactive isotope to generate cytotoxic radiopharmaceuticals, termed radioimmunoconjugates. Examples of radioactive isotopes that can be conjugated to antibodies for diagnostic or therapeutic use include, but are not limited to, iodine-131, indium-111, yttrium-90, and lutetium-177. The methods for 107 CRC / nn / Lznz / E / Yu preparing radioimmunoconjugates are known in the art. Examples of radioimmunoconjugates are commercially available, and include Zevalin™ (DEC Pharmaceuticals) and Bexxar™ (Corixa Pharmaceuticals), and similar methods can be used to prepare radioimmunoconjugates using the antibodies of the invention. In certain embodiments, the macrocyclic chelator is 1,4,7,10-tetraazacyclododecane-N,N',N",N'"-tetraacetic acid (DOTA) which can be attached to the antibody via a linker molecule. Such linker molecules are commonly known in the art and are described in Denardo et al., (1998) Clin Cancer Res. 4(10):2483-90; Peterson et al., (1999) Bioconjug. Chem. 10(4):553-7; and Zimmerman et al., (1999) Nuci. Med. Biol. 26(8):943-50, each of which is incorporated herein by reference. The antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention may also be conjugated to a heterologous protein or polypeptide (or fragment thereof), preferably to a polypeptide of at least 10, for at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100 amino acids) to generate fusion proteins . In particular, the invention provides fusion proteins comprising an antibody fragment (eg, antigen-binding fragment) described herein (eg, Fab fragment, Fd fragment, Fv fragment, F( ab)2, a VH domain, a VH CDR, a VL domain or a VL CDR) and a heterologous protein, polypeptide or peptide. Additional fusion proteins can be generated through the techniques of gene shuffling, motif shuffling, exon shuffling, and / or codon shuffling (collectively referred to as DNA shuffling). DNA shuffling can be used to alter the activities of the antibodies of the invention or fragments thereof (eg, antibodies or fragments thereof with higher affinities and lower dissociation rates). See, generally, US Patent Nos. 5,605,793, 5,811,238, 5,830,721,5,834,252, and 5,837,458; Patten et al., (1997) Curr. Opinion BiotechnoL 8:724-33; Harayama, (1998) Trends BiotechnoL 16(2):76-82; Hansson et al., (1999) J. Mol. Biol. 287:265-76; and Lorenzo and Blasco, (1998) Biotechniques 24(2):308-313 (each of these patents and publications are incorporated herein by reference in their entirety). Antibodies or fragments thereof, or encoded antibodies or fragments thereof, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination. A polynucleotide encoding an antibody or fragment thereof that specifically binds to an antigen can be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules. CAC / nn / Lznz / E / Yii 108 Furthermore, the antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention can be conjugated to marker sequences, such as a peptide, to facilitate purification. In preferred embodiments, the amino acid sequence of the tag is a hexahistidine peptide (SEQ ID NO: 267), such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 91311), among others, many of which are commercially available. As described in Gentz ​​et al., (1989) Proc. nati. Acad. Sci. USA 86: 821-824, for example, hexahistidine (SEQ ID NO: 267) provides convenient purification of the fusion protein. Other useful peptide tags for purification include, among others, the hemagglutinin (HA) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., (1984) Cell 37:767), and the FLAG tag (A. Einhauer et al., J. Biochem. Biophys. Methods 49: 455-465, 2001). In accordance with the present invention, antibodies or antigen-binding fragments may also be conjugated to tumor-penetrating peptides to enhance their efficacy. In other embodiments, the antibodies, antibody fragments (eg, antigen-binding fragments), or functional equivalents of the present invention are conjugated to a detectable or diagnostic agent. Such immunoconjugates may be useful in monitoring or predicting the onset, development, progression, and / or severity of a disease or disorder as part of a clinical testing procedure, such as determining the efficacy of a particular therapy. Such diagnosis and detection can be accomplished by coupling the antibody to detectable substances including, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin / biotin and avidin / biotin; fluorescent materials, such as, but not limited to Alexa Fluor 350, Alexa Fluor 405, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 500, Alexa Fluor 514, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 555, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 610, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680, Alexa Fluor 700, Alexa Fluor 750, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as, but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as, but not limited to, iodine (131l,125l,123l, y1211,), carbon (14C), sulfur (35S), tritium (3H), indium (115ln,113ln,112ln, y111ln,), technetium (Te), thallium (201Ti), gallium (68Ga,67Ga), palladium (103Pd), molybdenum (Mo), xenon (133Xe), fluorine (18F),153Sm,177Lu,159Gd,149Pm,140La,175Yb,166Ho ,90Y,47Sc,186Re,188Re,142Pr,105Rh,97Ru,68Ge,57Co,65Zn,85Sr,32P,153Gd,169Yb,51Cr,54Mn,75Se,64Cu,113Sn, and117Sn; and positron-emitting metals using various nonradioactive paramagnetic metal ion and positron emission tomography scans. CAC / nn / Lznz / E / Yii 109 Antibodies, antibody fragments (eg, antigen-binding fragments) or functional equivalents of the invention can also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene. 3. Conjugation and preparation of ADCs Processes for preparing antibody conjugates of Formula (C), Formula (C-1), and Formula (C^ A general reaction scheme for the formation of conjugates of Formula (C) is illustrated in Scheme 1 below: Scheme 1 Ab—(RG-|)y+ y^R8—LB-(D)n^-------Ab-(LA-(D)n)y(B) (C) where: RGi is a reactive group on the antibody or antigen-binding fragment thereof, Ab, by way of example only a thiol, amine or ketone, which reacts with a compatible reactive group, R8, attached to the drug-linker compound whereby it covalently binds the antibody or antigen-binding fragment thereof, Ab, to one or more linker-drug residues. Non-limiting examples of such reactions of RGi and R8 groups are a maleimide (R8) reacting with a thiol (RGi) to obtain a succinimide ring, or a hydroxylamine (R8) reacting with a ketone (RGi) to obtain an oxime. . In one embodiment, D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11 (GNAQ / GNA11 inhibitor), La is a linker that further comprises a bivalent linking group when RGi and R8 react, n is 1 ,2, 3, or 4, and y is 1,2, 3, or 4. A general reaction Scheme for the formation of conjugates of Formula (C-1) is illustrated in Scheme 2 below: Scheme 2 Ab-(RG1)y +y( (B-1) (C-1)Υ where: RG1 is a reactive group on the antibody or antigen-binding fragment thereof, Ab, by way of example only a thiol, amine or ketone, which reacts with a compatible reactive group, R8, attached to the linker-drug moiety whereby it binds 110 CRC / nn / Lznz / E / Yii covalently binds the antibody or antigen-binding fragment thereof, Ab, to one or more linker-drug residues. Non-limiting examples of such reactions of RGi and R8 groups are a maleimide (R8) reacting with a thiol (RGi) to obtain a succinimide ring, or a hydroxylamine (R8) reacting with a ketone (RGi) to obtain an oxime. . In one embodiment, D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11 (GNAQ / GNA11 inhibitor), Xi is a bivalent linking group formed when RGi and R8 react (for example a succinimide ring or an oxime), Yi is a phosphate group, X2 is a self-immolating spacer, Li is a bivalent peptide linker, L2 is a bond or a linker, and y is 1,2, 3, or 4. A general reaction Scheme for the formation of conjugates of Formula (C-2) is illustrated in Scheme 3 below: Scheme 3 CRC / nn / Lznz / E / Yii where: RGi is a reactive group on the antibody or antigen-binding fragment thereof, Ab, by way of example only a thiol, amine or ketone, that reacts with a compatible reactive group, R8, attached to the linker-drug moiety by whereby it covalently links the antibody or antigen-binding fragment thereof, Ab, to one or more linker-drug residues. Non-limiting examples of such reactions of RGi and R8 groups are a maleimide (R8) reacting with a thiol (RGi) to obtain a succinimide ring, or a hydroxylamine (R8) reacting with a ketone (RGi) to obtain an oxime. . In this case R° is methyl or ethyl, R1 is methyl or isopropyl, R2 is methyl or ethyl, Xi is a bivalent linking group formed when RGi and R8 react (for example a ring of 111 succinimide or an oxime), X2 is a self-immolating spacer, L1 is a bivalent peptide linker, L2 is a bond or a linker, and y is 1, 2, 3, or 4. A general reaction Scheme for the formation of conjugates of Formula (C-2) is illustrated in Fig. Scheme 4 below: Scheme 4 CAC / nn / Lznz / E / Yu where: RG1 is a reactive group on the antibody or antigen-binding fragment thereof, Ab, by way of example only a thiol, amine or ketone, that reacts with a compatible reactive group, R8, attached to the linker-drug moiety by whereby it covalently links the antibody or antigen-binding fragment thereof, Ab, to one or more linker-drug residues. Non-limiting examples of such reactions of RG1 and R8 groups are a maleimide (R8) reacting with a thiol (RG1) to obtain a succinimide ring, or a hydroxylamine (R8) reacting with a ketone (RG1) to obtain an oxime. . In this case R° is methyl or ethyl, R1 is methyl or isopropyl, R2 is methyl or ethyl, X1 is a bivalent linking group formed when RG1 and R8 react (for example a succinimide ring or an oxime), X2 is a self-immolating spacer, L1 is a bivalent peptide linker, L2 is a bond or a linker, and y is 1, 2, 3, or 4. Conjugation process with engineered cysteine ​​antibody residues Conjugates of the invention can be prepared using engineered cysteine ​​residues in an antibody by, for example, site-directed mutagenesis. Such site-directed conjugates are homogeneous and have improved properties. (Junutula JR, Raab H, Clark S, Bhakta S, Leipold DD, Weir S, Chen Y, Simpson M, Tsai SP, Dennis MS, Lu Y, Meng YG, Ng C, Yang J, Lee CC, Dueñas E, Gorrell J, Katta V, Kim A, McDorman K, Flagella K, Venook R, Ross S, 112 Spencer SD, Lee Wong W, Lowman HB, Vandlen R, Sliwkowski MX, Scheller RH, Polakis P, Mallet W. (2008) Nature Biotechnology 26:925-932.) Because the engineered cysteines in antibodies expressed in mammalian cells are modified by adducts (disulfides) such as glutathione (GSH) and / or cysteine ​​during their biosynthesis (Chen et al. 2009), the engineered cysteine ​​residues in the product as initially expressed they are unreactive to thiol-reactive reagents such as maleimido or bromo or iodo-acetamide groups. In order to conjugate the payload to an engineered cysteine ​​after expression, the glutathione or cysteine ​​adducts must be removed by reducing these disulfide adducts, which generally involves also reducing the native disulfides in the expressed protein. Deprotection of engineered cysteine ​​adduct products can be accomplished by first exposing the antibody to a reducing agent, eg, dithiothreitol (DTT), TCEP, or reduced cysteine, followed by a procedure that allows reoxidation of all native disulfide bonds of a antibody to restore and / or stabilize the functional structure of the antibody. Various methods can be employed to reduce and reoxidize antibodies with engineered cysteine ​​residues for the preparation of antibody-drug conjugates. Attempts to follow reoxidation protocols previously described in the literature using high CuSO4 concentration resulted in protein precipitation (Junutula JR, Raab H, Clark S, Bhakta S, Leipold DD, Weir S, Chen Y, Simpson M, Tsai SP, Dennis MS, Lu Y, Meng YG, Ng C, Yang J, Lee CC, Dueñas E, Gorrell J, Katta V, Kim A, McDorman K, Flagella K, Venook R, Ross S, Spencer SD, Lee Wong W, Lowman HB, Vandlen R, Sliwkowski MX, Scheller RH, Polakis P, Mallet W. (2008) Nature Biotechnology 26:925). We have successfully prepared and obtained antibody-drug conjugates with several different methods for the reduction and reoxidation of antibodies. The following is a method for reducing and reoxidizing antibodies with engineered cysteine ​​residues for the preparation of antibody-drug conjugates: Freshly prepared DTT is added to purified Cys mutant antibodies to a final concentration of 10 mM. After incubation with DTT at room temperature for 1 hour, the mixture is dialyzed at 4 °C against PBS for three days with daily buffer exchange to remove DTT and re-oxidize the native disulfide bonds of the antibody. An alternative method is to remove the reducing reagents through a desalting column such as Sephadex G-25, equilibrated with PBS. Once the protein is fully reduced, optionally 1 mM oxidized ascorbate (dehydro-ascorbic acid) is added to the desalted samples and reoxidation incubations are carried out for 20-24 hours. In another exemplary method, deprotection of engineered Cys residues is achieved by the addition of fully reduced cysteine ​​at a concentration of 20 mM to antibodies bound to Protein A-resin Sepharose. The reduction of Cys adducts is achieved by 113 CRC / nn / Lznz / E / Yii incubation for approximately 30-60 minutes at room temperature, then the reductant is quickly removed by washing the resin with 50 pellets of PBS. Reoxidation of reduced antibodies is achieved by incubating the washed suspension at room temperature with or without addition of 50-2000 nM CuCI2 as accelerator. With the exception of the use of copper sulfate, the examples herein use each of the protocols described with similar results. Reoxidation restores the disulfides within the chain, while dialysis, desalting, or chromatography of protein A removes the reducing agent, as well as the cysteines and glutathiones initially attached to the antibody's designed cysteine(s). Reversed phase HPLC chromatography is typically used to monitor the reoxidation process: antibodies are loaded onto a PLRP-S column (4000 Á, 50 mm x 2.1 mm, Agilent) heated to 80 °C and eluted using a linear gradient of 30-45% CH3CN in water containing 0.1% TFA at 1.5 mL / min. and peak detection at 215, 254 and 280 nm. After reoxidation, the antibody is conjugated to a drug-linker compound of, by way of example, the compounds of Formula (B), Formula (B-1), Formula (B-2) or Formula ( B-3) (see schemes 1-4). By way of example, a compound of Formula (B), Formula (B-1), Formula (B-2), or Formula (B-3) is added to the reoxidized Cys mutant antibody at 5-10 molar equivalents. relative to the antibody in PBS buffer (pH 7.2). The incubations are carried out for 1-2 hours. The conjugation process is monitored by reverse phase HPLC, which can separate conjugated from unconjugated antibodies. The conjugation reaction mixtures are analyzed on a PRLP-S column (4000 Á, 50 mm x 2.1 mm, Agilent) heated to 80 °C and elution from the column is carried out by a linear gradient of 30-30 acetonityl. 