GIP / GLP1 COAGONIST COMPOUNDS

MX435261BActive Publication Date: 2026-06-12ELI LILLY & CO
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
MX2021000793
Authority / Receiving Office
MX · MX
Patent Type
Patents
Current Assignee / Owner
Priority Date
2018-10-03
Filing Date
2021-01-20
Publication Date
2026-06-12
Estimated Expiration
2039-07-22

AI Technical Summary

Technical Problem

Current treatments for type 2 diabetes mellitus (T2DM) and obesity are inadequate, with existing GLP-1 receptor agonists limited by gastrointestinal side effects and suboptimal glucose control, and there is a need for compounds that can provide effective glucose control and weight loss with a favorable side effect profile, suitable for oral administration and long duration of action.

Method used

Development of compounds with dual agonist activity at GIP and GLP-1 receptors, specifically peptides of Formula I, which are designed for oral administration and have a prolonged duration of action, reducing the frequency of dosing and minimizing side effects.

Benefits of technology

The compounds effectively control glucose levels and induce weight loss in patients with T2DM and obesity, offering a more favorable therapeutic profile compared to existing treatments, with potential for less frequent dosing and improved patient compliance.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

The present invention relates to compounds that have activity on both human glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. The present invention also relates to compounds that have a prolonged duration of action on each of these receptors. Furthermore, the present invention also relates to compounds that can be administered orally. The compounds may be useful in the treatment of type 2 diabetes mellitus (T2DM). Additionally, the compounds may be useful in the treatment of obesity.
Need to check novelty before this filing date? Find Prior Art

Description

GIP / GLP1 COAGONIST COMPOUNDS The present invention relates to compounds having activity at both human glucose-dependent insulinotropic polypeptide (GIP) receptors and glucagon-like peptide-1 (GLP-1) receptors. The present invention further relates to compounds having a prolonged duration of action at each of these receptors. Furthermore, the present invention relates to compounds that can be administered orally. The compounds may be useful in the treatment of type 2 diabetes mellitus (T2DM). Furthermore, the compounds may be useful in the treatment of obesity. During the last decades, the prevalence of diabetes has continued to increase. T2DM is the most common form of diabetes, accounting for about 90% of all diabetes cases. T2DM is characterized by high blood glucose levels associated primarily with insulin resistance. The current standard of care for T2DM includes diet and exercise, oral drug therapy, and injectable glucose-lowering drugs, including incrctin-based therapies such as GLP-1 receptor agonists. Currently, a variety of GLP-1 receptor agonists are available for the treatment of T2DM, although marketed GLP-1 receptor agonists are generally dose-limited by gastrointestinal side effects, such as nausea and vomiting. Subcutaneous injection is the typical route of administration for available GLP-1 receptor agonists. When treatment with oral drugs and incretin-based treatments is insufficient, treatment with insulin is considered. Despite currently available treatment advances, many patients with T2DM are unable to achieve their glycemic control goals. Uncontrolled diabetes leads to various conditions associated with increased morbidity and mortality of patients. There is a need for a treatment that will allow more T2DM patients to reach their glycemic treatment goal. Obesity is a complex medical disorder that results in an excessive accumulation of adipose tissue mass. Currently, obesity is a global public health problem that is associated with undesirable health outcomes and morbidities. Desired treatments for patients with obesity aim to reduce excess body weight, improve obesity-related comorbidities, and maintain weight loss in the long term. Available treatments for obesity are unsatisfactory, particularly for FR / nnn / Lznz / e / YiAi Χ-21852 patients with severe obesity. There is a need for alternative treatment options to induce therapeutic weight loss in patients in need of such treatment. WO2016 / 111971 describes peptides claimed to have GLP1 and GIP activity. WO2013 / 164483 also describes compounds claimed to have GLP-1 and GIP activity. There is a need for treatments for T2DM capable of providing effective glucose control for a larger portion of patients in need of such treatment. There is a further need for T2D treatments capable of providing effective glucose control and with a favorable side effect profile. There is a need for alternative treatment options to provide therapeutic weight loss in a patient in need of such treatment. There is a need for an alternative treatment option for a patient in need of treatment for severe obesity. There is a desire for compounds having agonist activity at GIP and GLP-1 receptors that are suitable for oral administration. Compounds with a long duration of action at each of the GIP and GLP-1 receptors are desirable to allow less frequent dosing of the compound. Accordingly, the present invention provides a compound of Formula I: R1X1X2X3GTX6TSDX10X11X12X13X14DX16X17AX19X20X21X22X23X24X25X26X27 X28X29X30X31 (SEQ ID NO:3) where: Ri is a modification of the N-terminal amino group wherein the modification is selected from the group consisting of Ac and absent; Xi is selected from the group consisting of Y, H, D-Tyr, F, desH and des Y, X2 is selected from the group consisting of Aib, aMeP, A, P, and D-Ala: 0X1 and X2 combine to form desH-\y[NHCO]-Aib; X3 is selected from the group consisting of E, N, Aad, and cTA; Xe is selected from the group consisting of F, aMeF, and aMeF(2F); X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, E, aMeF, aMeF(2F), I, aMeY, Q, D-His, D-Tyr, cTA, and K(2 -[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)qCO2H; X11 is selected from the group consisting of S, aMeS, and D-Ser; FR / nnn / Lznz / e / YiAi FR / nnn / Lznz / e / YiAi Χ-21852 -3Χ12 is selected from the group consisting of I, S, D-He, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H ; X13 is selected from the group consisting of Nle, Aib, L, aMeL, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X14 is selected from the group consisting of L and K, wherein K is conjugated to a Ci6-C22 fatty acid, wherein said fatty acid is optionally conjugated to said K via a linker; X16 is selected from the group consisting of K, E, Om, Dab, Dap, S, T, H, Aib, aMeK, R, and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) 2-(y-Glu)-CO-(CH2)qCO2H; X17 is selected from the group consisting of K, Q, I, and a C16-C22 fatty acid conjugated amino acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker; Xj9 is selected from the group consisting of Q, A, and K(2-[2-(2-amino-ethoxy)-ethoxy]acctyl)2-(y-Glu)-CO-(CH2)qCO2H; X20 is selected from the group consisting of Aib, Q, H, R, K, aMeK, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2 )qCO2H; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E, I, and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO-(CH2)qCO2H; X22 is selected from the group consisting of F and aMeF; X23 is selected