60% in water containing 0.1% TFA at a flow rate of 1.5 mL / min. The elution of the proteins from the column is monitored at 280 nm, 254 nm and 215 nm. Alternatively, for antibodies bound to a protein A resin, once the antibody is re-oxidized, the resin is washed with 10 column volumes of PBS and the resin is then resuspended in equal volumes of PBS and excess is added. of 8x of a compound of Formula (B), Formula (B-1), Formula (B-2) or Formula (B-3) (in DMSO) and incubate at room temperature for 2 hours. The resin is then washed with 50 column volumes of PBS and the resulting antibody-drug conjugate is eluted from the protein A resin, neutralized with 1 / 10 volume 1 M Tris pH 9.0 and buffer exchanged into appropriate buffer to perform a preparative size exclusion chromatography (if necessary). Immunoconjugates are also characterized in terms of the average charge of a drug moiety to an antibody binding moiety, generally referred to as the drug-antibody ratio (DAR). The DAR value is extrapolated, for example, from LC-MS data for reduced and deglycosylated samples. LC / MS allows quantification of the average number of payload molecules (rest 114 drug CRC / nn / Lznz / E / Yii) bound to an antibody on an ADC. HPLC separates an antibody into light and heavy chains, and also separates the heavy chain (HC) and light chain (LC) according to the number of Linker-Payload groups per chain. Mass spectral data allows identification of the component species in the mixture, eg, LC, LC+1, LC+2, HC, HC+1, HC+2, etc. From the average charge of the LC and HC chains, the average DAR for an ADC can be calculated. The DAR for a given immunoconjugate sample represents the average number of drug molecules (payload) bound to a tetrameric antibody containing two light chains and two heavy chains. Throughout the text of the present application, if there is a discrepancy between the text of the specification and the sequence listing, the text of the specification will control. CRC / nn / Lznz / E / Yii Table 2. Examples of Anti-PMEL17 Antibodies of the Present Invention G1 E152C_S375C_wt LC SEQ ID NO: 1 HCDR1 (Combined) GGTFSDYAIT SEQ ID NO: 2 HCDR2 (Combined) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Combined) EGGLLTDISYSRYWFAY SEQ ID NO: 4 HCDR1 (Kabat) DYAIT SEQ ID NO: 2 HCDR2 ( Kabat) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Kabat) EGGLLTDISYSRYWFAY SEQ ID NO: 5 HCDR1 (Chothia) GGTFSDY SEQ ID NO: 6 HCDR2 (Chothia) IPIFGT SEQ ID NO: 3 HCDR3 (Chothia) EGGLLTDISYSRYWFAY SEQ ID NO: 7HCDR1 ( IMGT) GGTFSDYA SEQ ID NO: 8 HCDR2 (IMGT) IIPIFGTA 115 SEQ ID NO: 9 HCDR3 (IMGT) AREGGLLTDISYSRYWFAY SEQ ID NO: 10 VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAITWVRQAPGQGLEWMGGIIPIFGTANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRYWFAYWGQG TLVTVSS SEQ ID NO: 11 VH DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCG GCACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGG TGAC TGTTAGCTCA SEQ ID NO: 12 Heavy Chain QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAITWVRQAPGQGLEWMGGIIPIFGTANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRYWFAYWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPC PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYIC NVNHKPSNTKVDKRVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKG FYPCDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK pAC / nn / Lznz / E / Yii 116 SEQ ID NO: 13 Heavy Chain DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCGG CACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACCG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGGT GAC TGTTAGCTCAGCTAGCACCAAGGGCCCAAGT GTGTTTCCCCTGGCCCCCAGCAGCAAGTCTA CTTCCGGCGGAACTGCTGCCCTGGGTTGCC TGGTGAAGGACTACTTCCCCTGTCCCGTGAC AGTGTCCTGGAACTCTGGGGCTCTGACTTCC GGCGTGCACACCTTCCCCCGCCGTGCTGCAG AGCAGCGG CCTGTACAGCCTGAGCAGCGTG GTGACAGTGCCCTCCAGCTCTCTGGGAACC CAGACCTATATCTGCAACGTGAACCACAAGC CCAGCAACACCAAGGTGGACAAGAGAGTGG AGCCCAAGAGCTGCGACAAGACCCACCT GCCCCCCCTGCCCAGCTCCAGAACTGCTGG GAGGGCCTTCCGTGTTCCTGTTCCCCCCCA A GCCCAAGGACACCCTGATGATCAGCAGGAC CCCCGAGGTGACCTGCGTGGTGGTGGACGT GTCCCACGAGGACCCAGAGGTGAAGTTCAA CTGGTACGTGGACGGCGTGGAGGTGCACAA CGCCAAGACCAAGCCCAGAGAGGAGCAGTA CAACAGCACCTACAGGGTGGTGTCCGTGCT GACCGTGCT GCACCAGGACTGGCTGAACGG CAAAGAATACAAGTGCAAAGTCTCCAACAAG pRC / nn / Lznz / E / Yii 117 GCCCTGCCAGCCCCAATCGAAAAGACAATCA GCAAGGCCAAGGGCCAGCCACGGGAGCCC CAGGTGTACACCCTGCCCCCCAGCCGGGAG GAGATGACCAAGAACCAGGTGTCCCTGACCT GTCTGGTGAAGGGCTTCTACCCCTGTGATAT CGCCGTGGAGTGGGAGAGCAACGGCCAGCC CGAGAACAACTAC AAGACCACCCCCCCAGTG CTGGACAGCGACGGCAGCTTTCTTCCTGTACA GCAAGCTGACCGTGGACAAGTCCAGGTGGC AGCAGGGCAACGTGTTCAGCTGCAGCGTGA TGCACGAGGCCCTGCACAACCACTACACCCA GAAGTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 14 LCDR1 (Combined) SGDALRDKFVY SEQ ID NO: 15 LCDR2 (Combined) DDNNRPS SEQ ID NO: 16 LCDR3 (Combined) QSWDHSYSLVV SEQ ID NO: 14 LCDR1 (Kabat ) SGDALRDKFVY SEQ ID NO: 15 LCDR2 (Kabat) DDNNRPS SEQ ID NO: 16 LCDR3 (Kabat) QSWDHSYSLVV SEQ ID NO: 17 LCDR1 (Chothia) DALRDKF SEQ ID NO: 18 LCDR2 (Chothia) DDN SEQ ID NO: 19 LCDR3 (Chothia) ) WDHSYSLV SEQ ID NO: 20 LCDR1 (IMGT) ALRDKF SEQ ID NO: 18 LCDR2 (IMGT) DDN pRC / nn / Lznz / E / Yii 118 SEQ ID NO: 16 LCDR3 (IMGT) QSWDHSYSLVV SEQ ID NO: 21 VL DIELTQPPSVSVSPGQTASITCSGDALRDKFVY WYQQKPGQAPVLVIYDDNNRPSGIPERFSGSN SGNTATLTISGTQAEDEADYYCQSWDHSYSLV VFGGGTKLTVL SEQ ID NO: 22 ADN V L GATATCGAACTGACCCAGCCGCCGAGCGTG AGCGTGAGCCCGGGCCAGACCGCGAGCATT ACCTGTAGCGGCGATGCTCTGCGTGACAAAT TCGTTTACTGGTACCAGCAGAAACCGGGCCA GGCGCCGGTGCTGGTGATCTACGACGACAA CAACCGTCCGAGCGGCATCCCGGAACGTTTT AGCGGATCCAACAGCGGCAAC ACCGCGACC CTGACCATTAGCGGCACCCAGGCGGAAGAC GAAGCGGATTATTACTGCCAGTCTTGGGACC ATTCTTACTCTCTGGTTGTGTTTGGCGGCGG CACGAAGTTAACTGTCCTG SEQ ID NO: 23 Light Chain DIELTQPPSVSVSPGQTASITCSGDALRDKFVY WYQQKPGQAPVLVIYDDNN RPSGIPERFSGSN SGNTATLTISGTQAEDEADYYCQSWDHSYSLV VFGGGTKLTVLGQPKAAPSVTLFPPSSEELQA NKATLVCLISDFYPGAVTVAWKADSSPVKAGV ETTTPSKQSNNKYAASSYLSLTPEQWKSHRSY SCQVTHEGSTVEKTVAPTECS SEQ ID NO: 24 Light Chain DNA GATATCGAACTGACCCAGCCGCCGAGCGTG AGCGTGAGCCCGGGCCAGACCGCGAGCATT ACCTGTAGCGGCGATGCTCTGCGTGACAAAT TCGTTTACTGGTACCAGCAGAAAACCGGGCCA G GCGCCGGTGCTGGTGATCTACGACGACAA CAACCGTCCGAGCGGCATCCCGGAACGTTTT AGCGGATCCAACAGCGGCAACACCGCGACC CTGACCATTAGCGGCACCCAGGCGGAAGAC GAAGCGGATTATTACTGCCAGTCTTGGGACC ATTCTTACTCTCTGGTTGTGTTTGGCGGCGG CRC / nn / Lznz / E / Yii 119 CACGAAGTTAACTGTCCTGGGACAACCTAAG GCCGCTCCCTCCGTGACCCTGTTCCCCCCC AGCTCCGAGGAACTGCAGGCCAACAAGGCC ACCCTGGTGTGCCTGATCAGCGACTTCTACC CTGGCGCCGTGACCGTGGCCTGGAAGGCCG ACAGCAGCCCCGTGAAGGCCGGCGTGGAGA CAACCACCCCCAGCA AGCAGAGCAACAACAA GTACGCCGCCAGCAGCTACCTGAGCCTGAC CCCCGAGCAGTGGAAGAGCCACAGAAGCTA CAGCTGCCAGGTCACCCACGAGGGCAGCAC CGTGGAGAAAACCGTGGCCCCCACCGAGTG CAGC G1 E152C_S375C_3J LC SEQ ID NO: 1 HCDR1 (Combined) GG TFSDYAIT SEQ ID NO: 2 HCDR2 (Combined) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Combined) EGGLLTDISYSRYWFAY SEQ ID NO: 4 HCDR1 (Kabat) DYAIT SEQ ID NO: 2 HCDR2 (Kabat) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Kabat) EGGLLTDISYSRYWFAY SEQ ID NO: 5 HCDR1 (Chothia) GGTFSDY SEQ ID NO: 6 HCDR2 (Chothia) IPIFGT SEQ ID NO: 3 HCDR3(Chot hia) EGGLLTDISYSRYWFAY SEQ ID NO: 7 HCDR1 (IMGT) GGTFSDYA SEQ ID NO: 8 HCDR2 (IMGT) IIPIFGTA CRC / nn / Lznz / E / Yii 120 SEQ ID NO: 9 HCDR3 (IMGT) AREGGLLTDISYSRYWFAY SEQ ID NO: 10 VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YA ITW V RQ A PGQG L EW MGG11PIFGTAN YAQ KF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRY WFAYWGQGTLVTVSS SEQ ID NO: 11 VH DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCGGCACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGGTGAC TGTTAGCTCA SEQ ID NO: 12 Heavy Chain QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAITWVRQAPGQGLEWMGGIIPIFGTANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRYWFAYWGQG TLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPC PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEV HNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK CRC / nn / Lznz / E / Yii 121 SEQ ID NO: 13 Heavy Chain DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCGG CACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACCG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGGT GAC TGTTAGCTCAGCTAGCACCAAGGGCCCAAGT GTGTTTCCCCTGGCCCCCAGCAGCAAGTCTA CTTCCGGCGGAACTGCTGCCCTGGGTTGCC TGGTGAAGGACTACTTCCCCTGTCCCGTGAC AGTGTCCTGGAACTCTGGGGCTCTGACTTCC GGCGTGCACACCTTCCCCCGCCGTGCTGCAG AGCAGCGG CCTGTACAGCCTGAGCAGCGTG GTGACAGTGCCCTCCAGCTCTCTGGGAACCC AGACCTATATCTGCAACGTGAACCACAAGCC CAGCAACACCAAGGTGGACAAGAGAGTGGA GCCCAAGAGCTGCGACAAGACCCACCTG CCCCCCCTGCCCAGCTCCAGAACTGCTGGG AGGGCCTTCCGTGTTCCTGTTCCCCCCCA AG CCCAAGGACACCCTGATGATCAGCAGGACC CCCGAGGTGACCTGCGTGGTGGTGGACGTG TCCCACGAGGACCCAGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCACAACG CCAAGACCAAGCCCAGAGAGGAGCAGTACA ACAGCACCTACAGGGTGGTGTCCGTGCTGA CCGTGCTGCACCAG GACTGGCTGAACGGCA AAGAATACAAGTGCAAAGTCTCCAACAAGGC pRC / nn / Lznz / E / Yii 122 CCTGCCAGCCCCAATCGAAAAGACAATCAGC AAGGCCAAGGGCCAGCCACGGGAGCCCCAG GTGTACACCCTGCCCCCCAGCCGGGAGGAG ATGACCAAGAACCAGGTGTCCCTGACCTGTC TGGTGAAGGGCTTCTACCCCTGTGATATCGC CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAA GACCACCCCCCCAGTGCTG GACAGCGACGGCAGCTTCTTCCTGTACAGCA AGCTGACCGTGGACAAGTCCAGGTGGCAGC AGGGCAACGTGTTCAGCTGCAGCGTGATGC ACGAGGCCCTGCACAACCACTACACCCAGAA GTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 14 LCDR1 (Combined) SG DALRDKFVY SEQ ID NO: 15 LCDR2 (Combined) DDNNRPS SEQ ID NO: 16 LCDR3 (Combined) QSWDHSYSLVV SEQ ID NO: 14 LCDR1 (Kabat ) SGDALRDKFVY SEQ ID NO: 15 LCDR2 (Kabat) DDNNRPS SEQ ID NO: 16 LCDR3 (Kabat) QSWDHSYSLVV SEQ ID NO: 17 LCDR1 (Chothia) DALRDKF SEQ ID NO: 18 LCDR2 (Chothia) DDN SEQ ID NO: 19 LCDR3 (Chothia) ) WDHSYSLV SEQ ID NO: 20 LCDR1 (IMGT) ALRDKF SEQ ID NO: 18 LCDR2 (IMGT) DDN pRC / nn / Lznz / B / Yi 123 SEQ ID NO: 16 LCDR3 (IMGT) QSWDHSYSLVV SEQ ID NO: 25 VL SYELTQPLSVSVALGQTARITCSGDALRDKFVY WYQQKPGQAPVLVIYDDNNRPSGIPERFSGSN SGNTATLTIS RAQAG DEADYYCQSW DHS YS LV VFGGGTKLTVL SEQ ID NO: 26 DNA VL AGCTACGAGCTGACCCAGCCGCTGTCGGTG TCAGTCGCCCTGGGACAAACTGCCAGGATCA CTTGTTCCGGGGACGCATTGCGGGACAAGTT CGTGTACTGGTACCAGCAGAAGCCGGGTCA AGCCCCAGTGCTCGTGATCTACGACGACAAC AACCGGCCTTCCGGTATCCCCGAACGCTTCT CCGGATCCAATA GCGGAAACACCGCCACCCT GACCATTTCGAGAGCTCAGGCCGGGGATGA AGCGGACTACTACTGCCAGTCATGGGATCAC TCGTACTCCCTCGTCGTGTTTGGAGGCGGCA CGAAGCTTACTGTGCTG SEQ ID NO: 27 Light Chain SYELTQPLSVSVALGQTARITCSGDALRDKFVY WYQQKPGQAPVLVIYDDNNRPSGIPERFSGSN SGNTATLTIS RAQAG DEADYYCQSW DHS YS LV VFGGGTKLTVLGQPKAAPSVTLFPPSSEELQA NKATLVCLISDFYPGAVTVAWKADSSPVKAGV ETTTPSKQS NNKYAASSYLSLTPEQWKSHRSY SCQVTHEGSTVEKTVAPTECS SEQ ID NO: 28 DNA Light Chain AGCTACGAGCTGACCCAGCCGCTGTCGGTG TCAGTCGCCCTGGGACAAACTGCCAGGATCA CTTGTTCCGGGGACGCATTGCGGGACAAGTT CGTGTACTGGTACCAGCAGAAGCCGGGTCA AGCCCC AGTGCTCGTGATCTACGACGACAAC AACCGGCCTTCCGGTATCCCCGAACGCTTCT CCGGATCCAATAGCGGAAAACACCGCCACCCT GACCATTTCGAGAGCTCAGGCCGGGGATGA AGCGGACTACTACTGCCAGTCATGGGATCAC TCGTACTCCCTCGTCGTGTTTGGAGGCGGCA pRC / nn / Lznz / E / Yii 124 CGAAGCTTACTGTGCTGGGCCAGCCTAAGG CCGCTCCCTCCGTGACCCTGTTCCCCCCCAG CTCCGAGGAACTGCAGGCCAACAAGGCCAC CCTGGTGTGCCTGATCAGCGACTTCTACCCT GGCGCCGTGACCGTGGCCTGGAAGGCCGAC AGCAGCCCCGTGAAGGCCGGCGTGGAGACA ACCACCCCCAGCAAG CAGAGCAACAACAAGT ACGCCGCCAGCAGCTACCTGAGCCTGACCC CCGAGCAGTGGAAGAGCCACAGAAGCTACA GCTGCCAGGTCACCCACGAGGGCAGCACCG TGGAGAAAACCGTGGCCCCCACCGAGTGCA GC G1 E152C_S375C_3R LC SEQ ID NO: 1 HCDR1 (Combined) GGTFSD YAIT SEQ ID NO: 2 HCDR2 (Combined) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Combined) EGGLLTDISYSRYWFAY SEQ ID NO: 4 HCDR1 (Kabat) DYAIT SEQ ID NO: 2 HCDR2 (Kabat) GIIPIFGTANYAQKFQG SEQ ID NO: 3 HCDR3 (Kabat) EGGLLTDISYSRYWFAY SEQ ID NO: 5 HCDR1 (Chothia) GGTFSDY SEQ ID NO: 6 HCDR2 (Chothia) IPIFGT SEQ ID NO: 3 HCDR3(Chot hia) EGGLLTDISYSRYWFAY SEQ ID NO: 7 HCDR1 (IMGT) GGTFSDYA SEQ ID NO: 8 HCDR2 (IMGT) IIPIFGTA CAC / nn / Lznz / E / Yu 125 SEQ ID NO: 9 HCDR3 (IMGT) AREGGLLTDISYSRYWFAY SEQ ID NO: 10 VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YA ITW V RQ A PGQG L EW MGG11PIFGTAN YAQ KF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRY WFAYWGQGTLVTVSS SEQ ID NO: 11 VH DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCGGCACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGGTGAC TGTTAGCTCA SEQ ID NO: 12 Heavy Chain QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAITWVRQAPGQGLEWMGGIIPIFGTANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REGGLLTDISYSRYWFAYWGQG TLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPC PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEV HNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK CRC / nn / Lznz / E / Yii 126 SEQ ID NO: 13 Heavy Chain DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTGA CTACGCTATCACTTGGGTGCGCCAGGCCCC GGGCCAGGGCCTCGAGTGGATGGGCGGTAT CATCCCGATCTTCGG CACTGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACCG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGGTGGTCTG CTGACTGACATCTCTTACTCTCGTTACTGGTT CGCTTACTGGGGCCAAGGCACCCTGGT GAC TGTTAGCTCAGCTAGCACCAAGGGCCCAAGT GTGTTTCCCCTGGCCCCCAGCAGCAAGTCTA CTTCCGGCGGAACTGCTGCCCTGGGTTGCC TGGTGAAGGACTACTTCCCCTGTCCCGTGAC AGTGTCCTGGAACTCTGGGGCTCTGACTTCC GGCGTGCACACCTTCCCCCGCCGTGCTGCAG AGCAGCGG CCTGTACAGCCTGAGCAGCGTG GTGACAGTGCCCTCCAGCTCTCTGGGAACCC AGACCTATATCTGCAACGTGAACCACAAGCC CAGCAACACCAAGGTGGACAAGAGAGTGGA GCCCAAGAGCTGCGACAAGACCCACCTG CCCCCCCTGCCCAGCTCCAGAACTGCTGGG AGGGCCTTCCGTGTTCCTGTTCCCCCCCA AG CCCAAGGACACCCTGATGATCAGCAGGACC CCCGAGGTGACCTGCGTGGTGGTGGACGTG TCCCACGAGGACCCAGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCACAACG CCAAGACCAAGCCCAGAGAGGAGCAGTACA ACAGCACCTACAGGGTGGTGTCCGTGCTGA CCGTGCTGCACCAG GACTGGCTGAACGGCA AAGAATACAAGTGCAAAGTCTCCAACAAGGC CRC / nn / Lznz / E / Yii 127 CCTGCCAGCCCCAATCGAAAAGACAATCAGC AAGGCCAAGGGCCAGCCACGGGAGCCCCAG GTGTACACCCTGCCCCCCAGCCGGGAGGAG ATGACCAAGAACCAGGTGTCCCTGACCTGTC TGGTGAAGGGCTTCTACCCCTGTGATATCGC CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAA GACCACCCCCCCAGTGCTG GACAGCGACGGCAGCTTCTTCCTGTACAGCA AGCTGACCGTGGACAAGTCCAGGTGGCAGC AGGGCAACGTGTTCAGCTGCAGCGTGATGC ACGAGGCCCTGCACAACCACTACACCCAGAA GTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 14 LCDR1 (Combined) SG DALRDKFVY SEQ ID NO: 15 LCDR2 (Combined) DDNNRPS SEQ ID NO: 16 LCDR3 (Combined) QSWDHSYSLVV SEQ ID NO: 14 LCDR1 (Kabat ) SGDALRDKFVY SEQ ID NO: 15 LCDR2 (Kabat) DDNNRPS SEQ ID NO: 16 LCDR3 (Kabat) QSWDHSYSLVV SEQ ID NO: 17 LCDR1 (Chothia) DALRDKF SEQ ID NO: 18 LCDR2 (Chothia) DDN SEQ ID NO: 19 LCDR3 (Chothia) ) WDHSYSLV SEQ ID NO: 20 LCDR1 (IMGT) ALRDKF SEQ ID NO: 18 LCDR2 (IMGT) DDN CRC / nn / Lznz / E / Yii 128 SEQ ID NO: 16 LCDR3 (IMGT) QSWDHSYSLVV SEQ ID NO: 29 VL SYELTQPPSVSVSPGQTASITCSGDALRDKFVY WYQQKPGQSPVLVIYDDNNRPSGIPERFSGSN SGNTATLTISGTQAMDEADYYCQSWDHSYSLV VFGGGTKLTVL SEQ ID NO: 30 ADN V L TCGTACGAGCTCACTCAACCGCCTTCTGTGT CCGTGTCACCCGGGCAGACTGCCTCCATTAC CTGTTCGGGAGATGCCCTGCGCGACAAGTTT GTGTACTGGTACCAGCAGAAGCCCGGACAG TCGCCAGTGCTCGTCATCTATGACGACAACA ACAGACCTTCCGGTATCCCGGAACGGTTCAG CGGAAGCAATTCCGGCAACACCG CTACCCTG ACCATTAGCGGCACTCAGGCCATGGACGAA GCGGATTACTACTGCCAATCCTGGGACCACT CATACTCCCTTGTGGTGTTCGGTGGCGGAAC GAAGCTGACCGTCCTG SEQ ID NO: 31 Light Chain SYELTQPPSVSVSPGQTASITCSGDALRDKFVY WYQQKPGQSPVLVIYDDNNRPSGI PERFSGSN SGNTATLTISGTQAMDEADYYCQSWDHSYSLV VFGGGTKLTVLGQPKAAPSVTLFPPSSEELQA NKATLVCLISDFYPGAVTVAWKADSSPVKAGV ETTTPSKQSNNKYAASSYLSLTPEQWKSHRSY SCQVTHEGSTVEKTVAPTECS SEQ ID NO: 32 Light Chain DNA TCGTACGAGCTCACTCAACCGCCTTCTGTGT CCGTGTCACCCGGGCAGACTGCCTCCATTAC CTGTTCGGGAGATGCCCTGCGCGACAAGTTT GTGTACTGGTACCAGCAGAAGCCCGGACAG TCGCCAGTGCTCGTCATCTATGACGACAACA ACAGACCTTCGGTATCCCGGAACGGTTCAG CGGAAGCAATTCCGGCAACACCGCTACCCTG ACCATTAGCGGCACTCAGGCCATGGACGAA GCGGATTACTACTGCCAATCCTGGGACCACT CATACTCCCTTGTGGTGTTCGGTGGCGGAAC pRC / nn / Lznz / E / Yii 129 GAAGCTGACCGTCCTGGGCCAGCCTAAGGC CGCTCCCTCCGTGACCCTGTTCCCCCCAGC TCCGAGGAACTGCAGGCCAACAAGGCCACC CTGGTGTGCCTGATCAGCGACTTCTACCCTGGCGCCGTGACCGTGGCCTGGAAGGCCGACA GCAGCCCCGTGAAGGCCGGCGTGGAGACAA CCACCCCCAGCA AGCAGAGCAACAACAAGTA CGCCGCCAGCAGCTACCTGAGCCTGACCCC CGAGCAGTGGAAGAGCCACAGAAGCTACAG CTGCCAGGTCACCCACGAGGGCAGCACCGT GGAGAAAACCGTGGCCCCCACCGAGTGCAG C G4 E152_S375C SEQ ID NO: 33 HCDR1 (Combined) GGTFSTYAIS SE Q ID NO: 34 HCDR2 (Combined) RIIPILGIANYAQKFQG SEQ ID NO: 35 HCDR3 (Combined) EVRMIFDY SEQ ID NO: 36 HCDR1 (Kabat) TYAIS SEQ ID NO: 34 HCDR2 (Kabat) RIIPILGIANYAQKFQG SEQ ID NO: 35 HCDR3 (Kabat) EVRMIFDY SEQ ID NO: 37 HCDR1 (Chothia) GGTFSTY SEQ ID NO: 38 HCDR2 (Chothia) IPILGI SEQ ID NO: 35 HCDR3 (Chot hia) EVRMIFDY SEQ ID NO: 39 HCDR1 (IMGT) GGTFSTYA SEQ ID NO: 40 HCDR2 (IMGT) IIPILGIA CAC / nn / Lznz / E / Yii 130 SEQ ID NO: 41 HCDR3 (IMGT) AREVRMIFDY SEQ ID NO: 42 VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFST YAISWVRQAPGQGLEWMGRIIPILGIANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REVRMIFDYWGQGTLVTVSS SEQ ID NO: 43 DNA VH CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAACCGGGCAGCAGCGTGAAAGTTA GCTGCAAAGCATCCGGAGGGACG lili CTAC TTACGCTATTCCTTGGGTGCGCCAGGCCCCG GGCCAGGGCCTCGAGTGGATGGGCCGTATC ATCCCGATCCTGGGCATCGCGAACTACGCC CAGA AATTTCAGGGCCGGGTGACCATTACCG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCTGCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGTTCGTATG ATCTTCGATTACTGGGGCCAAGGCACCCTGG TGACTGTTAGCTCA SEQ ID NO: 44 Heavy Chain QVQLVQSGAEV KKPGSSVKVSCKASGGTFST YAISWVRQAPGQGLEWMGRIIPILGIANYAQKF QGRVTITADESTSTAYMELSSLRSEDTAVYYCA REVRMIFDYWGQGTLVTVSSASTKGPSVFPLA PSSKSTSGGTAALGCLVKDYFPCPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSCDKTHTC PPCPAPELLGGPSVFLFPP KPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPCDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 45 Heavy Chain DNA CAGGTGCAATTGGTGCAGAGCGGTGCCGAA GTGAAAAAACCGGGCAGCAGCGTGAAAGTTA CRC / nn / Lznz / E / Yii 131 GCTGCAAAGCATCCGGAGGGACGTTTTCTAC TTACGCTATTCCTTGGGTGCGCCAGGCCCCG GGCCAGGGCCTCGAGTGGATGGGCCGTATC ATCCCGATCCTGGGCATCGCGAACTACGCC CAGAAATTTCAGGGCCGGGTGACCATTACCG CCGATGAAAGCACCAGCACCGCCTATATGGA ACTGAGCAGCCT GCGCAGCGAAGATACGGC CGTGTATTATTGCGCGCGTGAAGTTCGTATG ATCTTCGATTACTGGGGCCAAGGCACCCTGG TGACTGTTAGCTCAGCCTCTACGAAAGGCCC AAGCGTATTTCCCCTGGCTCCTTCTAGTAAAT CAACCTCAGGTGGTACAGCAGCCCTTGGCT GCCTGGTCAAAGACTATTTCCCCTGTC CGGT GACCGTCTCATGGAACTCAGGTGCTTTGACA TCTGGTGTGCATACATTCCCAGCTGTGCTGC AAAGTAGTGGACTGTACAGCCTTTCCAGCGT GGTCACGGTGCCAAGTAGCTCCTTGGGTACT CAGACTTATATCTGCAATGTGAACCACAAGC CCTCTAACACGAAGGTGGACAAGCGCGTGG AGCC CAAATCTTGCGATAAGACGCATACTTG TCCCCCATGCCCTGCTCCTGAGCTGTTGGGA GGCCCGTCAGTGTTCTTGTTCCCTCCGAAGC CTAAGGACACTTTGATGATAAGTAGGACACC AGAGGTGACTTGCGTGGTGGTTGATGTGTCC CATGAAGATCCCGAGGTCAAATTTAATTGGT ACGTAGATGGTGTC GAAGTTCACAATGCTAA GACTAAGCCAAGGGAAGAGCAGTACAACAGT ACATATAGGGTAGTCTCCGTGCTGACAGTCC TCCACCAGGACTGGTTGAACGGCAAGGAATA CAAATGTAAGGTGTCAAACAAAGCTCTGCCT GCTCCCATTGAGAAAACATCTCTAAAGCCA AAGGCCAGCCGAGAGAGCCCCAAGTCTACA CTTTGCCCC CGAGCAGGGAGGAAATGACCA CAC / nn / Lznz / E / Yii 132 AGAATCAGGTGAGTCTGACGTGCCTCGTCAA AGGA lili ATCCATGCGATATTGCAGTTGAAT GGGAGAGCAATGGCCAGCCAGAGAACAACT ATAAAACCACACCACCCGTGCTCGACTCTGA TGGCAGCTTCTTCCTCTATAGCAAGCTGACA GTCGATAAATCTCGCTGGCAGCAAGGCAATG TGTTCTCCTGCTCCGTCATG CACGAGGCTTT GCATAACCATTATACTCAAAAATCTCTGTCCC TGTCACCTGGTAAA SEQ ID NO: 46 LCDR1 (Combined) RASQSISSYLA SEQ ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 48 LCDR3 (Combined) QQSYDYYT SEQ ID NO: 46 LCDR1 (Kabat) RASQSISSYLA SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 48 LCDR3 (Kabat) QQSYDYYT SEQ ID NO: 49 LCDR1 (Chothia) SQSISSY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 51 LCDR3 (Chothia) SYDYY SEQ NO: 52 LCDR1 (IMGT) QSISSY SEQ ID NO: 50 LCDR2 (IMGT) AAS SEQ NO: 48 LCDR3 (IMGT) QQSYDYYT SEQ ID NO: 53 VL DIQMTQSSSSLSASVGDRVTITCRASQSISSYL AWYQKP SGVPSRFSGS CAC / nn / Lznz / E / Yii 133 GSGTDFTLTISSLQPEDFATYYCQQSYDYYTFG QGTKVEIK SEQ ID NO: 54 ADN VL GATATCCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCCAGCGTGGGCGATCGCGTGACC ATTACCTGCAGAGCCAGCCAGTCTATTTCTT CTTACCTGGCTTGGTACCAGCAGAAACCGGG CAAAGCGCCGA AACTATTAATCTACGCTGCT TCTTCTCTGCAAAGCGGCGTGCCGAGCCGC TTTAGCGGCAGCGGATCCGGCACCGATTTCA CCCTGACCATTAGCTCTCTGCAACCGGAAGA CTTTGCGAACCTATTATTGCCAGCAGTCTTAC GACTACTACACCTTTGGCCAGGGCACGAAAG TTGAAATTAAA SEQ ID NO: 55 DIQMT Light Chain QSPSSLSASVGDRVTITCRASQSISSYL AWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQSYDYYTFG QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLT LSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC SEQ ID NO: 56 Light Chain DNA GATATCCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCCAGCGTGGGCGATCGCGTGACC ATTACCTGCAGAGCCAGCCAGTCTATTTCTT CTTACCTGGCTTGGTACCAGCAGAAACCGGG CAAAGCGCCGAAACTATTAATCT ACGCTGCT TCTTCTCTGCAAAGCGGCGTGCCGAGCCGC TTTAGCGGCAGCGGATCCGGCACCGATTTCA CCCTGACCATTAGCTCTCTGCAACCGGAAGA CTTTGCGACCCTATTATTGCCAGCAGTCTTAC GACTACTACACCTTTGGCCAGGGCACGAAAG TTGAAATTAAACGTACGGTGGCAGCTCCGTC TGTTTTCATCTTTCCACCTAGCGACGAGCAA CTCAAAAGTGGTACAGCATCCGTGGTTTGTC CRC / nn / Lznz / E / Yii 134 TGCTGAACAATTTTTACCCCAGGGAGGCTAA GGTCCAGTGGAAAGTCGATAACGCTCTTCAG TCTGGCAACAGTCAGGAGAGCGTCACAGAG CAGGACTCTAAGGATAGCACTTATAGTCTGT CCTCCACGCTGACACTGTCTAAAGCGGATTA TGAGAAGCACAAGGTTTACGCCTGTGAGGTA ACGCACCAAGGACTCTCCTCCCCA GTTACCA AATCTTTCAACAGAGGAGAATGT MOR024353 E152C_S375C SEQ ID NO: 57 HCDR1 (Combined) GGTFSDYAIS SEQ ID NO: 58 HCDR2 (Combined) GIIPIFGDANYAQKFQG SEQ ID NO: 59 HCDR3 (Combined) EGSSYFYMAY SEQ ID NO: 60 HCDR1 (Kabat) DYAIS SEQ ID NO: 58 HCDR2 (Kabat) GIIPIFGDANYAQKFQG SEQ ID NO: 59 HCDR3 (Kabat) EGSSYFYMAY SEQ ID NO: 5 HCDR1 (Chothia) GGTFSDY SEQ ID NO: 61 HCDR2 (Chothia) IPIFGD SEQ ID NO: 59 HCDR3(Chot hia) EGSSYFYMAY SEQ ID NO: 7 HCDR1 (IMGT) GGTFSDYA SEQ ID NO: 62 HCDR2 (IMGT) IIPIFGDA SEQ ID NO: 63 HCDR3 (IMGT) AREGSSYFYMAY CRC / nn / Lznz / E / Yii 135 SEQ ID NO: 64 VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAISWVRQAPGQGLEWMGGIIPIFGDANYAQK FQG R VTITAD ESTSTAYME LSS L RSE DTAV YYC AREGSSYFYMAYWGQGTLVTVSS SEQ ID NO: 65 ADN VH CAGGTTCAGCTGGTGCAGTCT GGCGCCGAA GTGAAGAAACCTGGCAGCAGCGTGAAGGTG TCCTGCAAAGCAAGCGGCGGCACCTTCAGC GATTACGCCATTCTCTTGGGTCCGACAGGCCC CTGGACAAGGCTTGGAATGGATGGGCGGCA TCATCCCCATTCTCGGCGACGCCAATTACGC CCAGAAATTCCAGGGCAGAGTGACCATCACC GCCGA CGAGTCTACAAGCACCGCCTACATG GAACTGAGCAGCCTGAGAAGCGAGGACACC GCCGTGTACTACTGTGCCAGAGAGGGCAGC AGCTACTTCTACATGGCCTATTGGGGCCAGG GCACCCTGGTCACAGTTAGCTCT SEQ ID NO: 66 Heavy Chain QVQLVQSGAEVKKPGSSVKVSCKASGGTFSD YAIS WVRQAPGQGLEWMGGIIPIFGDANYAQK FQG RVT ITAD ESTSTAYME LSS L CSR DTAV YYC AREGSSYFYMAYWGQGTLVTVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPCPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPCDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNV FSCSVMHEALHNHYTQKSLSLSP GK SEQ ID NO: 67 Heavy Chain DNA CAGGTTCAGCTGGTGCAGTCTGGCGCCGAA GTGAAGAAACCTGGCAGCAGCGTGAAGGTG CRC / nn / Lznz / E / Yii 136 TCCTGCAAAGCAAGCGGCGGCACCTTCAGC GATTACGCCATTCCTTGGGTCCGACAGGCCC CTGGACAAGGCTTGGAATGGATGGGCGGCA TCATCCCCATCTTCGGCGACGCCAATTACGC CCAGAAATTCCAGGGCAGAGTGACCATCACC GCCGACGAGTCTACAAGCACCGCCTACATG GAACTGAGCAGCCTGA GAAGCGAGGACACC GCCGTGTACTACTGTGCCAGAGAGGGCAGC AGCTACTTCTACATGGCCTATTGGGGCCAGG GCACCCTGGTCACAGTTAGCTCTGCTAGCAC CAAGGGCCCAAGTGTGTTTCCCCTGGCCCC CAGCAGCAAGTCTACTTCCGGCGGAACTGCT GCCCTGGGTTGCCTGGTGAAGGACTACTTCC CCT GTCCCGTGACAGTGTCCTGGAACTCTGG GGCTCTGACTTCCGGCGTGCACACCTTCCCC GCCGTGCTGCAGAGCAGCGGCCTGTACAGC CTGAGCAGCGTGGTGACAGTGCCCTCCAGC TCTCTGGGAACCCAGACCTATATCTGCAACG TGAACCACAAGCCCAGCAACACCAAGGTGG ACAAGAGAGTGGAG CCCAAGAGCTGCGACA AGACCCACACCTGCCCCCCCTGCCCAGCTC CAGAACTGCTGGGAGGGCCTTCCGTGTTCCT GTTCCCCCCCAAGCCCAAGGACACCCTGAT GATCAGCAGGACCCCCGAGGTGACCTGCGT GGTGGTGGACGTGTCCCACGAGGACCCAGA GGTGAAGTTCAACTGGTACGTGGACGGCGT GGA GGTGCACAACGCCAAGACCAAGCCCAG AGAGGAGCAGTACAACAGCACCTACAGGGT GGTGTCCGTGCTGACCGTGCTGCACCAGGA CTGGCTGAACGGCAAAGAATACAAGTGCAAA GTCTCCAACAAGGCCCTGCCAGCCCCAATC GAAAGACAATCAGCAAGGCCAAGGGCCAG CCACGGGAGCCCCAGGTGTACA CCCTGCCC CRC / nn / Lznz / E / Yu 137 CCCAGCCGGGAGGAGATGACCAAGAACCAG GTGTCCCTGACCTGTCTGGTGAAGGGCTTCT ACCCCTGTGATATCGCCGTGGAGTGGGAGA GCAACGGCCAGCCCGAGACAACTACAAGA CCACCCCCCCAGTGCTGGACAGCGACGGCA GCTTCTCCTGTACAGCAAGCTGACCGTGGA CAAGTCCAGGTGGCA GCAGGGCAACGTGTT CAGCTGCAGCGTGATGCACGAGGCCCTGCA CAACCACTACACCCAGAAGTCCCTGAGCCTG AGCCCCGGCAAG SEQ ID NO: 68 LCDR1 (Combined) SGDNIGSKLAS SEQ ID NO: 69 LCDR2 (Combined) DDSNRPS SEQ ID NO: 70 LCDR3 (Combined) AATAGDRWAYV SEQ ID NO: 68 LCDR1 (Kabat) SGDNIGSKLAS SEQ ID NO: 69 LCDR2 (Kabat) DDSNRPS SEQ ID NO: 70 LCDR3 (Kabat) AATAGDRWAYV SEQ ID NO: 71 LCDR1 (Chothia) DNIGSKL SEQ ID NO: 72 LCDR2 (Chothia) DDS SEQ ID NO: 73 LCDR3 (Chothia) TAGDRWAY SEQ ID NO: 74 LCDR1 (IMGT) NIGSKL SEQ ID NO: 72 LCDR2 (IMGT) DDS SEQ ID NO: 70 LCDR3 (IMGT) AATAGDRWAYV CRC / nn / Lznz / E / Yii 138 SEQ ID NO: 75 VL SYELTQPLSVSVALGQTARITCSGDNIGSKLAS WYQQKPGQAPVLVIYDDSNRPSGIPERFSGSN SGNTATLTISRAQAGDEADYYCAATAGDRWAY VFGGGTKLTVL SEQ ID NO: 76 ADN VL AGCTATGAGCTGACACAGCCTCTGTCCGTGT CTGTGGCTCT GGGACAGACCGCCAGAATCA CCTGTAGCGGCGACAACATCGGCAGCAAGC TGGCCTCTTGGTATCAGCAGAAGCCTGGACA GGCCCCTGTGCTGGTCATCTACGACGACAG CAATAGACCCAGCGGCATCCCCGAGAGATTC AGCGGCAGCAATAGCGGCAATACCGCCACA CTGACCATCAGCAGAGCACAGGCTGGCGAC G AGGCCGATTACTATTGTGCTGCCACAGCCG GCGACAGATGGGCCTATGTTTTTGGCGGCG GAACAAAGCTGACCGTGCTG SEQ ID NO: 77 Light Chain SYELTQPLSVSVALGQTARITCSGDNIGSKLAS WYQQKPGQAPVLVIYDDSNRPSGIPERFSGSN SG NTATLTIS RAQAG D E AD YY C A ATAG D RW AY VFGGGTKLTVLGQPKAAPSVTLFPPSSEELQA NKATLVCLISDFYPGAVTVAWKADSSPVKAGV ETTTPSKQSNNKYAASSYLSLTPEQWKSHRSY SCQVTHEGSTVEKTVAPTECS SEQ ID NO: 78 DNA Light Chain AGCTATGAGCTGACACAGCCTCTGTCCGTGT CTGTGGCTCTGGGACAGACCGCCAGAATCA CCTGTAGCGGCGACAACATCGGCAGCAAGC TGGCCTCTTGGTATCAGCAGAAGC CTGGACA GGCCCCTGTGCTGGTCATCTACGACGACAG CAATAGACCCAGCGGCATCCCCGAGAGATTC AGCGGCAGCAATAGCGGCAATACCGCCACA CTGACCATCAGCAGAGCACAGGCTGGCGAC GAGGCCGATTACTATTGTGCTGCCACAGCCG GCGACAGATGGGCCTATGTTTTTGGCGGCG GAACAAAGCTGACC GTGCTGGGACAGCCTA pRC / nn / Lznz / E / Yii 139 AGGCCGCTCCCTCCGTGACCCTGTTCCCCC CCAGCTCCGAGGAACTGCAGGCCAACAAGG CCACCCTGGTGTGCCTGATCAGCGACTTCTA CCCTGGCGCCGTGACCGTGGCCTGGAAGGC CGACAGCAGCCCCGTGAAGGCCGGCGTGGAGACAACCACCCCCAGCAAGCAGAGCAACAA CAAGTACGCCGCCAGCAG CTACCTGAGCCT GACCCCCGAGCAGTGGAAGAGCCACAGAAG CTACAGCTGCCAGGTCACCCACGAGGGCAG CACCGTGGAGAAAACCGTGGCCCCCACCGA GTGCAGC MOR024354 E152C_S375C SEQ ID NO: 79 HCDR1 (Combined) GFTFSSFGMS SEQ ID NO: 80 HCDR2 (Combined) combined) AISYSGSDTYYADSVKG SEQ ID NO: 81 HCDR3 (Combined) DVGVMDY SEQ ID NO: 82 HCDR1 ( Kabat) SFGMS SEQ ID NO: 80 HCDR2 (Kabat) AISYSGSDTYYADSVKG SEQ ID NO: 81 HCDR3 (Kabat) DVGVMDY SEQ ID NO: 83 HCDR1 (Chothia) GFTFSSF SEQ ID NO: 84 HCDR2 (Chothia) SYSGSD SEQ ID NO: 81 HCDR3( Chot hia) DVGVMDY SEQ ID NO: 85 HCDR1 (IMGT) GFTFSSFG SEQ ID NO: 86 HCDR2 (IMGT) ISYSGSDT CAC / nn / Lznz / E / Yu 140 SEQ ID NO: 87 HCDR3 (IMGT) ARDVGVMDY SEQ ID NO: 88 VH QVQLLESGGGLVQPGGSLRLSCAASGFTFSSF GMSWVRQAPGKGLEWVSAISYSGSDTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARDVGVMDYWGQGTLVTVSS SEQ ID NO: 89 VH DNA CAGGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTCAGCAG CTTTGGCATGAGCTGGGTCCGAACAGGCCCC TGGCAAAGGACTTGAATGGGTGTCCGCCATC AGCTACAGCGGCAGCGATACCTACTACGCC GAC AGCGTGAAGGGCAGATTCACCCATCTCCA GAGACAACAGCAAGAACACCCTGTACCTGCA GATGAACAGCCTGAGAGCCGAGGACACCGC CGTGTACTACTGTGCCAGAGATGTGGGCGT GATGGACTATTGGGGCCAGGGCACACTGGT CACCGTTAGCTCT SEQ ID NO: 90 Heavy Chain QVQLLESGGGLV QPGGSLRLSCAASGFTFSSF GMSWVRQAPGKGLEWVSAISYSGSDTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARDVGVMDYWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPCPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS LGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNS TYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTSCLVKGFYPCDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 91 Heavy Chain DNA CAGGTT CAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CRC / nn / Lznz / E / Yii 141 CTTGTGCCGCCAGCGGCTTCACCTTCAGCAG CTTTGGCATGAGCTGGGTCCGAACAGGCCCC TGGCAAAGGACTTGAATGGGTGTCCGCCATC AGCTACAGCGGCAGCGATACCTACTACGCC GACAGCGTGAAGGGCAGATTCACCATCTCCA GAGACAACAGCAAGAACACCTGTACCTGCA GATGAACAGCCTGAGA GCCGAGGACACCGC CGTGTACTACTGTGCCAGAGATGTGGGCGT GATGGACTATTGGGGCCAGGGCACACTGGT CACCGTTAGCTCTGCTAGCACCAAGGGCCCA AGTGTGTTTCCCCTGGCCCCCAGCAGCAAGT CTACTTCCGGCGGAACTGCTGCCCTGGGTT GCCTGGTGAAGGACTACTTCCCCTG TCCCGT GACAGTGTCCTGGAACTCTGGGGCTCTGACT TCCGGCGTGCACACCTTCCCCGCCGTGCTG CAGAGCAGCGGCCTGTACAGCCTGAGCAGC GTGGTGACAGTGCCCTCCAGCTCTCTGGGA ACCCAGACCTATATCTGCAACGTGAACCACA AGCCCAGCAACACCAAGGTGGACAAGAGAG TGGAGCCCA AGAGCTGCGACAAGACCCACA CCTGCCCCCCCTGCCCAGCTCCAGAACTGC TGGGAGGGCCTTCCGTGTTCCTGTTCCCCCC CAAGCCCAAGGACACCCTGATGATCAGCAG GACCCCCGAGGTGACCTGCGTGGTGGTGGA CGTGTCCCACGAGGACCCAGAGGTGAAGTT CAACTGGTACGTGGACGGCGTGGAG GTGCA CAACGCCAAGACCAAGCCCAGAGAGGAGCA GTACAACAGCACCTACAGGGTGGTGTCCGT GCTGACCGTGCTGCACCAGGACTGGCTGAA CGGCAAAGAATACAAGTGCAAAGTCTCCAAC AAGGCCCTGCCAGCCCCAATCGAAAGACAA TCAGCAAGGCCAAGGGCCAGCCACGGGAGC CCCAGGTGTACA CCCTGCCCCCCAGCCGGG CRC / nn / Lznz / E / Yii 142 AGGAGATGACCAAGAACCAGGTGTCCCTGA CCTGTCTGGTGAAGGGCTTCTACCCCTGTGA TATCGCCGTGGAGTGGGAGAGCAACGGCCA GCCCGAGAACAACTACAAGACCACCCCCCC AGTGCTGGACAGCGACGGCAGCTTCTCCT GTACAGCAAGCTGACCGTGGACAAGTCCAG GTGGCAGCAGGG CAACGTGTTCAGCTGCAG CGTGATGCACGAGGCCCTGCACAACCACTA CACCCAGAAGTCCCTGAGCCTGAGCCCCGG CAAG SEQ ID NO: 92 LCDR1 (Combined) SGDNLGTYYAH SEQ ID NO: 93 LCDR2 (Combined) SQSHRPS SEQ ID NO: 94 LCDR3 (Combined) GAWDAPSPELV SEQ ID NO: 92 LCDR1 (Kabat) SGDNLGTYYAH SEQ ID NO: 93 LCDR2 (Kabat) SQSHRPS SEQ ID NO: 94 LCDR3 (Kabat) GAWDAPSPELV SEQ ID NO: 95 LCDR1 (Chothia) DNLGTYY SEQ ID NO: 96 LCDR2 (Chothia) SQS SEQ ID NO: 97 LCDR3 (Chothia) WDAPSPEL SEQ ID NO: 98 LCDR1 (IMGT) NLGTYY SEQ ID NO: 96 LCDR2 (IMGT) SQS SEQ ID NO: 94 LCDR3 (IMGT) GAWDAPSPELV CAC / nn / Lznz / E / Yii 143 SEQ ID NO: 99 VL SYELTQPLSVSVALGQTARITCSGDNLGTYYAH WYQQKPGQAPVLVIYSQSHRPSGIPERFSGSN SGNTATLTIS RAQAG DEADYYCG AW DAPS PE L VFGGGTKLTVL SEQ ID NO: 100 ADN VL AGCTATGAGCTGACACAGCCTCTGTCCGTGT CTGTGGCTCTGGGACAGACCGCCAGAATCA CCTGTAGCGGCGATAACCTGGGCACCTACTA CGCCCACTGGTATCAGCAGAAGCCTGGACA GGCTCCCGTGCTGGTCATCTACAGCCAGTCT CACAGACCCAGCGGCATCCCCGAGAGATTC AGCGGCAGCAATAGCGGCAATACCGCCACA CTGACCATCAGCAGAGCACAGG CTGGCGAC GAGGCCGATTACTATTGTGGCGCTTGGGAC GCCCCATTCCCTGAGCTTGTTTTTGGCGGAG GCACCAAGCTGACAGTGCTG SEQ ID NO: 101 Light Chain SYELTQPLSVSVALGQTARITCSGDNLGTYYAH WYQQKPGQAPVLVIYSQSHRPSGIPERFSGSN SGNTATLT IS RAQAG DEADYYCG AW DAPS PE L VFGGGTKLTVLGQPKAAPSVTLFPPSSEELQA NKATLVCLISDFYPGAVTVAWKADSSPVKAGV ETTTPSKQSNNKYAASSYLSLTPEQWKSHRSY SCQVTHEGSTVEKTVAPTECS SEQ ID NO: 102 DNA Light Chain AGCTATGAGCTGACACAGCCTCTGTCCGTGT CTGTGGCTCT GGGACAGACCGCCAGAATCA CCTGTAGCGGCGATAACCTGGGCACCTACTA CGCCCACTGGTATCAGCAGAAGCCTGGACA GGCTCCCGTGCTGGTCATCTACAGCCAGTCT CACAGACCCAGCGGCATCCCCGAGAGATTC AGCGGCAGCAATAGCGGCAATACCGCCACA CTGACCATCAGCAGAGCACAGGCTGGCGAC GAG GCCGATTACTATTGTGGCGCTTGGGAC GCCCCATTCCCTGAGCTTGTTTTTGGCGGAG GCACCAAGCTGACAGTGCTGGGACAGCCTA CRC / nn / Lznz / E / Yii 144 AGGCCGCTCCCTCCGTGACCCTGTTCCCCC CCAGCTCCGAGGAACTGCAGGCCAACAAGG CCACCCTGGTGTGCCTGATCAGCGACTTCTA CCCTGGCGCCGTGACCGTGGCCTGGAAGGC CGACAGCAGCCCCGTGAAGGCCGGCGTGGAGACAACCACCCCCAGCAAGCAGAGCAACAA CAAGTACGCCGCCAGCAG CTACCTGAGCCT GACCCCCGAGCAGTGGAAGAGCCACAGAAG CTACAGCTGCCAGGTCACCCACGAGGGCAG CACCGTGGAGAAAACCGTGGCCCCCACCGA GTGCAGC Y010341 E152C_S375C SEQ ID NO: 103 HCDR1 (Combined) GFTFSSYAMS SEQ ID NO: 104 HCDR2 (Combined) AISGSGGSTYYADSVKG SEQ ID NO: 105 HCDR3 (Combined) AFRLYWLDV SEQ ID NO: 106 HCDR1 ( Kabat) SYAMS SEQ ID NO: 104 HCDR2 (Kabat) AISGSGGSTYYADSVKG SEQ ID NO: 105 HCDR3 (Kabat) AFRLYWLDV SEQ ID NO: 107 HCDR1 (Chothia) GFTFSSY SEQ ID NO: 108 HCDR2 (Chothia) SGSGGS SEQ ID NO: 105 HCDR 3( Chot hia) AFRLYWLDV SEQ ID NO: 109 HCDR1 (IMGT) GFTFSSYA SEQ ID NO: 110 HCDR2 (IMGT) ISGSGGST CAC / nn / Lznz / E / Yii 145 SEQ ID NO: 111 HCDR3 (IMGT) ARAFRLYWLDV SEQ ID NO: 112 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARAFRLYWLDVWGQGTLVTVSS SEQ ID NO : 113 DNA VH GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGAACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCAGCACATATTACG CCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTATTGTGCCAGAGCCTTCCGGCTGT ACTGGCTGGATGTTTGGGGACAGGGCACCC TGGTCACAGTGTCATCT SEQ ID NO: 114 Heavy Chain EVQLLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARAFRLYWLDVWGQGTLVTVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPCPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQY NSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPCDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK pRC / nn / Lznz / E / Yii 146 SEQ ID NO: 115 Heavy Chain DNA GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCA GCACATATTACGCCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTATTGTGCCAGAGCCTTCCGGCTGT ACTGGCTGGATGTTTGGGGACAGGGCACCC TGGTCACAGTGTCATCTGCTAGCACCA AGGG CCCAAGTGTGTTTCCCCTGGCCCCCAGCAG CAAGTCTACTTCCGGCGGAACTGCTGCCCTG GGTTGCCTGGTGAAGGACTACTTCCCCTGTC CCGTGACAGTGTCCTGGAACTCTGGGGCTCT GACTTCCGGCGTGCACACCTTCCCCGCCGT GCTGCAGAGCAGCGGCCTGTACAGCCTGAG CAGCGTGGT GACAGTGCCCTCCAGCTCTCT GGGAACCCAGACCTATATCTGCAACGTGAAC CACAAGCCCAGCAACACCAAGGTGGACAAG AGAGTGGAGCCCAAGAGCTGCGACAAAGACC CACACCTGCCCCCCCTGCCCAGCTCCAGAA CTGCTGGGAGGGCCTTCCGTGTTCCTGTTCC CCCCCAAGCCCAAGGACACCCTGATGATCA GCAG GACCCCCGAGGTGACCTGCGTGGTGG TGGACGTGTCCCACGAGGACCCAGAGGTGA AGTTCAACTGGTACGTGGACGGCGTGGAGG TGCACAACGCCAAGACCAAGCCCAGAGAGG AGCAGTACAACAGCACCTACAGGGTGGTGTC CGTGCTGACCGTGCTGCACCAGGACTGGCT GAACGGCAAAGA ATACAAGTGCAAAGTCTCC AACAAGGCCCTGCCAGCCCCAATCGAAAAGA CRC / nn / Lznz / E / Yu 147 CAATCAGCAAGGCCAAGGGCCAGCCACGGG AGCCCCAGGTGTACACCCTGCCCCCCAGCC GGGAGGAGATGACCAAGAACCAGGTGTCCC TGACCTGTCTGGTGAAGGGCTTCTACCCCTG TGATATCGCCGTGGAGTGGGAGAGCAACGG CCAGCCCGAGAACAACTACAAGACCACCCC CCCAGTGCTGGACA GCGACGGCAGCTTCTT CCTGTACAGCAAGCTGACCGTGGACAAGTCC AGGTGGCAGCAGGGCAACGTGTTCAGCTGC AGCGTGATGCACGAGGCCCTGCACAACCAC TACACCCAGAAGTCCCTGAGCCTGAGCCCC