from the group consisting of I, L, A, G, F, Η, E, V, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO-(CH2)qCO2H; X24 is selected from the group consisting of S, Aad, D-Glu, E, Aib, Η, V, A, Q, D, P, and K(2-[2-(2-amino-ethoxy)-ethoxy]- acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X25 is selected from the group consisting of Y and aMeY; X26 is selected from the group consisting of L, aMeL, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X27 is selected from the group consisting of L, I, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X28 is selected from the group consisting of E, A, S, D-Glu, and K(2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(y-Glu)-CO-(CH2) qCO2H; X29 is selected from the group consisting of Aib, G, A, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; FR / nnn / Lznz / e / YiAi Χ-21852 -4X3o is selected from the group consisting of C, G, G-R2 and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H ; X31 is absent or selected from the group consisting of PXs2X33X34-R2 (SEQ ID NO:4), PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), PX32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:6), K[(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H] X32X33X34-R2 ( SEQ ID NO:7), K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]X32X33X34X35X36X37X38X39-R2 (SEQ ID NO: 8) and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]X32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:9); where: X32 is S or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X33 is S or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X34 is selected from the group consisting of G, C, and K[(2-[2-(2-amino-ethoxy)ctoxy]-acctyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X35 is A or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X36 is P or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X37 is P or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X38 is P or K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X39 is selected from the group consisting of C, S, and K[(2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; X40 is selected from the group consisting of C and K[(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H]; q is selected from the group consisting of 14, 15, 16, 17, 18, 19, and 20; and R2 is a modification of the C-terminal group, where the modification is NH2 or is absent; or a pharmaceutically acceptable salt thereof; where if X30 is G-R2, then X31 is absent; where not more than one of Χίο, X12, X13, X14, X16, X17, X19, X2o, X21, X23,X24, X26, X27, X28, X29, X30, X31, X32, X33, X34, X35, X36 , X37, X38, X39, and X40 may be a fatty acid-containing substituent; and wherein no more than one of X30, X34, X39 and X40 may be C; and Χ-21852 -5FR / nnn / Lznz / e / YiAi where if one of X30, X34, X39, and X40 is C, then none of Χίο, X12, X13, X14, Xió, X17, X19, X20, X21, X23, X24 , X26, X27, X28, X29, X30, X3i,X32, X33, X34, X35, X36, X37, X38, X39, and X40 is a fatty acid-containing substituent. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein q is 16. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X31 is selected from group consisting of SEQ ID NO:5 and SEQ ID NO:8. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the X17 amino acid that is conjugated to a fatty acid is a natural amino acid. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X17 is selected from the group consisting of K, Q, and I. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein K is conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said K via a linker. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is selected from the group consisting of K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl) 2-(y-Glu)-CO-(CH2)i6-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(7-Glu)-CO-(CH2)i8 -CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i4-CO2H, K(2-[2-(2-amino -ethoxy)-ethoxy]-acetyl)2-CO-(CH2)i8-CO2H, K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)-(Y-Glu)-(Trx)-CO -(CH2)i8-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)(Trx)-(7-Glu)-CO-(CH2)i8-CO2H, K(2 -[2-(2-amino-ethoxy)-ethoxy]-acetyl)-(sK)-(y-Glu)-CO(CH2)i8-CO2H, K(2-[2-(2-amino-ethoxy) -ethoxy]-acetyl)-(8K)-(sK)-CO-(CH2)i8-CO2H, K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu) 2-CO-(CH2)i8-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-CO-(CH2)i8-CO2H, K(2-[2-(2 -amino-ethoxy)-ethoxy]-acetyl)2-(sK)-CO-(CH2)i6-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(sK )- CO-(CH2)i4-CO2H and KDab-(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)-Dab-(2-[2-(2-amino-ethoxy)-ethoxy]- acetyl)-CO-(CH2)i8-CO2H. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is selected from the group consisting of K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl) 2-(y Glu)-CO-(CH2)i6-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(7 Glu)-CO-(CH2)is-CO2H , K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y Glu)-CO(CH2)i4-CO2H and K(2-[2-(2-amino-ethoxy) -ethoxy]-acetyl)2-CO-(CH2) 18-CO2H. FR / nnn / Lznz / e / YiAi Χ-21852 -6Εη one embodiment, is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is selected from the group consisting of K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl )2-(Y Glu)-CO-(CH2)i6-CO2H, K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y Glu)-CO-(CH2)i8- CO2H and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y Glu)-CO(CH2)14-CO2H. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is selected from the group consisting of K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl) 2-(Y Glu)-CO-(CH2)i8-CO2H and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y Glu)-CO-(CH2)16-CO2H . In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)a-(Y-Glu )b-CO-(CH2)q-CO2H, where a is 2, b is 1, and q is selected from the group consisting of 18 and 20. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt of this, where X14 or X17 is K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)a-(YGlu)b-CO-(CH2)q-CO2H, where a is 2, b is 1 and q is 18. In one embodiment, is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein X14 or X17 is K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) a-(Y-Glu)b-CO-(CH2)q-CO2H, where a is 2, b is 1, and q is 20. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein Xi and X2 do not combine to form desH-v[NHCO]-Aib (hereinafter, a compound of Formula II). In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein: X17 is a C16-C22 fatty acid conjugated amino acid wherein said fatty acid is optionally conjugated to said amino acid via a linker; and X30 is selected from the group consisting of G-R2 and G; where if X30 is G, then X31 is selected from the group consisting of PX32X33X34R2(SEQ ID NO:4), where X32 is S, X33 is S, and X34 is G (SEQ ID NO:297), and PX32X33X34X35X36X37X38X39-R2 ( SEQ ID NO:5), where X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, and X39 is S (SEQ ID NO:298) (hereinafter, a compound of Formula III). In one embodiment, it is a compound of Formula III, or a pharmaceutically acceptable salt thereof, wherein the amino acid Xr? it is conjugated to the fatty acid through a linker (hereinafter, a "Formula Illa" compound). Χ-21852 -7pR / nnn / Lznz / e / YiAi Εη an embodiment, is a compound of Formula III and Illa, or a pharmaceutically acceptable salt thereof, wherein: Xio is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, E, aMeF, aMeF(2F), I, aMeY, Q, D-His, D-Tyr, and