GGCAAG SEQ ID NO: 116 LCDR1 (Combined) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 117 LCDR3 (Combined) QQVYSAPVT SEQ ID NO: 116 LCDR1 (Kabat ) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 117 LCDR3 (Kabat) QQVYSAPVT SEQ ID NO: 49 LCDR1 (Chothia) SQSISSY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 118 LCDR3 (Chothia) ) VYSAPV SEQ ID NO: 52 LCDR1 (IMGT) QSISSY SEQ ID NO: 50 LCDR2 (IMGT) AAS CRC / nn / Lznz / E / Yii 148 SEQ ID NO: 117 LCDR3 (IMGT) QQVYSAPVT SEQ ID NO: 119 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVYSAPVTF GQGTKVEIK SEQ ID NO: 120 ADN V L GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I ICTGGCAGCGGCT CTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAGGTCTA CAGCGCCCCTGTGACATTTGGCCAGGGCAC CAAGGTGGAAATCAAG SEQ ID NO: 121 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQ SGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVYSAPVTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 122 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGT GGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I I CTGGCAGCGGCTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG AC TTCGCCACCTACTACTGCCAGCAGGTCTACAGCGCCCCTGTGACATTTGGCCAGGGCAC CRC / nn / Lznz / E / Yii 149 CAAGGTGGAAATCAAGCGTACGGTGGCCGC TCCCAGCGTGTTCATCTTCCCCCCCAGCGAC GAGCAGCTGAAGAGTGGCACCGCCAGCGTG GTGTGCCTGCTGAACAACTTCTACCCCCGGG AGGCCAAGGTGCAGTGGAAGGTGGACAACG CCCTGCAGAGCGGCAACAGCCAGGAGAGCG TCACCGAGCAG GACAGCAAGGACTCCACCT ACAGCCTGAGCAGCACCCTGACCCTGAGCA AGGCCGACTACGAGAAGCATAAGGTGTACG CCTGCGAGGTGACCCACCAGGGCCTGTCCA GCCCCGTGACCAAGAGCTTCAACAGGGGCG AGTGC Y010355 E152C—S375C SEQ ID NO: 123 HCDR1 (Combined ) GFTFSNYWIS SEQ ID NO: 124 HCDR2 (Combined) RIKSKTYGGTTDYAEPVKG SEQ ID NO: 125 HCDR3 (Combined) TSRRSYAFDY SEQ ID NO: 126 HCDR1 (Kabat) NYWIS SEQ ID NO: 124 HCDR2 (Kabat) RIKSKTYGGTTDYAEPVKG SEQ ID NO: 125 HCDR3 (Kabat) TSRRSYAFDY SEQ ID NO: 127 HCDR1 (Chothia) GFTFSNY SEQ ID NO: 128 HCDR2 (Chothia) KSKTY GGT SEQ ID NO: 125 HCDR3(Chot hia) TSRRSYAFDY SEQ ID NO: 129 HCDR1 (IMGT) GFTFSNYW SEQ ID NO: 130 HCDR2 (IMGT) IKSKTYGGTT pRC / nn / Lznz / E / Yii 150 SEQ ID NO: 131 HCDR3 (IMGT) ARTSRRSYAFDY SEQ ID NO: 132 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNY WISWVRQAPGKGLEWVGRIKSKTYGGTTDYA EPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARTSRRSYAFDYWGQGTL VTVSS SEQ ID NO: 133 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA CTACTGGATCAGCTGGGTCCGACAGGCCCC TGGCAAAGGACTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCTACGG CGGCACCACCGA TTATGCCGAGCCTGTGAAGGGCAGATTCACC ATCAGCCGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGAACCA GCAGAAGAAGCTACGCCTTCGACTACTGGGGCCAGGGCACACTGGTTACCGTTAGCTCT SEQ ID NO: 134 String Heavy EVQLVESGGGLVKPGGSLRLSCAASGFTFSNY WISWVRQAPGKGLEWVGRIKSKTYGGTTDYA EPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARTSRRSYAFDYWGQGTLVTVSSASTKGP SVFPLAPSSKSSGGTAALGCLVKDYFPCPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREE QYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPCDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK pRC / nn / Lznz / E / Yii 151 SEQ ID NO: 135 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA CTACTGGATCAGCTGGGTCCGACAGGCCCC TGGCAAAGGACTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCTACGG CGGCACCACCGA TTATGCCGAGCCTGTGAAGGGCAGATTCACC ATCAGCCGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGAACCA GCAGAAGAAGCTACGCCTTCGACTACTGGGGCCAGGGCACACTGGTTACCGTTAGCTCTGC TAGCACCAAGGG CCCAAGTGTGTTTCCCCTG GCCCCCAGCAGCAAGTCTACTTCCGGCGGA ACTGCTGCCCTGGGTTGCCTGGTGAAGGAC TACTTCCCCTGTCCCGTGACAGTGTCCTGGA ACTCTGGGGCTCTGACTTCCGGCGTGCACA CCTTCCCCGCCGTGCTGCAGAGCAGCGGCC TGTACAGCCTGAGCAGCGTGGT GACAGTGC CCTCCAGCTCTCTGGGAACCCAGACCTATAT CTGCAACGTGAACCACAAGCCCAGCAACACC AAGGTGGACAAGAGAGTGGAGCCCAAGAGC TGCGACAAGACCCACACCTGCCCCCCCTGC CCAGCTCCAGAACTGCTGGGAGGGCCTTCC GTGTTCCTGTTCCCCCCCAAGCCCAAGGACA CCCTGATGATCAGCAG GACCCCCGAGGTGA CCTGCGTGGTGGTGGACGTGTCCCACGAGG ACCCAGAGGTGAAGTTCAACTGGTACGTGGA CGGCGTGGAGGTGCACAACGCCAAGACCAA GCCCAGAGAGGAGCAGTACAACAGCACCTA CAGGGTGGTGTCCGTGCTGACCGTGCTGCA CCAGGACTGGCTGAACGGCAAAGAATACA A GTGCAAAGTCTCCAACAAGGCCCTGCCAGC CRC / nn / Lznz / E / Yii 152 CCCAATCGAAAAGACAATCAGCAAGGCCAAG GGCCAGCCACGGGAGCCCCAGGTGTACACC CTGCCCCCCAGCCGGGAGGAGATGACCAAG AACCAGGTGTCCCTGACCTGTCTGGTGAAGG GCTTCTACCCCTGTGATATCGCCGTGGAGTG GGAGAGCAACGGCCAGCCCGAGAACAACTA CAAGACCACCCCCC CAGTGCTGGACAGCGA CGGCAGCTTCTTCCTGTACAGCAAGCTGACC GTGGACAAGTCCAGGTGGCAGCAGGGCAAC GTGTTCAGCTGCAGCGTGATGCACGAGGCC CTGCACAACCACTACACCCAGAAGTCCCTGA GCCTGAGCCCCGGCAAG SEQ ID NO: 136 LCDR1 (Combined) RASQSISSWLA SE Q ID NO: 137 LCDR2 (Combined) DASSLES SEQ ID NO: 138 LCDR3 (Combined) QQITRYPVT SEQ ID NO: 136 LCDR1 (Kabat ) RASQSISSWLA SEQ ID NO: 137 LCDR2 (Kabat) DASSLES SEQ ID NO: 138 LCDR3 (Kabat) QQITRYPVT SEQ ID NO: 139 LCDR1 (Chothia) SQSISSW SEQ ID NO: 140 LCDR2 (Chothia) DAS SEQ ID NO: 141 LCDR3 (Chothia) ) ITRYPV SEQ ID NO: 142 LCDR1 (IMGT) QSISSW SEQ ID NO: 140 LCDR2 (IMGT) DAS pAC / nn / Lznz / E / Yii 153 SEQ ID NO: 138 LCDR3 (IMGT) QQITRYPVT SEQ ID NO: 143 VL DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYDASSLESGVPSRFSGS GSGTEFTLTISSLQPEDFATYYCQQITRYPVTF GQGTKVEIK SEQ ID NO: 144 ADN VL GAC ATCCAGATGACACAGAGCCCCAGCACA CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCTCCT CTTGGCTGGCCTGGTATCAGCAGAAGCCTG GCAAGGCCCCTAAGCTGCTGATCTACGATGC CAGCAGCCTGGAAAGCGGCGTGCCAAGCAG AI I IICTGGCAGCGGCTCTG GCACCGAGTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAGATCAC AAGATACCCCGTGACCTTTGGCCAGGGCAC CAAGGTGGAAATCAAG SEQ ID NO: 145 Light Chain DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYDASSLESGVPSRF SGS GSGTEFTLTISSLQPEDFATYYCQQITRYPVTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 146 DNA Light Chain GACATCCAGATGACACAGAGCCCCAGCACA CTGTCTGCCAGCGTG GGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCTCCT CTTGGCTGGCCTGGTATCAGCAGAAGCCTG GCAAGGCCCCTAAGCTGCTGATCTACGATGC CAGCAGCCTGGAAAGCGGCGTGCCAAGCAG AI I IICTGGCAGCGGCTCTGGCACCGAGTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAGATCAC AAGATACCCCGTGACCTTTGGCCAGGGCAC CAC / nn / Lznz / E / Yu 154 CAAGGTGGAAATCAAGCGTACGGTGGCCGC TCCCAGCGTGTTCATCTTCCCCCCCAGCGAC GAGCAGCTGAAGAGTGGCACCGCCAGCGTG GTGTGCCTGCTGAACAACTTCTACCCCCGGG AGGCCAAGGTGCAGTGGAAGGTGGACAACG CCCTGCAGAGCGGCAACAGCCAGGAGAGCG TCACCGAGCAG GACAGCAAGGACTCCACCT ACAGCCTGAGCAGCACCCTGACCCTGAGCA AGGCCGACTACGAGAAGCATAAGGTGTACG CCTGCGAGGTGACCCACCAGGGCCTGTCCA GCCCCGTGACCAAGAGCTTCAACAGGGGCG AGTGC Y010356 E152C_S375C SEQ ID NO: 123 HCDR1 (Combined ) GFTFSNYWIS SEQ ID NO: 124 HCDR2 (Combined) RIKSKTYGGTTDYAEPVKG SEQ ID NO: 147 HCDR3 (Combined) VSGYYSHSGGFDV SEQ ID NO: 126 HCDR1 (Kabat) NYWIS SEQ ID NO: 124 HCDR2 (Kabat) RIKSKTYGGTTDYAEPVKG SEQ ID NO: 147 HCDR3 (Kabat) VSGYYSHSGGFDV SEQ ID NO: 127 HCDR1 (Chothia) GFTFSNY SEQ ID NO: 128 HCDR2 (Chothia) KSKTYGGT SEQ ID NO: 147 HCDR3 (Chot hia) VSGYYSHSGGFDV SEQ ID NO: 129 HCDR1 (IMGT) GFTFSNYW SEQ ID NO: 130 HCDR2 (IMGT) IKSKTYGGTT CRC / nn / Lznz / E / Yii 155 SEQ ID NO: 148 HCDR3 (IMGT) ARVSGYYSHSGGFDV SEQ ID NO: 149 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNY WISWVRQAPGKGLEWVGRIKSKTYGGTTDYA EPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARVSGYYSHS GGFDVWGQGTLVTVSS SEQ ID NO: 150 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA CTACTGGATCAGCTGGGTCCGACAGGCCCC TGGCAAAGGACTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCTACGGCGGCACCACCGA TTATGCCGAGCCTGTGAAGGGCAGATTCACC ATCAGCCGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG AACCGCCGTGTACTACTGCGCCAGAGTGTC TGGCTACTACTCTCACAGCGGCGGCTTTGAT GTGTGGGGCCAGGGAACACTGG TCACCGTT AGTTCT SEQ ID NO: 151 Heavy Chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSNY WISWVRQAPGKGLEWVGRIKSKTYGGTTDYA EPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARVSGYYSHSGGFDVWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPC PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTC VVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPCDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEAL HNHYTQKSL SLSPGK CRC / nn / Lznz / E / Yii 156 SEQ ID NO: 152 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA CTACTGGATCAGCTGGGTCCGACAGGCCCC TGGCAAAGGACTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCTACGG CGGCACCACCGA TTATGCCGAGCCTGTGAAGGGCAGATTCACC ATCAGCCGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGAGTGTC TGGCTACTACTCTCACAGCGGCGGCTTTGAT GTGTGGGGCCAGGGAACACTGGTCACCGTT AGTTCTGCT AGCACCAAGGGCCCAAGTGTGT TTCCCCTGGCCCCCAGCAGCAAGTCTACTTC CGGCGGAACTGCTGCCCTGGGTTGCCTGGT GAAGGACTACTTCCCCTGTCCCGTGACAGTG TCCTGGAACTCTGGGGCTCTGACTTCCGGC GTGCACACCTTCCCGCCGTGCTGCAGAGC AGCGGCCTGTACAGCCT GAGCAGCGTGGTG ACAGTGCCCTCCAGCTCTGGGAACCCAGA CCTATATCTGCAACGTGAACCACAAGCCCAG CAACACCAAGGTGGACAAGAGAGTGGAGCC CAAGAGCTGCGACAAGACCCACCTGCCC CCCCTGCCCAGCTCCAGAACTGCTGGGAGG GCCTTCCGTGTTCCTGTTCCCCCCCAAGCCC AAGGACA CCCTGATGATCAGCAGGACCCCC GAGGTGACCTGCGTGGTGGTGGACGTGTCC CACGAGGACCCAGAGGTGAAGTTCAACTGG TACGTGGACGGCGTGGAGGTGCACAACGCC AAGACCAAGCCCAGAGAGGAGCAGTACAAC AGCACCTACAGGGTGGTGTCCGTGCTGACC GTGCTGCACCAGGACTGG CTGAACGGCAAA GAATACAAGTGCAAAGTCTCCAACAAGGCCC pRC / nn / Lznz / E / Yii 157 TGCCAGCCCCAATCGAAAAGACAATCAGCAA GGCCAAGGGCCAGCCACGGGAGCCCCAGG TGTACACCCTGCCCCCCAGCCGGGAGGAGA TGACCAAGAACCAGGTGTCCCTGACCTGTCT GGTGAAGGGCTTCTACCCCTGTGATATCGCC GTGGAGTGGGAGAGCAACGGCCAGCCCGAG AACAACTACAAGACCAC CCCCCCAGTGCTGG ACAGCGACGGCAGCTTTCTTCCTGTACAGCAA GCTGACCGTGGACAAGTCCAGGTGGCAGCA GGGCAACGTGTTCAGCTGCAGCGTGATGCA CGAGGCCCTGCACAACCACTACACCCAGAA GTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 153 LCDR1 (Combined) RASQGIS NYLA SEQ ID NO: 154 LCDR2 (Combined) AASTLQS SEQ ID NO: 155 LCDR3 (Combined) QKTWRTPGT SEQ ID NO: 153 LCDR1 (Kabat ) RASQGISNYLA SEQ ID NO: 154 LCDR2 (Kabat) AASTLQS SEQ ID NO: 155 LCDR3 (Kabat) QKTWRTPGT SEQ ID NO: 156 LCDR1 (Chothia) SQGISNY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 157 LCDR3 (Chothia) ) TWRTPG SEQ ID NO: 158 LCDR1 (IMGT) QGISNY SEQ ID NO: 50 LCDR2 (IMGT) AAS CAC / nn / Lznz / E / Yii 158 SEQ ID NO: 155 LCDR3 (IMGT) QKTWRTPGT SEQ ID NO: 159 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPKLLIYAASTLQSGVPSRFSGS GSGTDFTLTISSLQPEDVATYYCQKTWRTPGT FGQGTKVEIK SEQ ID NO: 1 60 DNA VL GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GAI I I ICTGGCA GCGGCTCCGGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCCAGAG GACGTGGCCACCTACTACTGTCAGAAAACCT GGCGGACCCCTGGCACATTTGGCCAGGGAA CAAAGGTGGAAATCAAG SEQ ID NO: 161 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPK LLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKTWRTPGT FGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC EVTHQGLSSPVTKSFNRGEC SEQ ID NO: 162 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTG CCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GA I I I ICTGGCAGCGGCTCCGGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCC AGAGGACGTGGCCACCTACTACTGTCAGAAAACCTGGCGGACCCCTGGCACATTTGGCCAGGGAA CRC / nn / Lznz / E / Yii 159 CAAAGGTGGAAATCAAGCGTACGGTGGCCG CTCCCAGCGTGTTCATCTTCCCCCCCAGCGA CGAGCAGCTGAAGAGTGGCACCGCCAGCGT GGTGTGCCTGCTGAACAACTTCTACCCCGG GAGGCCAAGGTGCAGTGGAAGGTGGACAAC GCCCTGCAGAGCGGCAACAGCCAGGAGAGC GTCACCGAGCA GGACAGCAAGGACTCCACC TACAGCCTGAGCAGCACCCTGACCCTGAGC AAGGCCGACTACGAGAAGCATAAGGTGTAC GCCTGCGAGGTGACCCACCAGGGCCTGTCC AGCCCCGTGACCAAGAGCTTCAACAGGGGC GAGTGC Y010415 E152C_S375C SEQ ID NO: 103 HCDR1 (Combined) GFTFSSYAMS SEQ ID NO: 104 HCDR2 (Combined) AISGSGGSTYYADSVKG SEQ ID NO: 163 HCDR3 (Combined) SRLIAPWLDY SEQ ID NO: 106 HCDR1 (Kabat) SYAMS SEQ ID NO: 104 HCDR2 (Kabat) AISGSGGSTYYADSVKG SEQ ID NO: 163 HCDR3 (Kabat) SRLIAPWLDY SEQ ID NO: 107 HCDR1 (Chothia) GFTFSSY SEQ ID NO: 108 HCDR2 (Chothia) SGSGGS SEQ ID NO: 163 HC DR3 (Chot hia) SRLIAPWLDY SEQ ID NO: 109 HCDR1 (IMGT) GFTFSSYA SEQ ID NO: 110 HCDR2 (IMGT) ISGSGGST pRC / nn / Lznz / B / Yi 160 SEQ ID NO: 164 HCDR3 (IMGT) ARSRLIAPWLDY SEQ ID NO: 165 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARSRLIAPWLDYWGQGTLVTVSS SEQ ID NO : 166 DNA VH GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGAACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCAGCACATATTACG CCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTACTGTGCCAGAAGCAGACTGATCG CCCCTTGGCTGGATTATTGGGGCCAGGGCA CACTGGTCACCGTGTCATCT SEQ ID NO: 167 EVQ Heavy Chain LLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARSRLIAPWLDYWGQGTLVTVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPCPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQY NSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPCDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK CRC / nn / Lznz / E / Yii 161 SEQ ID NO: 168 Heavy Chain DNA GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCA GCACATATTACGCCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTACTGTGCCAGAAGCAGACTGATCGCCCCTTGGCTGGATTATTGGGGCCAGGGCA CACTGGTCACCGTGTCATCTGCTAGCACCAA GGG CCCAAGTGTGTTTCCCCTGGCCCCCAG CAGCAAGTCTACTTCCGGCGGAACTGCTGCC CTGGGTTGCCTGGTGAAGGACTACTTCCCCT GTCCCGTGACAGTGTCCTGGAACTCTGGGG CTCTGACTTCCGGCGTGCACACCTTCCCCGC CGTGCTGCAGAGCAGCGGCCTGTACAGCCT GAGCAGCGTGGTGA CAGTGCCCTCCAGCTC TCTGGGAACCCAGACCTATATCTGCAACGTG AACCACAAGCCCAGCAACACCAAGGTGGAC AAGAGAGTGGAGCCCAAGAGCTGCGACAAG ACCCACACCTGCCCCCCCTGCCCAGCTCCA GAACTGCTGGGAGGGCCTTCCGTGTTCCTGT TCCCCCCCAAGCCCAAGGACACCCTGATGAT CAG CAGGACCCCCGAGGTGACCTGCGTGGT GGTGGACGTGTCCCACGAGGACCCAGAGGT GAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCACAACGCCAAGACCAAGCCCAGAGA GGAGCAGTACAACAGCACCTACAGGGTGGT GTCCGTGCTGACCGTGCTGCACCAGGACTG GCTGAACGGCAAAGA ATACAAGTGCAAAGTCTCCAACAAGGCCCTGCCAGCCCCAATCGAAA CAC / nn / Lznz / E / Yii 162 AGACAATCAGCAAGGCCAAGGGCCAGCCAC GGGAGCCCCAGGTGTACACCCTGCCCCCCA GCCGGGAGGAGATGACCAAGAACCAGGTGT CCCTGACCTGTCTGGTGAAGGGCTTCTACCC CTGTGATATCGCCGTGGAGTGGGAGAGCAA CGGCCAGCCCGAGAACAACTACAAGACCAC CCCCCCAGTGCT GGACAGCGACGGCAGCTT CTTCCTGTACAGCAAGCTGACCGTGGACAAG TCCAGGTGGCAGCAGGGCAACGTGTTCAGC TGCAGCGTGATGCACGAGGCCCTGCACAAC CACTACACCCAGAAGTCCCTGAGCCTGAGCC CCGGCAAG SEQ ID NO: 116 LCDR1 (Combined) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 169 LCDR3 (Combined) QQVYGSPPT SEQ ID NO: 116 LCDR1 (Kabat ) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 169 LCDR3 (Kabat) QQVYGSPPT SEQ ID NO: 49 LCDR1 (Chothia) SQSISSY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 170 LCDR3 (Chothia) ) VYGSPP SEQ ID NO: 52 LCDR1 (IMGT) QSISSY SEQ ID NO: 50 LCDR2 (IMGT) AAS pRC / nn / Lznz / E / Yii 163 SEQ ID NO: 169 LCDR3 (IMGT) QQVYGSPPT SEQ ID NO: 171 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVYGSPPTF GQGTKVEIK SEQ ID NO: 172 ADN V L GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I ICTGGCAGCGGCT CTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAGGTCTA CGGCAGCCCTCCTACATTTGGCCAGGGCAC CAAGGTGGAAATCAAG SEQ ID NO: 173 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQ SGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVYGSPPTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 174 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGT GGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I I CTGGCAGCGGCTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG AC TTCGCCACCTACTACTGCCAGCAGGTCTACGGCAGCCCTCCTACATTTGGCCAGGGCAC CRC / nn / Lznz / E / Yu 164 CAAGGTGGAAATCAAGCGTACGGTGGCCGC TCCCAGCGTGTTCATCTTCCCCCCCAGCGAC GAGCAGCTGAAGAGTGGCACCGCCAGCGTG GTGTGCCTGCTGAACAACTTCTACCCCCGGG AGGCCAAGGTGCAGTGGAAGGTGGACAACG CCCTGCAGAGCGGCAACAGCCAGGAGAGCG TCACCGAGCAG GACAGCAAGGACTCCACCT ACAGCCTGAGCAGCACCCTGACCCTGAGCA AGGCCGACTACGAGAAGCATAAGGTGTACG CCTGCGAGGTGACCCACCAGGGCCTGTCCA GCCCCGTGACCAAGAGCTTCAACAGGGGCG AGTGC Y010417 E152C_S375C SEQ ID NO: 175 HCDR1 (Combined ) GYSFTSYWIG SEQ ID NO: 176 HCDR2 (Combined) IIYPGDSDTRYSPSFQG SEQ ID NO: 177 HCDR3 (Combined) GSSAASGLSGDL SEQ ID NO: 178 HCDR1 (Kabat) SYWIG SEQ ID NO: 176 HCDR2 (Kabat) IIYPGDSDTRYSPSFQG SEQ ID NO: 177 HCDR3 (Kabat) GSSAASGLSGDL SEQ ID NO: 179 HCDR1 (Chothia) GYSFTSY SEQ ID NO: 180 HCDR2 (Chothia) YPGDSD SEQ ID NO: 177 HCDR3 (Chot hia) GSSAASGLSGDL SEQ ID NO: 181 HCDR1 (IMGT) GYSFTSYW SEQ ID NO: 182 HCDR2 (IMGT) IYPGDSDT CRC / nn / Lznz / E / Yii 165 SEQ ID NO: 183 HCDR3 (IMGT) ARGSSAASGLSGDL SEQ ID NO: 184 VH EVQLVQSGAEVKKPGESLKISCKGSGYSFTSY WIGWVRQMPGKGLEWMGIIYPGDSDTRYSPS FQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARGSSAASGLSGDLWGQGTLVTVSS SE Q ID NO: 185 VH DNA GAAGTTCAGCTGGTGCAGTCTGGCGCCGAA