cTA; X12 is selected from the group consisting of I, S, and D-Ile; X13 is selected from the group consisting of Nle, Aib, L, and aMeL; X14 is selected from the group consisting of L and K; X16 is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK, and R; Xi9 is selected from the group consisting of Q, and A; X20 is selected from the group consisting of Aib, Q, H, R, K, and aMeK; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E, and I; X23 is selected from the group consisting of I, L, A, G, F, Η, E, and V; X24 is selected from the group consisting of S, Aad, D-Glu, E, Aib, Η, V, A, Q, D, and P; X26 is selected from the group consisting of L and aMeL, X27 is selected from the group consisting of L and I; X28 is selected from the group consisting of E, A, S, and D-Glu; X29 is selected from the group consisting of Aib, G, and A; X30 is selected from the group consisting of G and G-R2; where if X30 is G; then X31 is selected from the group consisting of PX32X33X34R2(SEQ ID NO:4), where X32 is S, X33 is S, and X34 is G (SEQ ID NO:297) and PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), wherein X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, and X39 is S (SEQ ID NO:298) (hereinafter, a compound of "Formula Illb ”). In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein the linker comprises 1 to 2 amino acids, and in a further embodiment of these particular compounds of Formula III, Illa and Illb are those where the linker amino acids are independently selected from the group consisting of Glu and γ-Glu. In another embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein the linker comprises one or two (2-[2(2-amino-ethoxy)-ethoxy]-acetyl) moieties. and in a further embodiment of these compounds of formula III, Illa and Illb in particular, are those in which the linker is (2-[2-(2-amino-ethoxy)-ethoxy]Χ-21852 -8FR / nnn / Lznz / e / YiAi acetyl)a-(y-Glu)b, wherein a is selected from the group consisting of 1 or 2; and b is selected from the group consisting of 1 or 2. In one embodiment, it is a compound of Formula III, or a pharmaceutically acceptable salt thereof, wherein Xn is an amino acid conjugated to a Ci6C22 fatty acid, wherein the amino acid is K, and wherein said fatty acid is optionally conjugated to said amino acid. through a linker. In one embodiment, it is a compound of Formula III, or a pharmaceutically acceptable salt thereof, wherein: Ri is absent; Xi and X2 do not combine to form desH-v[NHCO]-Aib; X17 is K conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker. In one embodiment, it is a compound of Formula III, or a pharmaceutically acceptable salt thereof, wherein: Xi is Y; X2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, and Y; X11 is S; X12 is I; X14 is L; X16 is selected from the group consisting of K, E, Orn, Dab and Dap; Xn is K conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker: X19 is Q; X20 is Aib; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, and E; X22 is F; X23 is I; X24 is selected from the group consisting of S, Aad, D-Glu, and E; X26 is L; and X28 is selected from the group consisting of E and A. Χ-21852 -9pR / nnn / Lznz / e / YiAi Εη an embodiment, is a compound of Formula III, or a pharmaceutically acceptable salt thereof, wherein: Xi is Y: X? it is Aib; X3 is E; X6 is aMeF(2F); Xto is selected from the group consisting of Y, 4-Pal, and V; Xn is S; XÍ2 is I; Xt3 is selected from the group consisting of L, Aib, and aMeL; X14 is L; X16 is selected from the group consisting of E, K, and Orn; Xj7 is K conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker; Xi9 is Q; X20 is Aib; X21 is selected from the group consisting of E, A, and T; X22 is F; X23 is I; X24 is D-Glu; X25 is selected from the group consisting of Y and aMeY; X26 is L; X27 is I; X28 is E; X29 is G; X30 is G; and X3! is PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), where X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, X39 is S (SEQ ID NO:298). In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein R2 is absent. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein R2 is NH2. Χ-21852 -10pR / nnn / Lznz / e / YiAi Εη one embodiment is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein X13 is aMeL. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein X25 is Y and Xj3 is aMeL. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein X17 is K conjugated to a fatty acid via a linker to the epsilon-amino group of the K side chain in where said fatty acid and the linker have the following formula: (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)a- (y-Glu)b-CO-(CH2)q-CO2H, in where a is 1 or 2; b is 1 or 2; and q is selected from the group consisting of 14 to 20. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Xi6 is Om, X13 is aMeL, and X25 is Y. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Xi6 is E, X13 is aMeL, and X25 is Y. In one embodiment, is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, in where Xió is E, X13 is aMeL, X10 is Y and X25 is aMeY. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Xi6 is Om, X13 is aMeL, X10 is 4Pal, and X25 is Y. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Χιβ is Orn, X13 is aMeL, X10 is V, and X25 is Y. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Xi6 is E, X13 is aMeL, X25 is Y, and X17 is K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)a-(7-Glu)b -CO-(CH2)q-CO2H, where a is 2; b is 1; and q is selected from the group consisting of 14 to 20. In one embodiment, it is a compound of Formula III, Illa and Illb, or a pharmaceutically acceptable salt thereof, wherein Xio is E, Χ13 is aMeL, X10 is Y, and Χ25 is Y and X17 is K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)a-(7-Glu)b-CO-(CH2)q-CO2H, where a is 2; b is 1; and q is selected from the group consisting of 16 to 20. In one embodiment, it is a compound of Formula I selected from the group consisting of SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14, or an acceptable salt pharmaceutically of this. In one embodiment, it is a compound of Formula I which is SEQ ID NO: 10, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO: 11, or a pharmaceutically acceptable salt thereof. In one embodiment, a compound of Formula I that is SEQ ID NO: 12, or a salt FR / nnn / Lznz / e / YiAi Χ-21852 -11pharmaceutically acceptable of this. In one embodiment, a compound of Formula I which is SEQ ID NO: 13, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO: 14, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein Xi is selected from the group consisting of Y, F, and D-Tyr; Xó is F; and X13 is selected from the group consisting of Aib, L, and aMeL. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein Ri is absent; Xi is selected from the group consisting of Y, F, and D-Tyr; Xó is F; X13 is selected from the group consisting of Aib, L, and aMeL; X2 is Aib; X3 is E; X10 is Y; Xn is S; X12 is I; X14 is L; Χιβ is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK, and R; X17 is an amino acid conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker; X19 is Q; X20 is selected from the group consisting of Aib, Q, H, and K; X21 is selected from the group consisting of H, D, T, A, and E; X22 is F; X23 is I; X24 is selected from the group consisting of D-Glu and E; X26 is L; X27 is I; X28 is selected from the group consisting of E, A, S, and D-Glu; X29 is selected from the group consisting of Aib, G, and A; X30 is selected from the group consisting of C, G, and G-R2; X31 is absent or selected from the group consisting of PX32X33X34-R2 (SEQ ID NO:4), PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), and PX32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:6); where: X32 is S; X33 is S; X34 is selected from the group consisting of G and C; X35 is A; X36 is P; X37 is P; X38 is P; X39 is selected from the group consisting of C and S; and X40 is C. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein Xi is selected from the group consisting of Y, F, and DTyr; Xó is F; and X13 is selected from the group consisting of Aib, L, and aMeL; X28 is A; X29 is G; X30 is G; X31 is PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5); X34 is G; and X39 is S. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein Xi is selected from the group consisting of Y and D-Tyr; and X13 is aMeL. In one embodiment, it is a compound of Formula I selected from the group consisting of SEQ ID NO:303, SEQ ID NO:304, SEQ ID NO:305, SEQ ID NO:306, SEQ ID NO:307, and SEQ ID NO: 308, or a pharmaceutically acceptable salt thereof. In a Χ-21852 -12pR / nnn / Lznz / e / YiAi modality, is a compound of Formula I which is SEQ ID NO:303, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO:304, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO:305, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO:306, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO:307, or a pharmaceutically acceptable salt thereof. In one embodiment it is a compound of Formula I which is SEQ ID NO:308, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I which is SEQ ID NO:386, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein: Xio is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, aMeF, aMeF(2F), I, aMeY, Q, D-His, E, cTA, and D-Tyr; X12 is selected from the group consisting of I, D-Ile, and S; X13 is selected from the group consisting of Nle, Aib, L, and aMeL; X14 is L; X16 is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK, and R; X17 is selected from the group consisting of K, Q, and I; Xí9 is selected from the group consisting of Q and A; X20 is selected from the group consisting of Aib, Q, H, R, K, and oMeK; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E, and I; X23 is selected from the group consisting of I, L, A, G, F, Η, E, and V; X24 is selected from the group consisting of S, Aad, D-Glu, E, Aib, Η, V, A, Q, D, and P; X26 is selected from the group consisting of L and aMeL; X27 is selected from the group consisting of L and I; X28 is selected from the group consisting of E, A, S, and D-Glu; and X29 is selected from the group consisting of Aib, G, and A (hereinafter, a compound of "Formula IV"). Χ-21852 -13FR / nnn / Lznz / e / YiAi Εη one embodiment, is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein X39 is C. In one embodiment, is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein X40 is C. In one embodiment, it is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein one, and only one, of X30, X34, X39, and X40 is C. In one embodiment, it is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein one, and only one, of X30, X34, X39, and X40 is C modified using time extension technology. In one embodiment, it is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein C is modified using time extension technology wherein the time extension technology is XTEN. In one embodiment, it is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein C is modified through the use of time extension technology wherein the time extension technology is a biotin (Glu)men where m is 0, 1, 2, or 3. In one embodiment, is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein: Xi is Y; X2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, and Y; X11 is S; X12 is I; X16 is selected from the group consisting of K, E, Orn, Dab and Dap; X19 is Q; X20 is selected from the group consisting of Aib and K; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, and E; X22 is F; X23 is I; X24 is selected from the group consisting of S, Aad, D-Glu, and E; X26 is L; and X28 is selected from the group consisting of E and A; or a pharmaceutically acceptable salt thereof. In one embodiment, it is a compound of Formula IV, or a pharmaceutically acceptable salt thereof, wherein Χ-21852 -14FR / nnn / Lznz / e / YiAi Χι is Y; Χ2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, and Y; X11 is S; X12 is I; X16 is selected from the group consisting of K, E, Orn, Dab and Dap; X20 is Aib; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, and E; X22 is F; X24 is selected from the group consisting of S, Aad, D-Glu, and E; X27 is I; and X28 is selected from the group consisting of E and A. In one embodiment, it is a compound of Formula I, or a pharmaceutical salt thereof, wherein: X14 is L; X17 is selected from the group consisting of K, Q, and I; X30 is selected from the group consisting of G-R2 and G; and q is selected from the group consisting of 16, 18 and 20; where if X30 is G, then X31 is selected from the group consisting of: PX32X33X34-R2 (SEQ ID NO:4), wherein: X32 is S, X33 is S, X34 is G, and R2 is absent (SEQ ID NO:299) or X32 is S, X33 is S, X34 is G, and R2 is NH2 (SEQ ID NO:300); and PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), where: X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, X39 is S, and R2 is absent (SEQ ID NO:301) or X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, X39 is S, and R2 is NH2(SEQ ID NO:302); and where one of Χίο, X12, X13, X14, X16, X19, X20, X21, X23, X24, X26, X27, X28, and X29 is K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-YGlu-CO-(CH2)qCO2H (hereinafter, a compound of "Formula V"). pR / nnn / Lznz / e / YiAi Χ-21852 -15Εη an embodiment, is a compound of Formula V, or a pharmaceutically acceptable salt thereof, wherein: Xi is Y; X2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, E, cTA, and K(2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-yGlu-CO -(CH2)qCO2H; X11 is S; X12 is selected from the group consisting of I, D-Ile, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-yGlu-CO-(CH2)qCO2H; X16 is selected from the group consisting of K, E, Om, Dab, Dap, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-yGlu-CO-(CH2)qCO2H; X17 is selected from the group consisting of K and I; X19 is selected from the group consisting of Q and K(2-[2-(2-amino-ctoxy)-ctoxy]-acctyl)2yGlu-CO-(CH2)qCO2H; X20 is selected from the group consisting of Aib and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-yGlu-CO-(CH2)qCO2H; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-yGlu-CO-(CH2)qCO2H ; X22 is F; X24 is selected from the group consisting of S, Aad, D-Glu, E, and K(2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-yGlu-CO-(CH2)qCO2H; X26 is selected from the group consisting of L and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2yGlu-CO-(CH2)qCO2H; X27 is selected from the group consisting of L and I; and X2s is selected from the group consisting of E, A, and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-yGlu-CO-(CH2)qCO2H. In one embodiment, it is a compound of Formula V, or a pharmaceutically acceptable salt thereof, wherein X20 is K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-yGlu-CO(CH2 )qCO2H, wherein q is 16 or 18. In one embodiment, is a compound of Formula V, or a pharmaceutically acceptable salt thereof, wherein X31 is SEQ ID NO:301 or SEQ ID NO:302. Χ-21852 -16FR / nnn / Lznz / e / YiAi One modality provides a method for treating a condition selected from the group consisting of T2DM, obesity, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), dyslipidemia, and metabolic syndrome, comprising administering to a subject that As needed, an effective amount of a compound of Formula I or a pharmaceutically acceptable salt thereof. One embodiment provides a method of providing therapeutic weight loss comprising administering to a subject in need thereof, an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In one embodiment, the condition is NAFLD. In one embodiment, the condition is NASH. One embodiment provides a compound of Formula I, or a pharmaceutically acceptable salt thereof, for use in therapy. One embodiment provides a compound of Formula I, or a pharmaceutically acceptable salt thereof, for use in therapy to treat a condition selected from the group consisting of T2DM, obesity, NAFLD, NASH, dyslipidemia, and metabolic syndrome. In one embodiment, the condition is DMT2. In one embodiment, the condition is obesity. In one embodiment, the condition is NAFLD. In one embodiment, the condition is NASH. In one embodiment, the condition is metabolic syndrome. The compounds of Formula I, or a pharmaceutically acceptable salt thereof, may be useful in the treatment of a variety of symptoms or disorders. For example, certain embodiments provide a method of treating T2DM in a patient comprising administering to a subject in need of such treatment an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In one embodiment, it is a method of treating obesity in a patient comprising administering to a subject in need of such treatment an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In one embodiment, the method is inducing non-therapeutic weight loss in a subject, comprising administering to a subject in need of such treatment an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In certain embodiments, the present invention provides a method for treating metabolic syndrome in a patient comprising administering to a subject in need of such treatment an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. In one embodiment, the method is treating the Χ-21852 -17FR / nnn / Lznz / e / YiAi NASH comprising administering to a subject in need of such treatment an effective amount of a compound of Formula I, or a pharmaceutically acceptable salt thereof. Furthermore, provided herein is a compound of the present invention for use in simultaneous, separate, and sequential combinations with one or more agents selected from metformin, a thiazolidinedione, a sulfonylurea, a dipeptidyl peptidase 4 inhibitor, a glucose and sodium, an inhibitor of SGLT-2, a modulator of growth differentiation factor 15 (GDF15). a peptide tyrosine (PYY) modulator, a modified insulin, amylin, a calcitonin receptor and amylin receptor dual agonist, and an oxyntomodulin (OXM) agonist in the treatment of a condition selected from the group consisting of T2DM, obesity , NAFLD, NASH, dyslipidemia and metabolic syndrome. In one embodiment, a compound of the present invention is provided in a fixed-dose combination with one or more agents selected from metformin, a thiazolidinedione, a sulfonylurea, a dipeptidyl peptidase 4 inhibitor, a sodium glucose cotransporter, a of SGLT-2, GDF15, PYY, a modified insulin, amylin, a dual agonist of the calcitonin receptor and the amylin receptor, and OXM. In one embodiment, it is a compound of the present invention for use in simultaneous, separate, and sequential combinations with one or more agents selected from metformin, a thiazolidinedione, a sulfonylurea, a dipeptidyl peptidase 4 inhibitor, a glucose co-transporter and sodium, an inhibitor of SGLT-2, GDF15, PYY, a modified insulin, amylin, a calcitonin receptor and amylin receptor dual agonist, and OXM in the treatment of a condition selected from the group consisting of T2DM and obesity. In one embodiment, it is a compound of the present invention for use in simultaneous, separate, and sequential combinations with one or more agents selected from metformin, a thiazolidinedione, a sulfonylurea, a dipeptidyl peptidase 4 inhibitor, a glucose cotransporter, and sodium and an SGLT-2 inhibitor in the treatment of a condition selected from the group consisting of T2DM and obesity. In other embodiments, the compounds, or a pharmaceutically acceptable salt thereof, may be useful for improving bone strength in subjects in need thereof. The compounds of the present invention, or a pharmaceutically acceptable salt thereof, may be useful in the treatment of other disorders such as Parkinson's disease or Alzheimer's disease. Incretins and incretin analogs that have activity at one or more of the GIP, GLP-1, and / or glucagon receptors have been reported to have the potential to be of value. Χ-21852 -18pR / nnn / Lznz / e / YiAi therapeutic in a number of other diseases or conditions, including, for example, obesity, NAFLD and NASH, dyslipidemia, metabolic syndrome, bone-related disorders, Alzheimer's disease, and Parkinson. See, eg, Jall S., et al., Monomeric GLP-1 / GIP / glucagon triagonism corrects obesity, hepatosteatosis, and dyslipidemia in female mice, MOL. METAB. 6(5):440-446 (March 2017); Carbone L.J., et al., Incretin-based therapies for the treatment of non-alcoholic fatty liver disease: A systematic review and meta-analysis. J. Gastroenterol. Hepatol., 31(1):23-31 (2016 Jan); B. Finan, et al., Reappraisal of GIP Pharmacology for Metabolic Diseases. TRENDS Mol. Med., 22(5):359-76 (May 2016); Choi, I.Y., et al., Potent body weight loss and efficacy in a NASH animal model by a novel long-acting GLP-l / Glucagon / GIP triple-agonist (HM15211), ADA 2017 Poster 1139-P; Ding, K.H., Impact of glucose-dependent insulinotropic peptide on age-induced bone loss, J. BONE MINER. Res., 23(4):536-43 (2008); Tai, J. et al., Neuroprotective effects of a triple GLP-l / GIP / glucagon receptor agonist in the APP / PS1 transgenic mouse model of Alzheimer ’s disease, Brain Res. 1678, 64-74 (2018); T.D. Müllcr et al., The New Biology and Pharmacology of Glucagon, PHYSIOL. Rev 97: 721-766 (2017); Finan, B. et al., Unimolecular Dual Incretins Maximize Metabolic Benefits in Rodents, Monkeys, and Humans, SCI. transfer Med., 5:209 (Oct 2013); Hólscher C, Insulin, incretins and other growth factors as potential novel treatments for Alzheimer's and Parkinson's diseases. BlOCHEM. SOC. TRANS. 