GTGAAGAAGCCTGGCGAGAGCCTGAAGATC TCCTGCAAAGGCAGCGGCTACAGCTTCACCA GCTACTGGATCGGCTGGGTCCGACAGATGC CTGGCAAAGGCCTTGAGTGGATGGGCATCAT CTACCCCGGCGACAGCGACACC AGATACAG CCCTAGCTTTCAGGGCCAAGTGACCATCAGC GCCGACAAGAGCATCAGCACAGCCTACCTG CAGTGGTCCAGCCTGAAGGCCTCTGACACC GCCATGTACTACTGTGCCAGAGGAAGCTCTGCCGCCTCTGGACTGTCTGGCGATCTTTGGGGACAGGGCACACTGGTCACAGTGTCTAGT SEQ ID NO: 1 86 Heavy Chain EVQLVQSGAEVKKPGESLKISCKGSGYSFTSY TIGWVRQMPGKGLEWMGIIYPGDSDTRYSPS FQGQVTISADKSISTAYLQWSSLKASDTAMYYC ARGSSAASGLSGDLWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPCPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREE QYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPCDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK CRC / nn / Lznz / E / Yii 166 SEQ ID NO: 187 Heavy Chain DNA GAAGTTCAGCTGGTGCAGTCTGGCGCCGAA GTGAAGAAGCCTGGCGAGAGCCTGAAGATC TCCTGCAAAGGCAGCGGCTACAGCTTCACCA GCTACTGGATCGGCTGGGTCCGACAGATGC CTGGCAAAGGCCTTGAGTGGATGGGCATCAT CTACCCCGGCGACAG CGACACCAGATACAG CCCTAGCTTTCAGGGCCAAGTGACCATCAGC GCCGACAAGAGCATCAGCACAGCCTACCTG CAGTGGTCCAGCCTGAAGGCCTCTGACACC GCCATGTACTACTGTGCCAGAGGAAGCTCTG CCGCCTCTGGACTGTCTGGCGATCTTTGGGGACAGGGCACACTGGTCACAGTGTCTAGTG CT AGCACCAAGGGCCCAAGTGTGTTTCCCCT GGCCCCCAGCAGCAAGTCTACTTCCGGCGG AACTGCTGCCCTGGGTTGCCTGGTGAAGGA CTACTTCCCCTGTCCCGTGACAGTGTCCTGG AACTCTGGGGCTCTGACTTCCGGCGTGCACA CCTTCCCCGCCGTGCTGCAGAGCAGCGGCC TGTACAGCCTGAG CAGCGTGGTGACAGTGC CCTCCAGCTCTCTGGGAACCCAGACCTATAT CTGCAACGTGAACCACAAGCCCAGCAACACC AAGGTGGACAAGAGAGTGGAGCCCAAGAGC TGCGACAAGACCCACCTGCCCCCCCTGC CCAGCTCCAGAACTGCTGGGAGGGCCTTCC GTGTTCCTGTTCCCCCCCAAGCCCAAGGACA CCCT GATGATCAGCAGGACCCCCGAGGTGA CCTGCGTGGTGGTGGACGTGTCCCACGAGG ACCCAGAGGTGAAGTTCAACTGGTACGTGGA CGGCGTGGAGGTGCACAACGCCAAGACCAA GCCCAGAGAGGAGCAGTACAACAGCACCTA CAGGGTGGTGTCCGTGCTGACCGTGCTGCA CCAGGACTGGCTGAAC GGCAAAGAATACAA GTGCAAAGTCTCCAACAAGGCCCTGCCAGC CRC / nn / Lznz / E / Yii 167 CCCAATCGAAAAGACAATCAGCAAGGCCAAG GGCCAGCCACGGGAGCCCCAGGTGTACACC CTGCCCCCCAGCCGGGAGGAGATGACCAAG AACCAGGTGTCCCTGACCTGTCTGGTGAAGG GCTTCTACCCCTGTGATATCGCCGTGGAGTG GGAGAGCAACGGCCAGCCCGAGAACAACTA CAAGACCACCCCCC CAGTGCTGGACAGCGA CGGCAGCTTCTTCCTGTACAGCAAGCTGACC GTGGACAAGTCCAGGTGGCAGCAGGGCAAC GTGTTCAGCTGCAGCGTGATGCACGAGGCC CTGCACAACCACTACACCCAGAAGTCCCTGA GCCTGAGCCCCGGCAAG SEQ ID NO: 116 LCDR1 (Combined) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 188 LCDR3 (Combined) QQDYYSPFT SEQ ID NO: 116 LCDR1 (Kabat ) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 188 LCDR3 (Kabat) QQDYYSPFT SEQ ID NO: 49 LCDR1 (Chothia) SQSISSY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 189 LCDR3 (Chothia) ) DYYSPF SEQ ID NO: 52 LCDR1 (IMGT) QSISSY SEQ ID NO: 50 LCDR2 (IMGT) AAS pRC / nn / Lznz / E / Yii 168 SEQ ID NO: 188 LCDR3 (IMGT) QQDYYSPFT SEQ ID NO: 190 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQDYYSPFTF GQGTKVEIK SEQ ID NO: 191 DNA VL GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I ICTGGCAGCGG CTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAGGACTA CTACAGCCCCTTCACCTTTGGCCAGGGCACC AAGGTGGAAATCAAG SEQ ID NO: 192 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQ SGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQDYYSPFTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 193 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGT GGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG AI I I I CTGGCAGCGGCTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG AC TTCGCCACCTACTACTGCCAGCAGGACTA CTACAGCCCCTTCACCTTTGGCCAGGGCACC CAC / nn / Lznz / E / Yii 169 AAGGTGGAAATCAAGCGTACGGTGGCCGCT CCCAGCGTGTTCATCTTCCCCCCCAGCGACG AGCAGCTGAAGAGTGGCACCGCCAGCGTGG TGTGCCTGCTGAACAACTTCTACCCCGGGA GGCCAAGGTGCAGTGGAAGGTGGACAACGC CCTGCAGAGCGGCAACAGCCAGGAGAGCGT CACCGAGCA GGACAGCAAGGACTCCACCTA CAGCCTGAGCAGCACCCTGACCCTGAGCAA GGCCGACTACGAGAAGCATAAGGTGTACGC CTGCGAGGTGACCCACCAGGGCCTGTCCAG CCCCGTGACCAAGAGCTTCAACAGGGGCGA GTGC Y010429 E152C_S375C SEQ ID NO: 103 HCDR1 (Com combined) GFTFSSYAMS SEQ ID NO: 104 HCDR2 (Combined) AISGSGGSTYYADSVKG SEQ ID NO: 194 HCDR3 (Combined) AYKLSWLDL SEQ ID NO: 106 HCDR1 (Kabat) SYAMS SEQ ID NO: 104 HCDR2 (Kabat) AISGSGGSTYYADSVKG SEQ ID NO: 194 HCDR3 (Kabat) AYKLSWLDL SEQ ID NO: 107 HCDR1 (Chothia) GFTFSSY SEQ ID NO: 108 HCDR2 (Chothia) SGSGGS SEQ ID NO: 194 HC DR3 (Chot hia) AYKLSWLDL SEQ ID NO: 109 HCDR1 (IMGT) GFTFSSYA SEQ ID NO: 110 HCDR2 (IMGT) ISGSGGST CRC / nn / Lznz / E / Yii 170 SEQ ID NO: 195 HCDR3 (IMGT) ARAYKLSWLDL SEQ ID NO: 196 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARAYKLSWLDLWGQGTLVTVSS SEQ ID NO: 197 VH DNA GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGAACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCAGCACATATT ACGCCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTATTGTGCCAGAGCCTACAAGCTGA GCTGGCTGGATCTTTGGGGCCAGGGCACAC TGGTCACAGTGTCATCT SEQ ID NO: 198 Heavy Chain EVQLLESGGGLVQPGGSLRLSCAASGFTFSSY AMSWVRQAPGKGLEWVSAISGSGGSTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CARAYKLSWLDLWGQGTLVTVSSASTKGPSVF PLAPSSKSTSGGTAALGCLVKDYFPCPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS SSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREE QYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPCDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K CRC / nn / Lznz / E / Yu 171 SEQ ID NO: 199 Heavy Chain DNA GAAGTTCAGCTGCTGGAATCTGGCGGAGGA CTGGTTCAACCTGGCGGCTCTCTGAGACTGT CTTGTGCCGCCAGCGGCTTCACCTTTAGCAG CTACGCCATGAGCTGGGTCCGACAGGCTCC TGGCAAAGGCCTTGAATGGGTGTCCGCCATC TCTGGCTCTGGCGGCA GCACATATTACGCCG ACTCTGTGAAGGGCAGATTCACCATCAGCCG GGACAACAGCAAGAACACCCTGTACCTGCAG ATGAACAGCCTGAGAGCCGAGGACACCGCC GTGTACTATTGTGCCAGAGCCTACAAGCTGA GCTGGCTGGATCTTTGGGGCCAGGGCACAC TGGTCACAGTGTCATCTGCTAGCACCAAGGG CCCAAGTGTGTTTCCCCTGGCCCCCAGCAG CAAGTCTACTTCCGGCGGAACTGCTGCCCTG GGTTGCCTGGTGAAGGACTACTTCCCCTGTC CCGTGACAGTGTCCTGGAACTCTGGGGCTCT GACTTCCGGCGTGCACACCTTCCCCGCCGT GCTGCAGAGCAGCGGCCTGTACAGCCTGAG CAGCGTGGTGACAG TGCCCTCCAGCTCTCT GGGAACCCAGACCTATATCTGCAACGTGAAC CACAAGCCCAGCAACACCAAGGTGGACAAG AGAGTGGAGCCCAAGAGCTGCGACAAAGACC CACACCTGCCCCCCCTGCCCAGCTCCAGAA CTGCTGGGAGGGCCTTCCGTGTTCCTGTTCC CCCCCAAGCCCAAGGACACCCTGATGATCA GCAGGACCCC CGAGGTGACCTGCGTGGTGG TGGACGTGTCCCACGAGGACCCAGAGGTGA AGTTCAACTGGTACGTGGACGGCGTGGAGG TGCACAACGCCAAGACCAAGCCCAGAGAGG AGCAGTACAACAGCACCTACAGGGTGGTGTC CGTGCTGACCGTGCTGCACCAGGACTGGCT GAACGGCAAAGAATACAAG TGCAAAGTCTCC AACAAGGCCCTGCCAGCCCCAATCGAAAAGA CRC / nn / Lznz / E / Yii 172 CAATCAGCAAGGCCAAGGGCCAGCCACGGG AGCCCCAGGTGTACACCCTGCCCCCCAGCC GGGAGGAGATGACCAAGAACCAGGTGTCCC TGACCTGTCTGGTGAAGGGCTTCTACCCCTG TGATATCGCCGTGGAGTGGGAGAGCAACGG CCAGCCCGAGAACAACTACAAGACCACCCC CCCAGTGCTGGACA GCGACGGCAGCTTCTT CCTGTACAGCAAGCTGACCGTGGACAAGTCC AGGTGGCAGCAGGGCAACGTGTTCAGCTGC AGCGTGATGCACGAGGCCCTGCACAACCAC TACACCCAGAAGTCCCTGAGCCTGAGCCCC GGCAAG SEQ ID NO: 116 LCDR1 (Combined) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 200 LCDR3 (Combined) QQVWYAPVT SEQ ID NO: 116 LCDR1 (Kabat ) RASQSISSYLN SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 200 LCDR3 (Kabat) QQVWYAPVT SEQ ID NO: 49 LCDR1 (Chothia) SQSISSY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 201 LCDR3 (Chothia) ) VWYAPV SEQ ID NO: 52 LCDR1 (IMGT) QSISSY SEQ ID NO: 50 LCDR2 (IMGT) AAS CAC / nn / Lznz / E / Yii 173 SEQ ID NO: 200 LCDR3 (IMGT) QQVWYAPVT SEQ ID NO: 202 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVWYAPVT FGQGTKVEIK SEQ ID NO: 20 3 DNA VL GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG A1 1 1 1CTG GCAGCGGCTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAAGTTTG GTACGCCCCTGTGACCTTTGGCCAGGGCAC CAAGGTGGAAATCAAG SEQ ID NO: 204 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKL LIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQVWYAPVT FGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC EVTHQGLSSPVTKSFNRGEC SEQ ID NO: 205 Liger Chain DNA a GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCAGCA GCTACCTGAACTGGTATCAGCAGAAGCCCG GCAAGGCCCCTAAACTGCTGATCTATGCCGC CAGCTCTCTGCAGTCTGGCGTGCCAAGCAG A1 1 1 1 CTGGCA GCGGCTCTGGCACCGACTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTACTGCCAGCAAGTTTG GTACGCCCCTGTGACCTTTGGCCAGGGCAC CRC / nn / Lznz / E / Yii 174 CAAGGTGGAAATCAAGCGTACGGTGGCCGC TCCCAGCGTGTTCATCTTCCCCCCCAGCGAC GAGCAGCTGAAGAGTGGCACCGCCAGCGTG GTGTGCCTGCTGAACAACTTCTACCCCCGGG AGGCCAAGGTGCAGTGGAAGGTGGACAACG CCCTGCAGAGCGGCAACAGCCAGGAGAGCG TCACCGAGCAG GACAGCAAGGACTCCACCT ACAGCCTGAGCAGCACCCTGACCCTGAGCA AGGCCGACTACGAGAAGCATAAGGTGTACG CCTGCGAGGTGACCCACCAGGGCCTGTCCA GCCCCGTGACCAAGAGCTTCAACAGGGGCG AGTGC Y010900 E152C_S375C SEQ ID NO: 206 HCDR1 (Combined ) GFTFSNAWMS SEQ ID NO: 207 HCDR2 (Combined) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 208 HCDR3 (Combined) TIYPSAPSSSLDY SEQ ID NO: 209 HCDR1 (Kabat) NAWMS SEQ ID NO: 207 HCDR2 (Kabat) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 208 HCDR3 (Kabat) TIYPSAPSSSLDY SEQ ID NO: 210 HCDR1 (Chothia) GFTFSNA SEQ ID NO: 211 HCDR2 (Chothia) KSKTDAGT SEQ ID NO: 208 HCDR3 (Chot hia) TIYPSAPSSSLDY SEQ ID NO: 212 HCDR1 (IMGT) GFTFSNAW SEQ ID NO: 213 HCDR2 (IMGT) IKSKTDAGTT CAC / nn / Lznz / E / Yii 175 SEQ ID NO: 214 HCDR3 (IMGT) ARTIYPSAPSSSLDY SEQ ID NO: 215 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V ROA PG KG L EW VG RIKS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARTIYPSAPSSSLD YWGQGTLVTVSS SEQ ID NO: 216 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAG CAAGACCGATGCCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG AACCCGCCGTGTACTACTGCGCCAGAACAAT CTACCCCAGCGCTCCTAGCAGCAGCCTGGA TTATTGGGGCCAGGGCACACTGGTCACCG you GTCATCT SEQ ID NO: 217 Heavy Chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA WMSWVRQAPGKGLEWVGRIKSKTDAGTTDYA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARTIYPSAPSSSLDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAAL GCLVKDYFPCP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK pRC / nn / Lznz / E / Yii 176 SEQ ID NO: 218 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCGATG CCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGAACAAT CTACCCCAGCGCTCCTAGCAGCAGCCTGGA TTATTGGGGCCAGGGCACACTGGTCACCGT GTCATCTG CTAGCACCAAGGGCCCAAGTGTG TTTCCCCTGGCCCCCAGCAGCAAGTCTACTT CCGGCGGAACTGCTGCCCTGGGTTGCCTGG TGAAGGACTACTTCCCCTGTCCCGTGACAGT GTCCTGGAACTCTGGGGCTCTGACTTCCGG CGTGCACACCTTCCCGCCGTGCTGCAGAG CAGCGGCCTGTACAGCCTGA GCAGCGTGGT GACAGTGCCCTCCAGCTCTCTGGGAACCCA GACCTATATCTGCAACGTGAACCACAAGCCC AGCAACACCAAGGTGGACAAGAGAGTGGAG CCCAAGAGCTGCGACAAGACCCACCTGC CCCCCCTGCCCAGCTCCAGAACTGCTGGGA GGGCCTTCCGTGTTCCTGTTCCCCCCCAAGC CCAAGGACA CCCTGATGATCAGCAGGACCC CCGAGGTGACCTGCGTGGTGGTGGACGTGT CCCACGAGGACCCAGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCACAACG CCAAGACCAAGCCCAGAGAGGAGCAGTACA ACAGCACCTACAGGGTGGTGTCCGTGCTGA CCGTGCTGCACCAGGACTGGCT GAACGGCA AAGAATACAAGTGCAAAGTCTCCAACAAGGC CRC / nn / Lznz / E / Yii 177 CCTGCCAGCCCCAATCGAAAAGACAATCAGC AAGGCCAAGGGCCAGCCACGGGAGCCCCAG GTGTACACCCTGCCCCCCAGCCGGGAGGAG ATGACCAAGAACCAGGTGTCCCTGACCTGTC TGGTGAAGGGCTTCTACCCCTGTGATATCGC CGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAA GACCACCCCCCCAGTGCTG GACAGCGACGGCAGCTTCTTCCTGTACAGCA AGCTGACCGTGGACAAGTCCAGGTGGCAGC AGGGCAACGTGTTCAGCTGCAGCGTGATGC ACGAGGCCCTGCACAACCACTACACCCAGAA GTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 153 LCDR1 (Combined) RASQGISNYLA SEQ ID NO: 154 LCDR2 (Combined) AASTLQS SEQ ID NO: 219 LCDR3 (Combined) QQLIFFPLT SEQ ID NO: 153 LCDR1 (Kabat ) RASQGISNYLA SEQ ID NO: 154 LCDR2 (Kabat) AASTLQS SEQ ID NO: 219 LCDR3 (Kabat) QQLIFFPLT SEQ ID NO: 156 LCDR1 (Chothia) SQGISNY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 220 LCDR3 (Chothia) ) LIFFPL SEQ ID NO: 158 LCDR1 (IMGT) QGISNY SEQ ID NO: 50 LCDR2 (IMGT) AAS CRC / nn / Lznz / E / Yii 178 SEQ ID NO: 219 LCDR3 (IMGT) QQLIFFPLT SEQ ID NO: 221 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPKLLIYAASTLQSGVPSRFSGS GSGTDFTLTISSLQPEDVATYYCQQLIFFPLTFG QGTKVEIK SEQ ID NO: 222 ADN VL GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GAI I I ICTGGCAGCGGCTCC GGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCCAGAG GACGTGGCCACCTACTATTGCCAGCAGCTGA TCTTCTTCCCTCTGACCTTTGGCCAGGGCAC CAAGGTGGAAATCAAG SEQ ID NO: 223 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPKLLIYAASTL QSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQLIFFPLTFG QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC SEQ ID NO: 224 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGT GGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GA I I I ICTGGCAGCGGCTCCGGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCCAGAG GA CGTGGCCACCTACTATTGCCAGCAGCTGA TCTTCTTCCCTCTGACCTTTGGCCAGGGCAC CRC / nn / Lznz / E / Yii 179 CAAGGTGGAAATCAAGCGTACGGTGGCCGC TCCCAGCGTGTTCATCTTCCCCCCCAGCGAC GAGCAGCTGAAGAGTGGCACCGCCAGCGTG GTGTGCCTGCTGAACAACTTCTACCCCCGGG AGGCCAAGGTGCAGTGGAAGGTGGACAACG CCCTGCAGAGCGGCAACAGCCAGGAGAGCG TCACCGAGCAG GACAGCAAGGACTCCACCT ACAGCCTGAGCAGCACCCTGACCCTGAGCA AGGCCGACTACGAGAAGCATAAGGTGTACG CCTGCGAGGTGACCCACCAGGGCCTGTCCA GCCCCGTGACCAAGAGCTTCAACAGGGGCG AGTGC Y010903 E152C_S375C SEQ ID NO: 206 HCDR1 (Combined ) GFTFSNAWMS SEQ ID NO: 207 HCDR2 (Combined) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 225 HCDR3 (Combined) ASHRLHSLFDV SEQ ID NO: 209 HCDR1 (Kabat) NAWMS SEQ ID NO: 207 HCDR2 (Kabat) RIKS KTDAGTTDYAAPVKG SEQ ID NO: 225 HCDR3 (Kabat) ASHRLHSLFDV SEQ ID NO: 210 HCDR1 (Chothia) GFTFSNA SEQ ID NO: 211 HCDR2 (Chothia) KSKTDAGT SEQ ID NO: 225 HCDR3(Chot hia) ASHRLHSLFDV SEQ ID NO: 212 HCDR1 (IMGT) GFTFSNAW SEQ ID NO: 213 HCDR2 (IMGT) IKSKTDAGTT CRC / nn / Lznz / E / Yu 180 SEQ ID NO: 226 HCDR3 (IMGT) ARASHRLHSLFDV SEQ ID NO: 227 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V ROA PG KG L EW VG R1KS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARASHRLHSLFD VWGQGTLVTVSS SEQ ID NO: 228 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAG CAAGACCGATGCCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG AACCGCCGTGTACTACTGTGCCAGAGCCTC TCACAGACTGCACAGCCTGTTTGACGTGTGG GGCCAGGGAACACTGGTCACCGTTAG TTCT SEQ ID NO: 229 Heavy Chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V RQA PG KG L EW VG R1 KS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARASHRLHSLFDVWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGG TAALGCLVKDYFPCPVT VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLH QDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPCDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK pRC / nn / Lznz / E / Yii 181 SEQ ID NO: 230 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCGATG CCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGTGCCAGAGCCTC TCACAGACTGCACAGCCTGTTTGACGTGTGG GGCCAGGGAACACTGGTCACCGTTAGTTCTG CTAG CACCAAGGGCCCAAGTGTGTTTCCCCT GGCCCCCAGCAGCAAGTCTACTTCCGGCGG AACTGCTGCCCTGGGTTGCCTGGTGAAGGA CTACTTCCCCTGTCCCGTGACAGTGTCCTGG AACTCTGGGGCTCTGACTTCCGGCGTGCACA CCTTCCCCGCCGTGCTGCAGAGCAGCGGCC TGTACAGCCTGAGCA GCGTGGTGACAGTGC CCTCCAGCTCTCTGGGAACCCAGACCTATAT CTGCAACGTGAACCACAAGCCCAGCAACACC AAGGTGGACAAGAGAGTGGAGCCCAAGAGC TGCGACAAGACCCACCTGCCCCCCCTGC CCAGCTCCAGAACTGCTGGGAGGGCCTTCC GTGTTCCTGTTCCCCCCCAAGCCCAAGGACA CCCTG ATGATCAGCAGGACCCCCGAGGTGA CCTGCGTGGTGGTGGACGTGTCCCACGAGG ACCCAGAGGTGAAGTTCAACTGGTACGTGGA CGGCGTGGAGGTGCACAACGCCAAGACCAA GCCCAGAGAGGAGCAGTACAACAGCACCTA CAGGGTGGTGTCCGTGCTGACCGTGCTGCA CCAGGACTGGCTGAACG GCAAAGAATACAA GTGCAAAGTCTCCAACAAGGCCCTGCCAGC CRC / nn / Lznz / E / Yii 182 CCCAATCGAAAAGACAATCAGCAAGGCCAAG GGCCAGCCACGGGAGCCCCAGGTGTACACC CTGCCCCCCAGCCGGGAGGAGATGACCAAG AACCAGGTGTCCCTGACCTGTCTGGTGAAGG GCTTCTACCCCTGTGATATCGCCGTGGAGTG GGAGAGCAACGGCCAGCCCGAGAACAACTA CAAGACCACCCCCC CAGTGCTGGACAGCGA CGGCAGCTTCTTCCTGTACAGCAAGCTGACC GTGGACAAGTCCAGGTGGCAGCAGGGCAAC GTGTTCAGCTGCAGCGTGATGCACGAGGCC CTGCACAACCACTACCCAGAAGTCCCTGA GCCTGAGCCCCGGCAAG SEQ ID NO: 136 LCDR1 (Combined) RASOS ISSW LA SE Q ID NO: 137 LCDR2 (Combined) DASSLES SEQ ID NO: 231 LCDR3 (Combined) QQGLFYPHT SEQ ID NO: 136 LCDR1 (Kabat) RASOS ISSW LA SEQ ID NO: 137 LCDR2 (Kabat) DASSLES SEQ ID NO: 231 LCDR3 (Kabat) QQGLFYPHT SEQ ID NO: 139 LCDR1 (Chothia) SQSISSW SEQ ID NO: 140 LCDR2 (Chothia) DAS SEQ ID NO: 232 LCDR3 (Chothia) GLFYPH SEQ ID NO: 142 LCDR1 (IMGT) QSISSW SEQ ID NO: 140 LCDR2 (IMGT) DAS CRC / nn / Lznz / E / Yii 183 SEQ ID NO: 231 LCDR3 (IMGT) QQGLFYPHT SEQ ID NO: 233 VL DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYDASSLESGVPSRFSGS GSGTEFTLTISSLQPEDFATYYCQQGLFYPHTF GQGTKVEIK SEQ ID NO: 234 ADN VL