42(2):593-0 (April 2014). Another embodiment provides for the use of a compound of the present invention, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for the treatment of a condition selected from the group consisting of T2DM, obesity, NAFLD, NASH, dyslipidemia, and syndrome. metabolic. In one embodiment, the medicament is for the treatment of T2DM. In one embodiment, the medicament is for the treatment of obesity. In one embodiment, the medicament is for the treatment of NAFLD. In one embodiment, the medicament is for the treatment of NASH. Another embodiment provides a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and at least one selected from the group consisting of a carrier, diluent, and excipient. In one embodiment, it is a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, at least one permeation enhancer, and at least one protease inhibitor. In one modality, it is a composition Χ-21852 -19FR / nnn / Lznz / e / YiAi pharmaceutical comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, at least one permeation enhancer, and at least one selected from the group consisting of carrier, diluent, and excipient . In one embodiment, it is a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, a permeation enhancer, a protease inhibitor, and at least one selected from the group consisting of carrier, diluent, and excipient. In one embodiment, it is a pharmaceutical composition comprising a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a permeation enhancer. In one embodiment, it is a pharmaceutical composition comprising a compound of the present invention, or a pharmaceutically acceptable salt thereof, and a permeation enhancer. In one embodiment, the permeation enhancer is selected from the group consisting of sodium decanoate (CIO), sodium taurodeoxycholate (NaTDC), lauroyl carnitine (LC), dodecyl maltoside (C12 maltoside), dodecylphosphatidylcholine (DPC), N Sodium -[8-(2-hydroxybcnzoyl)amino]caprylate (SNAC) and a rhamnolipid. In one embodiment, the permeation enhancer is selected from the group consisting of CIO and LC. In one embodiment, a protease inhibitor is selected from the group consisting of soybean trypsin inhibitor (SBTI), soybean trypsin-chymotrypsin inhibitor ("SBTCI"), ecotin, sunflower trypsin inhibitor (SFTI), leupeptin, citric acid, ethylenediaminetetraacetic acid CEDTA), sodium glycocholate, and 4-(2-aminoethyl)benzenesulfonyl fluoride hydrochloride (AEBSF”). In one embodiment, a protease inhibitor is selected from the group consisting of SBTI, SBTCI, and SFTI. In one embodiment, a protease inhibitor is SBTI. As used herein, the term "treatment" or "treating" includes restricting, slowing, stopping, or reversing the progression or severity of a symptom, condition, or disorder. Certain compounds of the present invention are generally effective over a wide dosage range. For example, doses for once weekly parenteral administration may be within the range of 0.05 mg to about 30 mg per person per week. The compounds of the present invention include novel amino acid sequences that have affinity for the respective GLP-1 and GIP receptors, with the desired potency at each of these receptors. GLP-1 is a 36 amino acid peptide, whose FR / nnn / Lznz / e / YiAi Χ-21852 The major biologically active fragment occurs as a 30 amino acid C-terminal amidated peptide (GLP-I7-36) (SEQ ID NO:2). GIP is a 42 amino acid peptide (SEQ ID NO:1), which, like GLP-1, is also known as an incretin, and plays a physiological role in glucose homeostasis by stimulating insulin secretion from cells. pancreatic beta cells in the presence of glucose. The compounds provide the desired potency at each of the GIP and GLP-1 receptors. In one embodiment, the compounds are suitable for oral administration. In one embodiment, the compounds have a convenient long action time on the GIP and GLP receptor. In one embodiment, the compounds have convenient GIP and GLP receptor activity wherein the potency of the GIP agonist is 2.5 to 5 times the potency of the GLP1 receptor as measured by the casein cAMP assay described. in the present disclosure below, where potency is normalized against native GIP and GLP on the day the assay is run. In one embodiment, the compounds have convenient activity on the GIP and GLP receptor where the potency of the GIP agonist is 2.5 to 10 times the potency of the GLP1 receptor as measured by the casein cAMP assay, where potency is normalized against native GIP and GLP on the day the assay is performed. As used in the present description, the term "amino acid" means both the natural amino acids and the non-natural amino acids. Amino acid sequences are typically represented by using standard one-letter codes (for example, L = leucine), as well as naturally occurring amino acid substituted alpha-methyl residues (for example, α-methyl leucine or aMeL and α-methyl lysine or aMeK), and certain other unnatural amino acids, such as alpha-aminoisobutyric acid or "Aib," "4Pal," "Orn" and the like. The structures of these amino acids appear below: Χ-21852 -21αΜ=ί FR / nnn / Lznz / e / γΐΛΐ Χ-21852 -22desHis-Ab cesH- ^NHCO]-Aib c^sY amep pR / nnn / Lznz / e / YiAi As used herein, Orn means omit. As used herein, 4Pal means 3-4-pyridyl)-L-alanine. As used herein, aMeF(2F) means alpha-methyl 2-F-phenylalanine. As used herein, aMeY, aMeK, and aMeL mean alpha methyl tyrosine, alpha methyl lysine, and alpha methyl leucine, respectively. As used herein, "e" and "D-Glu" mean D-glutamic acid. As used herein, D-His and h" mean D-histidine. As used herein, D-Tyr and y mean D-tyrosine. As used herein, D-Ser and s mean D-serine. As used herein, D-Ala" and a mean D-alanine. As used herein, aMeF(2F) means alpha-methyl-F(2F) and alphamethyl-Phe(2F). As used herein, aMeF means alpha-methyl-F and alpha-methyl-Phe. As used herein, aMeY means alpha-methyl-Tyr. As used herein, aMeK means alpha-methyl-Lys. As used herein, aMeL means alpha-methylLeu. As used herein, aMeS means alpha-methyl-serine and alpha-methyl-Ser. As used herein, "aMeP" means alpha-methyl-proline and alpha-methyl-Pro. As used herein, "desH" means desHis. As used herein, "desY" means desTyr. When Xi is DesH and X2 is Aib, and the Desh and Aib can be combined to form a group as illustrated above, Desh—ψ[ NHCO]-Aib. When used herein, the term "C16-C22 fatty acid conjugated amino acid" refers to any natural or unnatural amino acid with a functional group that has been chemically modified to be conjugated to a fatty acid by means of Χ-21852 -23FR / nnn / Lznz / e / YiAi a covalent bond to the fatty acid or, preferably, via a linker. Examples of such functional groups include amino, carboxyl, chloro, bromo, iodo, azido, alkynyl, alkenyl, and thiol groups. Examples of naturally occurring amino acids that include such functional groups include K (amino), C (thiol), E (carboxyl), and D (carboxyl). In one embodiment, the conjugated amino acid is K. As indicated above, in one embodiment a compound of Formula I, II, III, IV, and V are compounds of the present invention wherein a fatty acid moiety is conjugated through a linker or direct bond. In one embodiment, the compounds of the present invention include a fatty acid moiety conjugated, preferably via a linker, to a K at position 14 or 17. In one embodiment, the conjugation is an acylation. In one embodiment, the conjugation is to the epsilon-amino group of the side chain of K. In one embodiment of the compounds of the present invention, a fatty acid moiety conjugated, through a linker, to a K is included in the position 17. In one embodiment, the compounds of the present invention include a fatty acid moiety conjugated directly, without a linker, to a natural or non-natural amino acid with a functional group available for conjugation. In certain preferred embodiments, the conjugated amino acid is selected from the group consisting of K, C, E, and D. In particularly preferred embodiments, the conjugated amino acid is K. In such embodiments, the conjugation is to the epsilon-amino group of the side chain. from K. In one embodiment, the linker comprises one to four amino acids, an amino polyethylene glycol cai'boxylate, or mixtures thereof. In one embodiment, amino polyethylene glycol carboxylate has the following formula: H-{NH-CH2-CH2-[O-CH2-CH2]p-O-(CH2)z-CO}r-OH, where p is any integer from 1 to 12, z is any integer from 1 to 20 , and r is 1 or 2. In one embodiment, it is a compound of Formula I comprising an amino acid conjugated to a fatty acid through a linker, wherein the linker is one to two amino acids selected from the group consisting of Glu and γ-Glu. In one embodiment, the linker is one or two (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) moieties. The compounds of the present invention use a C16-C22 fatty acid chemically conjugated to the functional group of an amino acid, either through a direct bond or through a linker. In one embodiment, the fatty acid moiety is conjugated to a lysine at position 17 via a linker between the lysine and the fatty acid. In one embodiment, the fatty acid moiety is conjugated Χ-21852 -24FR / nnn / Lznz / e / YiAi with a lysine at position 20 via a linker between the lysine and the fatty acid. In one embodiment, the fatty acid chain is any single C16-C22 fatty acid chain. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the fatty acid is conjugated to a linker, and the linker comprises one or more (2-[2-(2-amino-ethoxy )-ethoxy]-acetyl), in combination with zero or one to four amino acids. In one embodiment, the linker may comprise one to four Glu or γ-Glu amino acid residues. In one embodiment, the linker may comprise 1 or 2 Glu or γ-Glu amino acid residues. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, comprising a fatty acid conjugated through a linker wherein the linker comprises 1 or 2 γ-Glu amino acid residues. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt, comprising a fatty acid conjugated through a linker, wherein the linker may comprise one to four amino acid residues (such as, for example, amino acids Glu and x-Glu) used in combination with up to 36 residues (2-[2-(2-amino-ctoxy)-ctoxy]-acctyl). Specifically, in one embodiment it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, comprising a fatty acid conjugated through a linker wherein the linker constitutes combinations of one to four amino acids Glu and x-Glu and one to four moieties (2-[2(2-amino-ethoxy)-ethoxy]-acetyl). In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, comprising a fatty acid conjugated through a linker wherein the linker comprises combinations of one or two γ-Glu amino acids and one or two ( 2-[2-(2-amino-ethoxy)-ethoxy]-acetyl). In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, comprising a fatty acid conjugated through a linker wherein the linker and fatty acid components have the following formula: (2-[2-(2-Amino-ethoxy)-ethoxy]-acetyl)a-(Y-Glu)b-CO-(CH2)q-CO2H, where a is 1 or 2, b is 1 or 2 , and c is 16 or 18. In one embodiment, a is 2, b is 1, and q is 18; and the structure is: In one embodiment, a is 1, b is 2, and q is 18; and the structure is: Χ-21852 -25FR / nnn / Lznz / e / YiAi Εη a modality, a is 1, b is 1 and q is 18; and the structure is: As used herein, the term "C16-C22 fatty acid" means a carboxylic acid having between 16 and 22 carbon atoms. In one embodiment, the C1oC22 fatty acid suitable for use herein may be a saturated diacid. In one embodiment, the fatty acid is C2o-C22. In one mode, q is selected from the group consisting of 14, 16, 18, and 20. In one mode, q is selected from 18 to 20. In one mode, q is 18. In one mode, q is 20. In one embodiment, specific C16-C22 saturated fatty acids that are suitable for the compounds and uses thereof described herein include, but are not limited to, hexadecanedioc acid (Cio diacid), heptadecanedioc acid (C17 diacid), octadecanedioic (Cis diacid), nonadecanedioic (C19 diacid), eicosanedioic (C20 diacid), heneicosanedioic (C21 diacid), docosanedioic (C22 diacid), including branched and substituted derivatives thereof. In one embodiment, the C16-C22 fatty acid is selected from the group consisting of a Cis saturated diacid, a C19 saturated diacid, a C20 saturated diacid, and branched and substituted derivatives thereof. In one embodiment, the C16-C22 fatty acid is selected from the group consisting of stearic acid, arachidic acid, and eicosanedioic acid. In one embodiment, the C16-C22 fatty acid is arachidic acid. As shown in the chemical structures of Examples 1-5 below, in one embodiment the fatty acid-linker moieties described above are attached to the epsilonamino group of the Usin side chain. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein none of X30, X31, X32, X33, X34, X35, X36, X37, X38, X39, and X40 is C or is a pR / nnn / Lznz / e / YiAi Χ-21852 -26 substituent containing a fatty acid. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein none of Χίο, X12, X13, X14, X16, X17, X19, X20, X21, X23, X24, X26, X27, X28 , X29, X30, X31, X32, X33, X34, X35, X36, X37, X38, X39, and X40 is a fatty acid-containing substituent; and none of X30, X34, X39 and X40 is C. In one embodiment, is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein none of Χίο, X12, X13, X14, X16, X17, X19, X20, X21, X23, X24, X26, X27, X28, X29, X30, X31.X32, X33, X34, X35, X36, X37, X38, X39, and X40 is a fatty acid-containing substituent. As used herein, time extension technology means a peptide time extension technology, eg, recombinant human serum albumin (rHSA), conjugation of the peptide with a pharmaceutically acceptable polymer, such as the polymeric amino acid sequence ( XTEN), non-sulfated heparin-like carbohydrate polymer (HEP), hydroxyethyl starch (HES), llama heavy chain (VHH) antibody fragments, pegylation, Fe-conjugation, bovine serum albumin (BSA) (Slccp, D. Epert Opin Drug Del (2015) 12, 793-812 Podust VN et al J Control Release 2015 ePUB Hey T et al in: R Kontermann (Ed.), Therapeutic Proteins: Strategies to Modulate their Plasma Half -Lives, Wiley-VCH Verlag Gmbh & Co. KGaA, Weinheim, Germany, 2012, ppl 17-140 DeAngelis, PL, Drug Dev Delivery (2013) Jan 12 / 31 / 2012 In one modality, outreach technology time extension technology is applied through the use of a linker group.In one embodiment, time extension technology is applied through the use of 0, 1, 2, or 3 amino acids as linkers. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid (i.e., a compound where none of Χίο, X12, X13, X14, Xio, X17, X19, X20, X21, X23, X24, X26, X27, X28, X29, X30, X31, X32, X33, X34, X35, X36, X37, X38, X39, and X40 is a substituent containing a fatty acid) or time extension technology it can be administered to a patient in need thereof via transdermal or infusion delivery methods. In addition, a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, can be further modified using a peptide time extension technology, eg, recombinant human serum albumin (rHSA) conjugation. of the peptide with a pharmaceutically acceptable polymer, such as amino acid sequence polymer (XTEN), non-sulfated heparin-like carbohydrate polymer (HEP), and hydroxyethyl starch (HES). In one embodiment, a time extension technology is applied by using a pR / nnn / Lznz / e / YiAi Χ-21852 -27 amino acid cisternae in a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, using procedures known to those skilled in the art. In one embodiment, a time extension technology is applied to an amino acid in a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid. In one embodiment, where a time extension technology is applied to a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, X17 is selected from the group consisting of I, K, and Q. In one embodiment, embodiment where a time extension technology is applied