GACATCCAGATGACACAGAGCCCCAGCACA CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCTCCT CTTGGCTGGCCTGGTATCAGCAGAAGCCTG GCAAGGCCCCTAAGCTGCTGATCTACGATGC CAGCAGCCTGGAAAGCGGCGTGCCAAGCAG AI I IICTGGCAGCGGCT CTGGCACCGAGTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTATTGTCAGCAGGGCCT GTTCTACCCTCACACCTTTGGCCAGGGCACC AAGGTGGAAATCAAG SEQ ID NO: 235 Light Chain DIQMTQSPSTLSASVGDRVTITCRASQSISSWL AWYQQKPGKAPKLLIYDASSLES GVPSRFSGS GSGTEFTLTISSLQPEDFATYYCQQGLFYPHTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 236 DNA Light Chain GACATCCAGATGACACAGAGCCCCAGCACA CTGTCTGCCAGCGTG GGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGAGCATCTCCT CTTGGCTGGCCTGGTATCAGCAGAAGCCTG GCAAGGCCCCTAAGCTGCTGATCTACGATGC CAGCAGCCTGGAAAGCGGCGTGCCAAGCAG AI I IICTGGCAGCGGCTCTGGCACCGAGTTC ACCCTGACCATATCTAGCCTGCAGCCAGAGG ACTTCGCCACCTACTATTGTCAGCAGGGCCT GTTCTACCCTCACACCTTTGGCCAGGGCACC CRC / nn / Lznz / E / Yii 184 AAGGTGGAAATCAAGCGTACGGTGGCCGCT CCCAGCGTGTTCATCTTCCCCCCCAGCGACG AGCAGCTGAAGAGTGGCACCGCCAGCGTGG TGTGCCTGCTGAACAACTTCTACCCCGGGA GGCCAAGGTGCAGTGGAAGGTGGACAACGC CCTGCAGAGCGGCAACAGCCAGGAGAGCGT CACCGAGCA GGACAGCAAGGACTCCACCTA CAGCCTGAGCAGCACCCTGACCCTGAGCAA GGCCGACTACGAGAAGCATAAGGTGTACGC CTGCGAGGTGACCCACCAGGGCCTGTCCAG CCCCGTGACCAAGAGCTTCAACAGGGGCGA GTGC Y010906 E152C_S375C SEQ ID NO: 206 HCDR1 (Com GFTFSNAWMS SEQ ID NO: 207 HCDR2 (Combined) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 237 HCDR3 (Combined) DEYPWGWFDV SEQ ID NO: 209 HCDR1 (Kabat) NAWMS SEQ ID NO: 207 HCDR2 (Kabat) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 237 HCDR3 (Kabat) DEYPWGWFDV SEQ ID NO: 210 HCDR1 (Chothia) GFTFSNA SEQ ID NO: 211 HCDR2 (Chothia) KSKTDAGT SEQ ID NO : 237 HCDR3 (Chot hia) DEYPWGWFDV SEQ ID NO: 212 HCDR1 (IMGT) GFTFSNAW SEQ ID NO: 213 HCDR2 (IMGT) IKSKTDAGTT CRC / nn / Lznz / E / Yu 185 SEQ ID NO: 238 HCDR3 (IMGT) ARDEYPWGWFDV SEQ ID NO: 239 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V ROA PG KG L EW VG RIKS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARDEYPWGW FDVWGQGTLVTVSS SEQ ID NO: 240 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CA AGAGCAAGACCGATGCCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG AACCGCCGTGTACTACTGCGCCAGAGATGA GTACCCCTGGGGATGGTTCGATGTGTGGGG ACAGGGAACCCTGGTCACCGTT AGTTCT SEQ ID NO: 241 Heavy Chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V ROA PG KG L EW VG RI KS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARDEYPWGWFDVWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGG TAALGCLVKDYFPCPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQD WLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPCDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK CRC / nn / Lznz / E / Yii 186 SEQ ID NO: 242 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCGATG CCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGATGA GTACCCCTGGGGATGGTTCGATGTGTGGGG ACAGGGAACCCTGGTCACCGTTAGTTCTGCT AGCA CCAAGGGCCCAAGTGTGTTTCCCCTG GCCCCCAGCAGCAAGTCTACTTCCGGCGGA ACTGCTGCCCTGGGTTGCCTGGTGAAGGAC TACTTCCCCTGTCCCGTGACAGTGTCCTGGA ACTCTGGGGCTCTGACTTCCGGCGTGCACA CCTTCCCCGCCGTGCTGCAGAGCAGCGGCC TGTACAGCCTGAGCAG CGTGGTGACAGTGC CCTCCAGCTCTCTGGGAACCCAGACCTATAT CTGCAACGTGAACCACAAGCCCAGCAACACC AAGGTGGACAAGAGAGTGGAGCCCAAGAGC TGCGACAAGACCCACCTGCCCCCCCTGC CCAGCTCCAGAACTGCTGGGAGGGCCTTCC GTGTTCCTGTTCCCCCCCAAGCCCAAGGACA CCCTGAT GATCAGCAGGACCCCCGAGGTGA CCTGCGTGGTGGTGGACGTGTCCCACGAGG ACCCAGAGGTGAAGTTCAACTGGTACGTGGA CGGCGTGGAGGTGCACAACGCCAAGACCAA GCCCAGAGAGGAGCAGTACAACAGCACCTA CAGGGTGGTGTCCGTGCTGACCGTGCTGCA CCAGGACTGGCTGAACGG CAAAGAATACAA GTGCAAAGTCTCCAACAAGGCCCTGCCAGC CAC / nn / Lznz / E / Yii 187 CCCAATCGAAAAGACAATCAGCAAGGCCAAG GGCCAGCCACGGGAGCCCCAGGTGTACACC CTGCCCCCCAGCCGGGAGGAGATGACCAAG AACCAGGTGTCCCTGACCTGTCTGGTGAAGG GCTTCTACCCCTGTGATATCGCCGTGGAGTG GGAGAGCAACGGCCAGCCCGAGAACAACTA CAAGACCACCCCCC CAGTGCTGGACAGCGA CGGCAGCTTCTTCCTGTACAGCAAGCTGACC GTGGACAAGTCCAGGTGGCAGCAGGGCAAC GTGTTCAGCTGCAGCGTGATGCACGAGGCC CTGCACAACCACTACACCCAGAAGTCCCTGA GCCTGAGCCCCGGCAAG SEQ ID NO: 243 LCDR1 (Combined) RASQGISSWLA SE Q ID NO: 47 LCDR2 (Combined) AASSLQS SEQ ID NO: 244 LCDR3 (Combined) QQYIFYPLT SEQ ID NO: 243 LCDR1 (Kabat ) RASQGISSWLA SEQ ID NO: 47 LCDR2 (Kabat) AASSLQS SEQ ID NO: 244 LCDR3 (Kabat) QQYIFYPLT SEQ ID NO: 245 LCDR1 (Chothia) SQGISSW SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 246 LCDR3 (Chothia) ) YIFYPL SEQ ID NO: 247 LCDR1 (IMGT) QGISSW SEQ ID NO: 50 LCDR2 (IMGT) AAS CRC / nn / Lznz / E / Yii 188 SEQ ID NO: 244 LCDR3 (IMGT) QQYIFYPLT SEQ ID NO: 248 VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWL AWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQYIFYPLTF GQGTKVEIK SEQ ID NO: 249 DNA VL GACATCCAGATGACACAGAGCCCTAGCTCCG TGTCTGCCAGCGTGGGAGACAGAGTGACCA TCACCTGTAGAGCCAGCCAGGGCATCTCTTC TTGGCTGGCCTGGTATCAGCAGAAGCCTGG CAAGGCCCCTAAGCTGCTGATCTATGCCGCT TCCAGTCTGCAGAGCGGCGTGCCAAGCAGA TTTTCTGGCA GCGGCTCTGGCACCGACTTCA CCCTGACCATATCTAGCCTGCAGCCAGAGGA CTTCGCCACCTACTACTGCCAGCAGTACATC TTCTACCCTCTGACCTTCGGCCAGGGCACCA AGGTGGAAATCAAG SEQ ID NO: 250 Light Chain DIQMTQSPSSVSASVGDRVTITCRASQGISSWL AWYQQKPGKAPKLLIYA ASSLQSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQYIFYPLTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 251 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCTCCG TGTCTGCCAGCGTGGGAGACAGAGTGACCA TCACCTGTAGAGCCAGCCAGGGCATCTCTTC TTGGCTGGCCTGGTATCAGCAGAAG CCTGG CAAGGCCCCTAAGCTGCTGATCTATGCCGCT TCCAGTCTGCAGAGCGGCGTGCCAAGCAGA TTTTCTGGCAGCGGCTCTGGCACCGACTTCA CCCTGACCATATCTAGCCTGCAGCCAGAGGA CTTCGCCACCTACTACTGCCAGCAGTACATC TTCTACCCTCTGACCTTCGGCCAGGGCACCA CRC / nn / Lznz / E / Yii 189 AGGTGGAAATCAAGCGTACGGTGGCCGCTC CCAGCGTGTTCATCTTCCCCCCCAGCGACGA GCAGCTGAAGAGTGGCACCGCCAGCGTGGT GTGCCTGCTGAACAACTTCTACCCCCGGGAG GCCAAGGTGCAGTGGAAGGTGGACAACGCC CTGCAGAGCGGCAACAGCCAGGAGAGCGTC ACCGAGCAGGACA GCAAGGACTCCACCTAC AGCCTGAGCAGCACCCTGACCCTGAGCAAG GCCGACTACGAGAAGCATAAGGTGTACGCCT GCGAGGTGACCCACCAGGGCCTGTCCAGCC CCGTGACCAAGAGCTTCAACAGGGGCGAGT GC Y010910 E152C_S375C SEQ ID NO: 206 HCDR1 (Combined) GFT FSNAWMS SEQ ID NO: 207 HCDR2 (Combined) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 252 HCDR3 (Combined) VASPSAPGGFDY SEQ ID NO: 209 HCDR1 (Kabat) NAWMS SEQ ID NO: 207 HCDR2 (Kabat) RIKSKTDAGTTDYAAPVKG SEQ ID NO: 252 HCDR3 (Kabat) VASPSAPGGFDY SEQ ID NO: 210 HCDR1 (Chothia) GFTFSNA SEQ ID NO: 211 HCDR2 (Chothia) KSKTDAGT SEQ ID NO :252HCDR3 (Chot hia) VASPSAPGGFDY SEQ ID NO: 212 HCDR1 (IMGT) GFTFSNAW SEQ ID NO: 213 HCDR2 (IMGT) IKSKTDAGTT CRC / nn / Lznz / E / Yii 190 SEQ ID NO: 253 HCDR3 (IMGT) ARVASPSAPGGFDY SEQ ID NO: 254 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA W MSW V RQA PG KG L EW VG R1KS KTDAGTTD YA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARVASPSAPG GFDYWGQGTLVTVSS SEQ ID NO: 255 VH DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCGATGCCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG AACCGCCGTGTACTACTGCGCCAGAGTGG CTTCTCCTTCTGCTCCCGGCGGATTCGATTA TTGGGGCCAGGGAACACTGGTCAC CGTGTC TAGT SEQ ID NO: 256 Heavy Chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSNA WMSWVRQAPGKGLEWVGRIKSKTDAGTTDYA APVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCARVASPSAPGGFDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAAL GCLVKDYFPCP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK pRC / nn / Lznz / E / Yii 191 SEQ ID NO: 257 Heavy Chain DNA GAAGTGCAGCTGGTGGAATCTGGCGGCGGA CTTGTGAAACCTGGCGGCTCTCTGAGACTGA GCTGTGCCGCTTCCGGCTTCACCTTCAGCAA TGCCTGGATGAGCTGGGTCCGACAGGCCCC TGGAAAAGGCCTTGAGTGGGTCGGACGGAT CAAGAGCAAGACCGATG CCGGCACCACCGA TTATGCTGCCCCTGTGAAGGGCAGATTCACC ATCAGCAGGGACGACAGCAAGAACACCCTG TACCTGCAGATGAACAGCCTGAAAACCGAGG ACACCGCCGTGTACTACTGCGCCAGAGTGG CTTCTCCTTCTGCTCCCGGCGGATTCGATTA TTGGGGCCAGGGAACACTGGTCACCGTGTC TAGTGCT AGCACCAAGGGCCCAAGTGTGTTT CCCCTGGCCCCCAGCAGCAAGTCTACTTCC GGCGGAACTGCTGCCCTGGGTTGCCTGGTG AAGGACTACTTCCCCTGTCCCGTGACAGTGT CCTGGAACTCTGGGGCTCTGACTTCCGGCG TGCACACCTTCCCCCGCCGTGCTGCAGAGCA GCGGCCTGTACAGCCTGA GCAGCGTGGTGA CAGTGCCCTCCAGCTCTCTGGGAACCCAGA CCTATATCTGCAACGTGAACCACAAGCCCAG CAACACCAAGGTGGACAAGAGAGTGGAGCC CAAGAGCTGCGACAAGACCCACCTGCCC CCCCTGCCCAGCTCCAGAACTGCTGGGAGG GCCTTCCGTGTTCCTGTTCCCCCCCAAGCCC AAGGACACC CTGATGATCAGCAGGACCCCC GAGGTGACCTGCGTGGTGGTGGACGTGTCC CACGAGGACCCAGAGGTGAAGTTCAACTGG TACGTGGACGGCGTGGAGGTGCACAACGCC AAGACCAAGCCCAGAGAGGAGCAGTACAAC AGCACCTACAGGGTGGTGTCCGTGCTGACC GTGCTGCACCAGGACTGGCT GAACGGCAAA GAATACAAGTGCAAAGTCTCCAACAAGGCCC pRC / nn / Lznz / E / Yii 192 TGCCAGCCCCAATCGAAAAGACAATCAGCAA GGCCAAGGGCCAGCCACGGGAGCCCCAGG TGTACACCCTGCCCCCCAGCCGGGAGGAGA TGACCAAGAACCAGGTGTCCCTGACCTGTCT GGTGAAGGGCTTCTACCCCTGTGATATCGCC GTGGAGTGGGAGAGCAACGGCCAGCCCGAG AACAACTACAAGACCAC CCCCCCAGTGCTGG ACAGCGACGGCAGCTTTCTTCCTGTACAGCAA GCTGACCGTGGACAAGTCCAGGTGGCAGCA GGGCAACGTGTTCAGCTGCAGCGTGATGCA CGAGGCCCTGCACAACCACTACACCCAGAA GTCCCTGAGCCTGAGCCCCGGCAAG SEQ ID NO: 153 LCDR1 (Combined) RASQGIS NYLA SEQ ID NO: 154 LCDR2 (Combined) AASTLQS SEQ ID NO: 258 LCDR3 (Combined) QQSLFAPFT SEQ ID NO: 153 LCDR1 (Kabat ) RASQGISNYLA SEQ ID NO: 154 LCDR2 (Kabat) AASTLQS SEQ ID NO: 258 LCDR3 (Kabat) QQSLFAPFT SEQ ID NO: 156 LCDR1 (Chothia) SQGISNY SEQ ID NO: 50 LCDR2 (Chothia) AAS SEQ ID NO: 259 LCDR3 (Chothia) ) SLFAPF SEQ ID NO: 158 LCDR1 (IMGT) QGISNY SEQ ID NO: 50 LCDR2 (IMGT) AAS pAC / nn / Lznz / E / Yii 193 SEQ ID NO: 258 LCDR3 (IMGT) QQSLFAPFT SEQ ID NO: 260 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPKLLIYAASTLQSGVPSRFSGS GSGTDFTLTISSLQPEDVATYYCQQSLFAPTFF GQGTKVEIK SEQ ID NO: 261 ADN VL GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGTGGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GAI I I ICTGGCAGCGGCTCC GGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCCAGAG GACGTGGCCACCTACTACTGTCAGCAGAGC CTGTTCGCCCCTTTCACCTTTGGCCAGGGCA CCAAGGTGGAAATCAAG SEQ ID NO: 262 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQGISNYL AWYQQKPGKVPKLLIYAASTL QSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQSLFAPTFF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQ ID NO: 263 DNA Light Chain GACATCCAGATGACACAGAGCCCTAGCAGC CTGTCTGCCAGCGT GGGAGACAGAGTGACC ATCACCTGTAGAGCCAGCCAGGGCATCAGC AACTACCTGGCCTGGTATCAGCAGAAACCCG GCAAGGTGCCCAAGCTGCTGATCTACGCTG CCAGCACACTGCAGAGCGGAGTGCCTAGCA GA I I I ICTGGCAGCGGCTCCGGCACCGATTT CACCCTGACCATATCTAGCCTGCAGCCAGAG GA CGTGGCCACCTACTACTGTCAGCAGAGC CTGTTCGCCCCTTTCACCTTTGGCCAGGGCA CRC / nn / Lznz / E / Yii 194 CCAAGGTGGAAATCAAGCGTACGGTGGCCG CTCCCAGCGTGTTCATCTTCCCCCCCAGCGA CGAGCAGCTGAAGAGTGGCACCGCCAGCGT GGTGTGCCTGCTGAACAACTTCTACCCCCGGAGGCCAAGGTGCAGTGGAAGGTGGACAAC GCCCTGCAGAGCGGCAACAGCCAGGAGAGC GTCACCGAGCA GGACAGCAAGGACTCCACC TACAGCCTGAGCAGCACCCTGACCCTGAGC AAGGCCGACTACGAGAAGCATAAGGTGTAC GCCTGCGAGGTGACCCACCAGGGCCTGTCC AGCCCCGTGACCAAGAGCTTCAACAGGGGC GAGTGC CRC / nn / Lznz / E / Yii Other antibodies of the invention include those where the amino acids or nucleic acids encoding the amino acids have been mutated, but have at least 60, 70, 80, 90, or 95 percent identity to the sequences described in Table 2. In some embodiments , 1, 2, 3, 4, or 5 amino acids have been mutated in the variable regions compared to the variable regions depicted in the sequence described in Table 2, while retaining substantially the same therapeutic activity as the antibodies listed in Table 2. Since each of these antibodies can bind to PMEL17, the VL, VH, full-length light chain, and full-length heavy chain sequences (amino acid sequences and the nucleotide sequences encoding the amino acid sequences) can be mixed. and combining to create other PMEL17 binding antibodies of the invention. Such mixed and pooled PMEL17 binding antibodies can be tested using binding assays known in the art (eg, ELISA and other assays described in the Examples section). When these strands are mixed and matched, a VH sequence from a particular VH / VL pairing must be replaced by a structurally similar VH sequence. Similarly, a full-length heavy chain sequence of a particular full-length heavy chain / light chain pairing must be replaced by a structurally similar full-length heavy chain sequence. Similarly, a VL sequence from a particular VH / VL pairing must be replaced by a structurally similar VL sequence. Similarly, a full-length light chain sequence of a particular full-length heavy chain / light chain pairing must be replaced by a structurally similar full-length light chain sequence. Accordingly, in one aspect, the invention provides a 195 isolated monoclonal antibody or an antigen-binding region thereof having: a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 42, 64, 88, 112, 132 , 149, 165, 184, 196, 215, 227, 239 or 254; and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 21,25, 29, 53, 75, 99, 119, 143, 159, 171,190, 202, 221,233, 248 or 260; wherein the antibody specifically binds to PMEL17. In another aspect, the invention provides (i) an isolated monoclonal antibody having: a full-length heavy chain comprising an amino acid sequence that has been optimized for expression in the cell of a mammalian expression system selected from the group consisting of in SEQ ID NOs: 12, 44, 66, 90, 114, 134, 151,167, 186, 198, 217, 229, 241 or 256; and a full-length light chain comprising an amino acid sequence that has been optimized for expression in a mammalian cell selected from the group consisting of SEQ ID NOs: 23, 27, 31, 55, 77, 101, 121, 145, 161, 173, 192, 204, 223, 235, 250 or 262; or (ii) a functional protein comprising an antigen-binding portion thereof. In another aspect, the present invention provides PMEL-17 binding antibodies comprising the heavy chain and light chain CDR1s, CDR2s and CDR3s as described in Table 2, or combinations thereof. The amino acid sequences of the VH CDR1s of the antibodies are illustrated, for example, in SEQ ID NOs: 1,4,5, 7, 33, 36, 37, 39, 57, 60, 79, 82, 83, 85, 103, 106, 107,109,123,126,127,129,175,178,179,181,206,209, 210, and 212. The amino acid sequences of the VH CDR2s of the antibodies are illustrated, for example, in SEQ ID NOs: 2, 6, 8, 34, 38, 40, 58, 61,62, 80, 84, 86, 104, 108,110,124, 128,130, 176, 180,182, 207, 211, and 213. The amino acid sequences of the VH CDR3s of the antibodies are illustrated, for example, in SEQ ID NOs: 3,9,35,41,59,63,81,87, 105, 111, 125, 131, 147, 148, 163, 164, 177, 183, 194, 195,208,214, 225, 226, 237, 238, 252, and 253. The amino acid sequences of the VL CDR1s of the antibodies are illustrated, for example, in SEQ ID NOs: 14, 17, 20, 46, 49, 52, 68, 71, 74, 92, 95, 98, 116, 136, 139, 142, 153, 156, 158, 243, 245, and 247. The amino acid sequences of the VL CDR2s of the antibodies are illustrated, for example, in Fig. SEQ ID Nos: 15, 18, 47, 50, 69, 72, 93, 96, 137,140, ​​and 154. The amino acid sequences of the VL CDR3s of the antibodies are illustrated, for example, in SEQ ID NOs: 16, 19, 48, 51,70, 73, 94, 97, 117, 118, 138, 141,155, 157, 169, 170,188, 189, 200, 201, 219, 220, 231,232, 244, 246, 258, and 259 . Since each of these antibodies can bind PMEL17 and antigen-binding specificity is provided primarily by the CDR1, 2, and 3 regions, the VH CDR1, CDR2, and CDR3 sequences, and the CDR1, CDR2, and CDR3 sequences of VL can be “mixed and matched” (ie, the CDRs of different antibodies can be mixed and matched. Such 196 CRC / nn / Lznz / E / Yii "mixed and matched" binding antibodies to PMEL-17 can be tested using binding assays known in the art and those described in the Examples (eg, ELISAs). When VH CDR sequences are mixed and matched, the CDR1, CDR2 and / or CDR3 sequence of a particular VH sequence must be replaced with a structurally similar CDR sequence(s). Similarly, when VL CDR sequences are mixed and matched, the CDR1, CDR2 and / or CDR3 sequence of a particular VL sequence must be replaced with a structurally similar CDR sequence(s). It will be apparent to those skilled in the art that new VH and VL sequences can be created by substituting one or more VH and / or VL CDR region sequences with sequences structurally similar to the CDR sequences set forth herein for monoclonal antibodies of the present invention. Accordingly, in some embodiments, the present invention provides an isolated monoclonal antibody or antigen-binding region thereof comprising a heavy chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1,4 , 5, 7, 33, 36, 37, 39, 57, 60, 79, 82, 83, 85, 103, 106, 107, 109, 123, 126, 127, 129, 175, 178, 179, 181,206, 209 , 210, and 212; a heavy chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 6, 8, 34, 38, 40, 58, 61, 62, 80, 84, 86, 104, 108, 110, 124, 128,130, 176, 180,182, 207, 211, and 213; a heavy chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 9, 35, 41, 59, 63, 81, 87, 105, 111, 125, 131, 147, 148, 163, 164, 177, 183, 194, 195, 208, 214, 225, 226, 237, 238, 252, and 253; a light chain CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14,17, 20, 46, 49, 52, 68, 71,74, 92, 95, 98, 116, 136, 139, 142, 153, 156, 158, 243, 245, and 247; a light chain CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 18, 47, 50, 69, 72, 93, 96, 137, 140, and 154; and a light chain CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 19, 48, 51, 70, 73, 94, 97, 117, 118, 138, 141, 155, 157 , 169, 170, 188, 189, 200, 201,219, 220, 231,232, 244, 246, 258, and 259; wherein the antibody specifically binds to PMEL17. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 1, 4, 5 or 7, a heavy chain CDR2 of heavy chain of SEQ ID NO: 2, 6 or 8; a heavy chain CDR3 of SEQ ID NO: 3 or 9; a light chain CDR1 of SEQ ID NO: 14, 17 or 20; a light chain CDR2 of SEQ ID NO: 15 or 18; and a light chain CDR3 of SEQ ID NO: 16o 19. CRC / nn / Lznz / E / Yii 197 In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 33, 36, 37 or 39, a heavy chain CDR2 of heavy chain of SEQ ID NO: 34, 38 or 40; a heavy chain CDR3 of SEQ ID NO: 35 or 41; a light chain CDR1 of SEQ ID NO: 46, 49 or 52; a light chain CDR2 of SEQ ID NO: 47 or 50; and a CDR3 light chain of SEQ ID NO: 48 or 51. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 5, 7, 57 or 60, a heavy chain CDR2 of heavy chain of SEQ ID NO: 58, 61 or 62; a heavy chain CDR3 of SEQ ID NO: 59 or 63; a light chain CDR1 of SEQ ID NO: 68, 71 or 74; a light chain CDR2 of SEQ ID NO: 69 or 72; and a light chain CDR3 of SEQ ID NO: 70 or 73. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 79, 82, 83 or 85, a heavy chain CDR2 of heavy chain of SEQ ID NO: 80, 84 or 86; a heavy chain CDR3 of SEQ ID NO: 81 or 87; a light chain CDR1 of SEQ ID NO: 92, 95 or 98; a light chain CDR2 of SEQ ID NO: 93 or 96; and a light chain CDR3 of SEQ ID NO: 94 or 97. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of heavy chain of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 105 or 111; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a CDR3 light chain of SEQ ID NO: 117 or 118. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 123, 126, 127 or 129, a heavy chain CDR2 of heavy chain of SEQ ID NO: 124, 128 or 130; a heavy chain CDR3 of SEQ ID NO: 125 or 131; a light chain CDR1 of SEQ ID NO: 136, 139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a CDR3 light chain of SEQ ID NO: 138 or 141. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 123, 126, 127 or 129, a heavy chain CDR2 of heavy chain of SEQ ID NO: 124, 128 or 130; a heavy chain CDR3 of SEQ ID NO: 147 or 148; a light chain CDR1 of SEQ ID 198 CRC / nn / Lznz / E / Yu NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a CDR3 light chain of SEQ ID NO: 155 or 157. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of heavy chain of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 163 or 164; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 169 or 170. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 175, 178, 179 or 181, a heavy chain CDR2 of heavy chain of SEQ ID NO: 176, 180 or 182; a heavy chain CDR3 of SEQ ID NO: 177 or 183; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 188 or 189. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of heavy chain of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 194 or 195; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 200 or 201. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of heavy chain of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 208 or 214; a light chain CDR1 of SEQ ID NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a light chain CDR3 of SEQ ID NO: 219 or 220. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of heavy chain of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 225 or 226; a light chain CDR1 of SEQ ID NO: 136, 139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a CDR3 light chain of SEQ ID NO: 231 or 232. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a chain variable region CRC / nn / Lznz / E / Yii 199 heavy comprising a HCDR1 of SEQ ID NO: 206, 209, 210 or 212, a HCDR2 of SEQ ID NO: 207, 211 or 213, and a HCDR3 of SEQ ID NO: 237 or 238; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 243, 245 or 247, an LCDR2 of SEQ ID NO: 47 or 50, and an LCDR3 of SEQ ID NO: 244 or 246. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, 209, 210 or 212, a HCDR2 of SEQ ID NO: 207, 211 or 213, and a HCDR3 of SEQ ID NO: 252 or 253; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 153,156 or 158, an LCDR2 of SEQ ID NO: 50 or 154, and an LCDR3 of SEQ ID NO: 258 or 259. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 1, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a CDR2 light chain of SEQ ID NO: 15, and a CDR3 light chain of SEQ ID NO: 16; b) a heavy chain CDR1 of SEQ ID NO: 4, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a CDR2 light chain of SEQ ID NO: 15, and a CDR3 light chain of SEQ ID NO: 16; c) a heavy chain CDR1 of SEQ ID NO: 5, a heavy chain CDR2 of SEQ ID NO: 6, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 17, a CDR2 light chain of SEQ ID NO: 18, and a CDR3 light chain of SEQ ID NO: 19; either d) a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 8, a heavy chain CDR3 of SEQ ID NO: 9, a light chain CDR1 of SEQ ID NO: 20, a CDR2 light chain of SEQ ID NO: 18, and a CDR3 light chain of SEQ ID NO: 16. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 33, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID 200 CRC / nn / Lznz / E / Yii NO: 46, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 48; b) a heavy chain CDR1 of SEQ ID NO: 36, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 46, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 48; c) a heavy chain CDR1 of SEQ ID NO: 37, a heavy chain CDR2 of SEQ ID NO: 38, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 51; either d) a heavy chain CDR1 of SEQ ID NO: 39, a heavy chain CDR2 of SEQ ID NO: 40, a heavy chain CDR3 of SEQ ID NO: 41, a light chain CDR1 of SEQ ID NO: 52, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 48. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 57, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a CDR2 light chain of SEQ ID NO: 69, and a CDR3 light chain of SEQ ID NO: 70; b) a heavy chain CDR1 of SEQ ID NO: 60, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a CDR2 light chain of SEQ ID NO: 69, and a CDR3 light chain of SEQ ID NO: 70; c) a heavy chain CDR1 of SEQ ID NO: 5, a heavy chain CDR2 of SEQ ID NO: 61, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 71, a CDR2 light chain of SEQ ID NO: 72, and a CDR3 light chain of SEQ ID NO: 73; either d) a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 62, a heavy chain CDR3 of SEQ ID NO: 63, a light chain CDR1 of SEQ ID NO: 74, a CDR2 light chain of SEQ ID NO: 72, and a CDR3 light chain of SEQ ID NO: 70. CRC / nn / Lznz / E / Yu 201 In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 79, a heavy chain CDR2 of SEQ ID NO: 80, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 92, a CDR2 light chain of SEQ ID NO: 93, and a CDR3 light chain of SEQ ID NO: 94; b) a heavy chain CDR1 of SEQ ID NO: 82, a heavy chain CDR2 of SEQ ID NO: 80, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 92, a CDR2 light chain of SEQ ID NO: 93, and a CDR3 light chain of SEQ ID NO: 94; c) a heavy chain CDR1 of SEQ ID NO: 83, a heavy chain CDR2 of SEQ ID NO: 84, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 95, a CDR2 light chain of SEQ ID NO: 96, and a CDR3 light chain of SEQ ID NO: 97; either d) a heavy chain CDR1 of SEQ ID NO: 85, a heavy chain CDR2 of SEQ ID NO: 86, a heavy chain CDR3 of SEQ ID NO: 87, a light chain CDR1 of SEQ ID NO: 98, a CDR2 light chain of SEQ ID NO: 96, and a CDR3 light chain of SEQ ID NO: 94. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 116; a light chain CDR2 of SEQ ID NO: 47; and a light chain CDR3 of SEQ ID NO: 117; b) a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 117; c) a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 118; either CAC / nn / Lznz / E / Yii 202 d) a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 111, a light chain CDR1 of SEQ ID NO: 52 a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 117. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 138; b) a heavy chain CDR1 of SEQ ID NO: 126, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 138; c) a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 139, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 141; either d) a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 131, a light chain CDR1 of SEQ ID NO: 142, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 138. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 155; b) a heavy chain CDR1 of SEQ ID NO: 126, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 155; CRC / nn / Lznz / E / Yii 203 c) a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 156, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 157; either d) a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 148, a light chain CDR1 of SEQ ID NO: 158, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 155. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 169; b) a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 169; c) a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 170; either d) a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 164, a light chain CDR1 of SEQ ID NO: 52, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 169. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 175, a heavy chain CDR2 of SEQ ID NO: 176, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 188; CRC / nn / Lznz / E / Yii 204 b) a heavy chain CDR1 of SEQ ID NO: 178, a heavy chain CDR2 of SEQ ID NO: 176, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 188; c) a heavy chain CDR1 of SEQ ID NO: 179, a heavy chain CDR2 of SEQ ID NO: 180, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 189; either d) a heavy chain CDR1 of SEQ ID NO: 181, a heavy chain CDR2 of SEQ ID NO: 182; a heavy chain CDR3 of SEQ ID NO: 183, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: :188. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 200; b) a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 116, a CDR2 light chain of SEQ ID NO: 47, and a CDR3 light chain of SEQ ID NO: 200; c) a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 49, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 201; either d) a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 195, a light chain CDR1 of SEQ ID NO: 52, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 200. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: CRC / nn / Lznz / E / Yii 205 a) a heavy chain CDR1 of SEQ ID NO: 206, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 219; b) a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 153, a CDR2 light chain of SEQ ID NO: 154, and a CDR3 light chain of SEQ ID NO: 219; c) a heavy chain CDR1 of SEQ ID NO: 210, a heavy chain CDR2 of SEQ ID NO: 211, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 156, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 220; either d) a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 214, a light chain CDR1 of SEQ ID NO: 158, a CDR2 light chain of SEQ ID NO: 50, and a CDR3 light chain of SEQ ID NO: 219. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain CDR1 of SEQ ID NO: 206, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 231; b) a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a CDR2 light chain of SEQ ID NO: 137, and a CDR3 light chain of SEQ ID NO: 231; c) a heavy chain CDR1 of SEQ ID NO: 210, a heavy chain CDR2 of SEQ ID NO: 211, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 139, a CDR2 light chain of SEQ ID NO: 140, and a CDR3 light chain of SEQ ID NO: 232; either d) a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 226, a light chain CDRI of SEQ pRC / nn / Lznz / E / Yi 206 ID NO: 142; a light chain CDR2 of SEQ ID NO: 140; and a CDR3 light chain of SEQ ID NO: 231. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 237, and a light chain variable region comprising an LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; b) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 209, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 237, and a light chain variable region comprising an LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; c) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 210, a HCDR2 of SEQ ID NO: 211, and a HCDR3 of SEQ ID NO: 237, and a light chain variable region comprising an LCDR1 of SEQ ID NO: 245, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 246; either d) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 212, a HCDR2 of SEQ ID NO: 213, and a HCDR3 of SEQ ID NO: 238; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 247, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 244. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises CDR sequences selected from: a) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 206, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 252, and a light chain variable region comprising an LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; b) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 209, a HCDR2 of SEQ ID NO: 207, and a HCDR3 of SEQ ID NO: 252, and a light chain variable region comprising an LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; c) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 210, a HCDR2 of SEQ ID NO: 211, and a HCDR3 of SEQ ID NO: 252, and a chain variable region 207 light CRC / nn / Lznz / E / Yii comprising an LCDR1 of SEQ ID NO: 156, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 259; either d) a heavy chain variable region comprising a HCDR1 of SEQ ID NO: 212, a HCDR2 of SEQ ID NO: 213, and a HCDR3 of SEQ ID NO: 253; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 158, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 258. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 10 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 21. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 10 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 25. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 10 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 29. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds to PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 42 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 53. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 64 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 75. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 88 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 99. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 112 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 119. CRC / nn / Lznz / E / Yii 208 In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 132 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 143. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 149 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 159. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 165 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 171. In a specific embodiment, an antibody or antibody fragment (eg, antigen-binding fragments) that specifically binds PMEL17 comprises a heavy chain (VH) variable region comprising the amino acid sequence of SEQ ID NO: 184 , and a light chain (VL) variable region comprising the amino acid sequence of SEQ ID NO: 190. In a specific embodiment, an antibody...

Claims

1. An antibody or antigen-binding fragment thereof that binds to PMEL17 comprising: a. a heavy chain variable region comprising a heavy chain CDR1 (Complementarity-Determining Region 1) of SEQ ID NO: 1, 4, 5 or 7, a heavy chain CDR2 (Complementarity-Determining Region 2) of SEQ ID NO: 2, 6 or 8, and a heavy chain CDR3 (Complementarity-Determining Region 3) of SEQ ID NO: 3 or 9; and a variable light chain region comprising a light chain CDR1 (Complementarity Determining Region 1) of SEQ ID NO: 14, 17 or 20, a light chain CDR2 (Complementarity Determining Region 2) of SEQ ID NO: 15 or 18, and a light chain CDR3 (Complementarity Determining Region 3) of SEQ ID NO: 16 or 19; b.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 33, 36, 37 or 39, a heavy chain CDR2 of SEQ ID NO: 34, 38 or 40; a heavy chain CDR3 of SEQ ID NO: 35 or 41; a light chain CDR1 of SEQ ID NO: 46, 49 or 52; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 48 or 51; c. a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 5, 7, 57 or 60, a heavy chain CDR2 of SEQ ID NO: 58, 61 or 62; a heavy chain CDR3 of SEQ ID NO: 59 or 63; a light chain CDR1 of SEQ ID NO: 68, 71 or 74; a light chain CDR2 of SEQ ID NO: 69 or 72; and a light chain CDR3 of SEQ ID NO: 70 or 73; d.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 79, 82, 83 or 85, a heavy chain CDR2 of SEQ ID NO: 80, 84 or 86; a heavy chain CDR3 of SEQ ID NO: 81 or 87; a light chain CDR1 of SEQ ID NO: 92, 95 or 98; a light chain CDR2 of SEQ ID NO: 93 or 96; and a light chain CDR3 of SEQ ID NO: 94 or 97; e. a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 105 or 111; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 117 or 118; CRC / nn / Lznz / E / Yu 284 f.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 123, 126, 127 or 129, a heavy chain CDR2 of SEQ ID NO: 124, 128 or 130; a heavy chain CDR3 of SEQ ID NO: 125 or 131; a light chain CDR1 of SEQ ID NO: 136, 139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a light chain CDR3 of SEQ ID NO: 138 or 141; g. a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 123, 126, 127 or 129, a heavy chain CDR2 of SEQ ID NO: 124, 128 or 130; a heavy chain CDR3 of SEQ ID NO: 147 or 148; a light chain CDR1 of SEQ ID NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a light chain CDR3 of SEQ ID NO: 155 or 157; h.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 163 or 164; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 169 or 170; i. a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 175, 178, 179 or 181, a heavy chain CDR2 of SEQ ID NO: 176, 180 or 182; a heavy chain CDR3 of SEQ ID NO: 177 or 183; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 188 or 189; j.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 103, 106, 107 or 109, a heavy chain CDR2 of SEQ ID NO: 104, 108 or 110; a heavy chain CDR3 of SEQ ID NO: 194 or 195; a light chain CDR1 of SEQ ID NO: 49, 52 or 116; a light chain CDR2 of SEQ ID NO: 47 or 50; and a light chain CDR3 of SEQ ID NO: 200 or 201; k. a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 208 or 214; a light chain CDR1 of SEQ ID NO: 153, 156 or 158; a light chain CDR2 of SEQ ID NO: 50 or 154; and a light chain CDR3 of SEQ ID NO: 219 or 220; CRC / nn / Lznz / E / Yii 285 I.a variable heavy chain region comprising a heavy chain CDR1 of SEQ ID NO: 206, 209, 210 or 212, a heavy chain CDR2 of SEQ ID NO: 207, 211 or 213; a heavy chain CDR3 of SEQ ID NO: 225 or 226; a light chain CDR1 of SEQ ID NO: 136, 139 or 142; a light chain CDR2 of SEQ ID NO: 137 or 140; and a light chain CDR3 of SEQ ID NO: 231 or 232; m. a heavy chain variable region comprising a heavy chain variable region comprising an HCDR1 of SEQ ID NO: 206, 209, 210 or 212, an HCDR2 of SEQ ID NO: 207, 211 or 213, and an HCDR3 of SEQ ID NO: 237 or 238; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 243, 245 or 247, an LCDR2 of SEQ ID NO: 47 or 50, and an LCDR3 of SEQ ID NO: 244 or 246; n.a heavy chain variable region comprising a heavy chain variable region comprising an HCDR1 of SEQ ID NO: 206, 209, 210 or 212, an HCDR2 of SEQ ID NO: 207, 211 or 213, and an HCDR3 of SEQ ID NO: 252 or 253; and a light chain variable region comprising an LCDR1 of SEQ ID NO: 153, 156 or 158, an LCDR2 of SEQ ID NO: 50 or 154, and an LCDR3 of SEQ ID NO: 258 or 259; or. a heavy chain CDR1 of SEQ ID NO: 1, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a light chain CDR2 of SEQ ID NO: 15, and a light chain CDR3 of SEQ ID NO: 16; p. a heavy chain CDR1 of SEQ ID NO: 4, a heavy chain CDR2 of SEQ ID NO: 2, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 14, a light chain CDR2 of SEQ ID NO: 15, and a light chain CDR3 of SEQ ID NO: 16; q.a heavy chain CDR1 of SEQ ID NO: 5, a heavy chain CDR2 of SEQ ID NO: 6, a heavy chain CDR3 of SEQ ID NO: 3, a light chain CDR1 of SEQ ID NO: 17, a light chain CDR2 of SEQ ID NO: 18, and a light chain CDR3 of SEQ ID NO: 19; r. a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 8, a heavy chain CDR3 of SEQ ID NO: 9, a light chain CDR1 of SEQ ID NO: 20, a light chain CDR2 of SEQ ID NO: 18, and a light chain CDR3 of SEQ ID NO: 16; CRC / nn / Lznz / E / Yii 286 s. a heavy chain CDR1 of SEQ ID NO: 33, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 46, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 48; t.a heavy chain CDR1 of SEQ ID NO: 36, a heavy chain CDR2 of SEQ ID NO: 34, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 46, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 48; or a heavy chain CDR1 of SEQ ID NO: 37, a heavy chain CDR2 of SEQ ID NO: 38, a heavy chain CDR3 of SEQ ID NO: 35, a light chain CDR1 of SEQ ID NO: 49, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 51; a heavy chain CDR1 of SEQ ID NO: 39, a heavy chain CDR2 of SEQ ID NO: 40, a heavy chain CDR3 of SEQ ID NO: 41, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 48; w.a heavy chain CDR1 of SEQ ID NO: 57, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a light chain CDR2 of SEQ ID NO: 69, and a light chain CDR3 of SEQ ID NO: 70; x. a heavy chain CDR1 of SEQ ID NO: 60, a heavy chain CDR2 of SEQ ID NO: 58, a heavy chain CDR3 of SEQ ID NO: 59, a light chain CDR1 of SEQ ID NO: 68, a light chain CDR2 of SEQ ID NO: 69, and a light chain CDR3 of SEQ ID NO: 70; y. one heavy chain CDR1 of SEQ ID NO: 5, one heavy chain CDR2 of SEQ ID NO: 61, one heavy chain CDR3 of SEQ ID NO: 59, one light chain CDR1 of SEQ ID NO: 71, one light chain CDR2 of SEQ ID NO: 72, and one light chain CDR3 of SEQ ID NO: 73; pRC / nn / Lznz / E / Yii z.a heavy chain CDR1 of SEQ ID NO: 7, a heavy chain CDR2 of SEQ ID NO: 62, a heavy chain CDR3 of SEQ ID NO: 63, a light chain CDR1 of SEQ ID NO: 287 74, a light chain CDR2 of SEQ ID NO: 72, and a light chain CDR3 of SEQ ID NO: 70; aa. a heavy chain CDR1 of SEQ ID NO: 79, a heavy chain CDR2 of SEQ ID NO: 80, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 92, a light chain CDR2 of SEQ ID NO: 93, and a light chain CDR3 of SEQ ID NO: 94; bb. one heavy chain CDR1 of SEQ ID NO: 82, one heavy chain CDR2 of SEQ ID NO: 80, one heavy chain CDR3 of SEQ ID NO: 81, one light chain CDR1 of SEQ ID NO: 92, one light chain CDR2 of SEQ ID NO: 93, and one light chain CDR3 of SEQ ID NO: 94; cc.a heavy chain CDR1 of SEQ ID NO: 83, a heavy chain CDR2 of SEQ ID NO: 84, a heavy chain CDR3 of SEQ ID NO: 81, a light chain CDR1 of SEQ ID NO: 95, a light chain CDR2 of SEQ ID NO: 96, and a light chain CDR3 of SEQ ID NO: 97; dd. a heavy chain CDR1 of SEQ ID NO: 85, a heavy chain CDR2 of SEQ ID NO: 86, a heavy chain CDR3 of SEQ ID NO: 87, a light chain CDR1 of SEQ ID NO: 98, a light chain CDR2 of SEQ ID NO: 96, and a light chain CDR3 of SEQ ID NO: 94; ee. one heavy chain CDR1 of SEQ ID NO: 103, one heavy chain CDR2 of SEQ ID NO: 104, one heavy chain CDR3 of SEQ ID NO: 105, one light chain CDR1 of SEQ ID NO: 116; one light chain CDR2 of SEQ ID NO: 47; and one light chain CDR3 of SEQ ID NO: 117; ff.a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ ID NO: 116, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 117; gg. a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 105, a light chain CDR1 of SEQ pRC / nn / Lznz / E / Yi 288 ID NO: 49, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 118; hh. a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 111, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 117; ii.a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a light chain CDR2 of SEQ ID NO: 137, and a light chain CDR3 of SEQ ID NO: 138; jj. a heavy chain CDR1 of SEQ ID NO: 126, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 136, a light chain CDR2 of SEQ ID NO: 137, and a light chain CDR3 of SEQ ID NO: 138; kk. a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 125, a light chain CDR1 of SEQ ID NO: 139, a light chain CDR2 of SEQ ID NO: 140, and a light chain CDR3 of SEQ ID NO: 141; II.a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 131, a light chain CDR1 of SEQ ID NO: 142, a light chain CDR2 of SEQ ID NO: 140, and a light chain CDR3 of SEQ ID NO: 138; mm. a heavy chain CDR1 of SEQ ID NO: 123, a heavy chain CDR2 of SEQ ID NO: 124, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 153, a light chain CDR2 of SEQ ID NO: 154, and a light chain CDR3 of SEQ ID NO: 155; nn. one heavy chain CDR1 of SEQ ID NO: 126, one heavy chain CDR2 of SEQ ID NO: 124, one heavy chain CDR3 of SEQ ID NO: 147, one light chain CDR1 of SEQ ID NO: 153, one light chain CDR2 of SEQ ID NO: 154, and one light chain CDR3 of SEQ ID NO: 155; pRC / nn / Lznz / E / Yi 289 oo.a heavy chain CDR1 of SEQ ID NO: 127, a heavy chain CDR2 of SEQ ID NO: 128, a heavy chain CDR3 of SEQ ID NO: 147, a light chain CDR1 of SEQ ID NO: 156, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 157; pp. a heavy chain CDR1 of SEQ ID NO: 129, a heavy chain CDR2 of SEQ ID NO: 130, a heavy chain CDR3 of SEQ ID NO: 148, a light chain CDR1 of SEQ ID NO: 158, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 155; qq. one heavy chain CDR1 of SEQ ID NO: 103, one heavy chain CDR2 of SEQ ID NO: 104, one heavy chain CDR3 of SEQ ID NO: 163, one light chain CDR1 of SEQ ID NO: 116, one light chain CDR2 of SEQ ID NO: 47, and one light chain CDR3 of SEQ ID NO: 169; rr.a heavy chain CDR1 of SEQ ID NO: 106, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 116, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 169; ss. a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 163, a light chain CDR1 of SEQ ID NO: 49, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 170; tt. one heavy chain CDR1 of SEQ ID NO: 109, one heavy chain CDR2 of SEQ ID NO: 110, one heavy chain CDR3 of SEQ ID NO: 164, one light chain CDR1 of SEQ ID NO: 52, one light chain CDR2 of SEQ ID NO: 50, and one light chain CDR3 of SEQ ID NO: 169; uu.one heavy chain CDR1 of SEQ ID NO: 175, one heavy chain CDR2 of SEQ ID NO: 176, one heavy chain CDR3 of SEQ ID NO: 177, one light chain CDR1 of SEQ ID NO: 116, one light chain CDR2 of SEQ ID NO: 47, and one light chain CDR3 of SEQ ID NO: 188; vv. a heavy chain CDR1 of SEQ ID NO: 178, a heavy chain CDR2 of SEQ ID NO: 176, a heavy chain CDR3 of SEQ ID NO: 177, a light chain CDR1 of SEQ CRC / nn / Lznz / E / Yii 290 ID NO: 116, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 188; ww. one heavy chain CDR1 of SEQ ID NO: 179, one heavy chain CDR2 of SEQ ID NO: 180, one heavy chain CDR3 of SEQ ID NO: 177, one light chain CDR1 of SEQ ID NO: 49, one light chain CDR2 of SEQ ID NO: 50, and one light chain CDR3 of SEQ ID NO: 189; xx.a heavy chain CDR1 of SEQ ID NO: 181, a heavy chain CDR2 of SEQ ID NO: 182; a heavy chain CDR3 of SEQ ID NO: 183, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 188; and a heavy chain CDR1 of SEQ ID NO: 103, a heavy chain CDR2 of SEQ ID NO: 104, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 116, a light chain CDR2 of SEQ ID NO: 47, and a light chain CDR3 of SEQ ID NO: 200; one heavy chain CDR1 of SEQ ID NO: 106, one heavy chain CDR2 of SEQ ID NO: 104, one heavy chain CDR3 of SEQ ID NO: 194, one light chain CDR1 of SEQ ID NO: 116, one light chain CDR2 of SEQ ID NO: 47, and one light chain CDR3 of SEQ ID NO: 200; aaa.a heavy chain CDR1 of SEQ ID NO: 107, a heavy chain CDR2 of SEQ ID NO: 108, a heavy chain CDR3 of SEQ ID NO: 194, a light chain CDR1 of SEQ ID NO: 49, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 201; bbb. a heavy chain CDR1 of SEQ ID NO: 109, a heavy chain CDR2 of SEQ ID NO: 110, a heavy chain CDR3 of SEQ ID NO: 195, a light chain CDR1 of SEQ ID NO: 52, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 200; ccc. one heavy chain CDR1 of SEQ ID NO: 206, one heavy chain CDR2 of SEQ ID NO: 207, one heavy chain CDR3 of SEQ ID NO: 208, one light chain CDR1 of SEQ ID NO: 153, one light chain CDR2 of SEQ ID NO: 154, and one light chain CDR3 of SEQ ID NO: 219; CRC / nn / Lznz / E / Yii 291 ddd.a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 153, a light chain CDR2 of SEQ ID NO: 154, and a light chain CDR3 of SEQ ID NO: 219; eee. a heavy chain CDR1 of SEQ ID NO: 210, a heavy chain CDR2 of SEQ ID NO: 211, a heavy chain CDR3 of SEQ ID NO: 208, a light chain CDR1 of SEQ ID NO: 156, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 220; fff. a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 214, a light chain CDR1 of SEQ ID NO: 158, a light chain CDR2 of SEQ ID NO: 50, and a light chain CDR3 of SEQ ID NO: 219; ggg.a heavy chain CDR1 of SEQ ID NO: 206, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a light chain CDR2 of SEQ ID NO: 137, and a light chain CDR3 of SEQ ID NO: 231; hhh. a heavy chain CDR1 of SEQ ID NO: 209, a heavy chain CDR2 of SEQ ID NO: 207, a heavy chain CDR3 of SEQ ID NO: 225, a light chain CDR1 of SEQ ID NO: 136, a light chain CDR2 of SEQ ID NO: 137, and a light chain CDR3 of SEQ ID NO: 231; iii. one heavy chain CDR1 of SEQ ID NO: 210, one heavy chain CDR2 of SEQ ID NO: 211, one heavy chain CDR3 of SEQ ID NO: 225, one light chain CDR1 of SEQ ID NO: 139, one light chain CDR2 of SEQ ID NO: 140, and one light chain CDR3 of SEQ ID NO: 232; jjj.a heavy chain CDR1 of SEQ ID NO: 212, a heavy chain CDR2 of SEQ ID NO: 213, a heavy chain CDR3 of SEQ ID NO: 226, a light chain CDRI of SEQ ID NO: 142; a light chain CDR2 of SEQ ID NO: 140; and a light chain CDR3 of SEQ ID NO: 231; kkk. a heavy chain variable region comprising an HCDR1 of SEQ ID NO: 206, an HCDR2 of SEQ ID NO: 207, and an HCDR3 of SEQ ID NO: 237, and a light chain variable region pAC / nn / Lznz / E / Yii 292 comprising an LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; III. a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 209, an HCDR2 of SEQ ID NO: 207, and an HCDR3 of SEQ ID NO: 237, and a variable light chain region comprising an LCDR1 of SEQ ID NO: 243, an LCDR2 of SEQ ID NO: 47, and an LCDR3 of SEQ ID NO: 244; mmm.a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 210, an HCDR2 of SEQ ID NO: 211, and an HCDR3 of SEQ ID NO: 237, and a variable light chain region comprising an LCDR1 of SEQ ID NO: 245, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 246; nnn. a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 212, an HCDR2 of SEQ ID NO: 213, and an HCDR3 of SEQ ID NO: 238; and a variable light chain region comprising an LCDR1 of SEQ ID NO: 247, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 244; ooo. a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 206, an HCDR2 of SEQ ID NO: 207, and an HCDR3 of SEQ ID NO: 252, and a variable light chain region comprising an LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; ppp.a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 209, an HCDR2 of SEQ ID NO: 207, and an HCDR3 of SEQ ID NO: 252, and a variable light chain region comprising an LCDR1 of SEQ ID NO: 153, an LCDR2 of SEQ ID NO: 154, and an LCDR3 of SEQ ID NO: 258; qqq. a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 210, an HCDR2 of SEQ ID NO: 211, and an HCDR3 of SEQ ID NO: 252, and a variable light chain region comprising an LCDR1 of SEQ ID NO: 156, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO: 259; or rrr. a variable heavy chain region comprising an HCDR1 of SEQ ID NO: 212, an HCDR2 of SEQ ID NO: 213, and an HCDR3 of SEQ ID NO: 253; and a variable light chain region comprising an LCDR1 of SEQ ID NO: 158, an LCDR2 of SEQ ID NO: 50, and an LCDR3 of SEQ ID NO:

258. CRC / nn / Lznz / E / Yii 293.

2. An antibody or antigen-binding fragment thereof that binds to PMEL17 comprising: a. A heavy chain variable region (HV) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (LV) comprising the amino acid sequence of SEQ ID NO: 21; b. A heavy chain variable region (HV) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (LV) comprising the amino acid sequence of SEQ ID NO: 25; c. A heavy chain variable region (HV) comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region (LV) comprising the amino acid sequence of SEQ ID NO: 29; d. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 42, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 53; e.A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 64, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 75; f. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 88, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 99; g. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 112, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 119; h. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 132, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 143; i.A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 149, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 159; CRC / nn / Lznz / E / Yii 294 j. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 165, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 171; k. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 184, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 190; I. A heavy chain variable region (HV) comprising the amino acid sequence of SEQ ID NO: 196, and a light chain variable region (LV) comprising the amino acid sequence of SEQ ID NO: 202; m.A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 215, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 221; n. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 227, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 233; o. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 239, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO: 248; or p. A variable heavy chain region (VH) comprising the amino acid sequence of SEQ ID NO: 254, and a variable light chain region (VL) comprising the amino acid sequence of SEQ ID NO:

260.

3. An antibody or antigen-binding fragment thereof that binds to PMEL17 comprising: a. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 23; b. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 27; c. A heavy chain comprising the amino acid sequence of SEQ ID NO: 12, and a light chain comprising the amino acid sequence of SEQ ID NO: 31; CRC / nn / Lznz / E / Yii 295 d. A heavy chain comprising the amino acid sequence of SEQ ID NO: 44, and a light chain comprising the amino acid sequence of SEQ ID NO: 55; e. A heavy chain comprising the amino acid sequence of SEQ ID NO: 66, and a light chain comprising the amino acid sequence of SEQ ID NO: 77; f.A heavy chain comprising the amino acid sequence of SEQ ID NO: 90, and a light chain comprising the amino acid sequence of SEQ ID NO: 101; g. A heavy chain comprising the amino acid sequence of SEQ ID NO: 114, and a light chain comprising the amino acid sequence of SEQ ID NO: 121; h. A heavy chain comprising the amino acid sequence of SEQ ID NO: 134, and a light chain comprising the amino acid sequence of SEQ ID NO: 145; i. A heavy chain comprising the amino acid sequence of SEQ ID NO: 151, and a light chain comprising the amino acid sequence of SEQ ID NO: 161; j. A heavy chain comprising the amino acid sequence of SEQ ID NO: 167, and a light chain comprising the amino acid sequence of SEQ ID NO: 173; k.A heavy chain comprising the amino acid sequence of SEQ ID NO: 186, and a light chain comprising the amino acid sequence of SEQ ID NO: 192; I. A heavy chain comprising the amino acid sequence of SEQ ID NO: 198, and a light chain comprising the amino acid sequence of SEQ ID NO: 204; m. A heavy chain comprising the amino acid sequence of SEQ ID NO: 217, and a light chain comprising the amino acid sequence of SEQ ID NO: 223; n. A heavy chain comprising the amino acid sequence of SEQ ID NO: 229, and a light chain comprising the amino acid sequence of SEQ ID NO: 235; o. A heavy chain comprising the amino acid sequence of SEQ ID NO: 241, and a light chain comprising the amino acid sequence of SEQ ID NO: 250; or p.A heavy chain comprising the amino acid sequence of SEQ ID NO: 256, and a light chain comprising the amino acid sequence of SEQ ID NO:

262. CAC / nn / Lznz / E / Yii 296.

4. The antibody of any of Claims 1-3, wherein the antibody or antigen-binding fragment thereof comprises one or more cysteine ​​substitutions.

5. The antibody of Claim 4, wherein the antibody or antigen-binding fragment thereof comprises one or more cysteine ​​substitutions selected from S152C, S375C, or both S152C and S375C of the heavy chain of the antibody or antigen-binding fragment thereof, wherein the position is numbered according to the UE system.

6. The antibody of any of Claims 1-5, wherein said antibody is a monoclonal antibody.

7. An antibody-drug conjugate comprising the formula (C) Ab-(LA-(D)n) and (C) wherein: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11; Ab is an antibody or antigen-binding fragment thereof that binds to the human PMEL17 protein; LA is a linker; n is 1, 2, 3, or 4; and y is 1, 2, 3, or 4.

8. The antibody-drug conjugate of Claim 7, wherein said n is 1.

9. The antibody-drug conjugate of any of Claims 7 or 8, wherein said y ranges approximately from 1 to approximately 4.

10. The antibody-drug conjugate of any of Claims 7-9, wherein said linker is a cleavable linker or a non-cleavable linker.

11. The antibody-drug conjugate of Claim 10, wherein the linker comprises a ValCit peptide linker.

12. The antibody-drug conjugate of any of Claims 7-11, wherein said drug residue is an inhibitor of GNAQ and GNA11. CRC / nn / Lznz / E / Yu 297 13. The antibody-drug conjugate of any of Claims 7-11, wherein D is *** i CRC / nn / Lznz / E / Yii 14. The antibody-drug conjugate of any of Claims 7-11, wherein D is *** i 15. The antibody-drug conjugate of any of Claims 7-14 having the following structure, 298 prc? nn / ίζηζ / E / γΐΛ 16. The antibody-drug conjugate of any of Claims 7-14 having the following structure, 17. An antibody-drug conjugate having the following Formula (C-2): 299 prc? nn / Lznz / E / YiA where: RO is methyl or ethyl; R1 is methyl or isopropyl; R2 is methyl or ethyl; Ab is an antibody or antigen-binding fragment thereof that binds to human PMEL17 protein; X1 is a bivalent coupling group; X2 is a self-immolating spacer; L1 is a bivalent peptide linker; L2 is a linker or a bonder, yy is 1, 2, 3 or 4.

18. A pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, of any of Claims 1-6 and a pharmaceutically acceptable carrier. 300 19. A pharmaceutical composition comprising the antibody-drug conjugate of any of Claims 7-17 and a pharmaceutically acceptable carrier.

20. A method for treating or preventing cancer in a patient in need thereof, comprising administering to said patient the antibody-drug conjugate of any of Claims 7-17, or the pharmaceutical composition of any of Claims 18 or 19, wherein the cancer expresses PMEL17, contains a mutation of the GNAQ or GNA11 gene, or the cancer expresses PMEL17 and contains a mutation of GNAQ, GNA11, or both.

21. The method of Claim 20, wherein the antibody-drug conjugate or pharmaceutical composition is administered to the patient in combination with one or more additional therapeutic compounds.

22. The method of Claim 21, wherein the single or additional therapeutic compounds are selected from a standard-of-care chemotherapeutic, an MDM2 inhibitor, an MRC2 inhibitor, a PKC inhibitor, a MAPK inhibitor, a costimulatory molecule, or a checkpoint inhibitor.

23. The method of Claim 22, wherein the costimulatory molecule is selected from an agonist of 0X40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11 a / CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, STING, or CD83 ligand.

24. The method of Claim 22, wherein the checkpoint inhibitor is selected from an inhibitor of PD-1, PD-L1, PD-L2, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and / or TGFR beta.

25. The antibody-drug conjugate of any of Claims 7-17, or the pharmaceutical composition of any of Claims 18 or 19, for use as a medicament.

26. The antibody-drug conjugate of any of Claims 7-17, or the pharmaceutical composition of any of Claims 18 or 19, for use in the treatment or prevention of a cancer expressing PMEL17 or a cancer containing a mutation of the GNAQ or GNA11 gene in a patient in need.

27. The use of the antibody or antigen-binding fragment thereof of any of Claims 1-6, the antibody-drug conjugate of any of Claims 7-17, or the pharmaceutical composition of any of Claims 18 or 19, for treating or preventing a 301 CRC / nn / Lznz / E / Yii cancer expressing PMEL17 or a cancer containing a mutation of the GNAQ or GNA11 gene in a patient in need.

28. The use of the antibody or antigen-binding fragment thereof of any of Claims 1-6, the antibody-drug conjugate of any of Claims 7-17, or the pharmaceutical composition of any of Claims 18 or 19 in the manufacture of a medicament.

29. The method of any of Claims 20-24, the antibody-drug conjugate of any of Claims 25-26, or the use of any of Claims 27-28, wherein the cancer expresses PMEL17 or contains a mutation in the GNAQ or GNA11 gene.

30. The method, antibody-drug conjugate, or use of Claim 28, wherein the cancer is uveal melanoma, subcutaneous melanoma, hepatocellular carcinoma, or a metastatic cancer thereof.

31. A nucleic acid encoding the antibody or antigen-binding fragment of any of Claims 1-6.

32. The nucleic acid of Claim 31, wherein the nucleic acid comprises the nucleotide sequence of the SEQ ID NOs: 13, 24, 28, 32, 45, 56, 67, 78, 91, 102, 115, 122, 135, 146, 152, 162, 168, 174, 187, 193, 199, 205, 218, 224, 230, 236, 242, 251, 257, or 263.

33. A vector comprising the nucleic acid of Claim 31 or 32.

34. A host cell comprising the vector according to Claim 33, or the nucleic acid according to Claim 31 or 32.

35. A process for producing an antibody or antigen-binding fragment comprising culturing the host cell of Claim 34 and recovering the antibody from the cell culture.

36. The process of Claim 35 wherein the recovery of the antibody from the cell culture comprises the steps of: a) removing the cells and filtering the culture; b) purifying the culture by affinity chromatography; c) inactivating all viruses in the culture by adjusting the pH to 3.4-3.6, then readjusting the pH to 5.8-6.2 and filtering the culture; d) purifying the culture by cation-exchange chromatography and performing column reduction of the culture; e) performing anion-exchange chromatography on the culture; f) removing the viruses by nanofiltration; g) filtering the culture containing the antibody; and h) obtaining purified antibody.

37. A process for producing an anti-PMEL17 antibody-drug conjugate comprising: (a) preforming a linker-drug moiety of the following Formula (B): R8-LB-(D)n (B) wherein: D is a GNAQ inhibitor, a GNA11 inhibitor, or an inhibitor of both GNAQ and GNA11; R8 is a reactive group; LB is a cleavable and non-cleavable linker, and n is 1, 2, 3, or 4; (d) conjugating said linker-drug moiety to the cell culture recovery antibody of Claim 35 to produce an antibody-drug conjugate; and (c) purifying the antibody-drug conjugate.

38. A diagnostic reagent comprising the antibody or antigen-binding fragment thereof of any of Claims 1-6.

39. The diagnostic reagent of Claim 38, wherein the antibody or antigen-binding fragment thereof is labelled with a radiolabel, a fluorophore, a chromophore, an imaging agent, or a metal ion.