to a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, X30 is C. In an embodiment where a time extension technology is applied to a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, X34 is C. In one embodiment where a time extension technology is applied to a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, X39 is C. In one embodiment where a time extension technology is applied to a compound of Formula I, or a pharmaceutically acceptable salt thereof, without a fatty acid, X40 is C. When used herein in reference to one or more of the GIP or GLP-1 receptors, the terms "activity, activating(s)", activator and the like refer to the ability of a compound, or a salt pharmaceutically acceptable thereof, to bind to and induce a response in the recipient(s), as measured using assays known in the art, such as the in vitro assays described below. The affinity of the compounds, or a pharmaceutically acceptable salt thereof, of the present invention for each of the GIP and GLP-1 receptors can be measured using techniques known for measuring receptor binding levels in the art, this includes, for example, those described in the examples below, and is commonly expressed as a Ki value. The activity of the compounds of the present invention at each of the receptors can further be measured using techniques known in the art, including, for example, the in vitro activity assays described below, and is expressed commonly as an EC50 value, which is the concentration of the compound that causes the mean maximal stimulation in a dose-response curve. In one embodiment, a pharmaceutical composition of a compound of Formula I is suitable for administration by a parenteral route (eg, subcutaneous, intravenous, intraperitoneal, intramuscular, or transdermal). In a modality, a composition Χ-21852 -28pR / nnn / Lznz / e / YiAi pharmaceutical of a compound of Formula I is suitable, for oral administration (eg tablet, capsule). Some pharmaceutical compositions and processes for preparing them are well known in the art. (See, for example, Remington: The Science and Practice of Pharmacy (Troy, id., 21st ed., Lippincott, Williams & Wilkins, 2006). The physicochemical properties of a peptide in addition to the anatomical and physiological characteristics of the gastrointestinal tract can provide challenges to efficient oral administration of a peptide In one embodiment, a pharmaceutical composition for oral administration comprises a compound of this invention, and a permeation enhancer In one embodiment, a pharmaceutical composition for oral administration comprises a compound of Formula I or a pharmaceutically acceptable salt thereof, a permeation enhancer, and a protease inhibitor In one embodiment, a pharmaceutical composition for oral administration comprises a compound of Formula I, or a pharmaceutically acceptable salt thereof, and a permeation enhancer. Monolithic and multiparticulate dosage forms are contemplated for the compounds of the present invention. In one embodiment, a compound of Formula I is provided as a monolithic composition. A monolithic composition is intended for the release of all components at a single location. A multiparticle composition is intended to achieve rapid transit from the stomach to the intestine and allow distribution of the components of the composition over a large surface area of ​​the small intestine. Concurrent release of a compound and functional excipients is desired for monolithic and multiparticulate dosage compositions. In one embodiment, a monolithic composition of a compound of Formula I, or a pharmaceutically acceptable salt thereof, is formulated as an enteric capsule, enteric-coated capsule, or enteric-coated tablet. Such a multi-particle composition can be formulated as enteric-coated mini-tablets, or enteric-coated granules where the coating is generally intact in the stomach at low pH and dissolves in the higher pH of the intestine. Two types of coated mini-tablets or coated granules can be formulated for administration to the proximal small intestine by dissolution above pH 5.5 or to the distal small intestine by dissolution above pH 7-7.2. In addition, a coating system for distal small intestinal release may be applied to capsules or monolithic tablets if a FR / nnn / Lznz / e / YiAi Χ-21852 -29supply in the distal small intestine. The mini-tablets can be filled into a standard uncoated capsule. As used herein, the term "permeation enhancer" means a permeation enhancer that improves the oral absorption of a compound of this invention. As used herein, "permeation enhancer" means permeation enhancers, such as sodium decanoate, sodium taurodeoxycholate, lauroyl carnitine, dodecyl maltoside, dodecylphosphatidylcholine, SNAC, a rhamnolipid, and permeation enhancers reported in the literature, such such as phosphatase permeability inhibitors, PIP-250 and PIP-640. See, Pharmaceutics. 2019 January; 11(1): 41, (See Biomaterials. 2012; 33: 3464-3474), ZOT(tight junction toxin), AG (ZOT fragment) (See Int J. Pharm. 2009; 365: 121-130). In one embodiment, a permeation enhancer is selected from the group consisting of sodium decanoate, sodium taurodeoxycholate, and lauroyl carnitine. In one embodiment, a permeation enhancer is selected from the group consisting of CIO, LC, and NaTDC. In one embodiment, a permeation enhancer is CIO. As used herein, the term "protease inhibitor" means a protease inhibitor that may be selected from the group consisting of protein-based, peptide-based, and small molecule-based. Protease inhibitors are well known and may include, for example, soybean trypsin inhibitor ("SBTI"), soybean trypsinchymotrypsin inhibitor ("SBTCI"), ecotin, sunflower trypsin inhibitor ("SFTI"), leupeptin, citric acid, ethylenediaminetetraacetic acid (EDTA), sodium glycocholate, and 4-(2-aminoethyl)benzenesulfonyl fluoride hydrochloride (AEBSF). In one embodiment, a protease inhibitor is selected from the group consisting of SBTI, SBTCI, and SFTI. In one embodiment, a protease inhibitor is SBTI. In one embodiment, it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the compound is a potent GIPR / GLP-1R dual agonist that is a partial agonist at the GLP-1R as demonstrated by a guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay at the cell membrane, and a partial agonist on the GLP-1R as demonstrated by a p-arrestin-2 recruitment assay. In one embodiment it is a compound of Formula I, or a pharmaceutically acceptable salt thereof, wherein the compound stimulates GLP-1R-induced activation of Gas in the guanosine 5Xgamma-thio)triphosphate-[3;,S] binding assay. (GTPyS) on the membrane of HEK293 cells with GLP-1R. In one embodiment, it is a compound that Χ-21852 -30FR / nnn / Lznz / e / YiAi shows partial agonism of 75% or less in the guanosine 5'-(gammatio)triphosphate-[35S] (GTPyS) binding assay on the membrane of GLP-1R HEK293 cells , and 35% or less in the β-arrestin recruitment assay in CHO cells for GLP. In one embodiment, it is a method for the treatment of diabetes comprising administering an effective amount of a compound that exhibits partial agonism of 75% or less in the guanosine 5'-(gamma-thio)triphosphate-[ 35S] (GTPyS) on the membrane of HEK293 cells with GLP-IR, and an effective amount of a compound that is a GIP agonist. In one embodiment, the compound showing partial agonism in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the GLP-IR HEK293 cell membrane is co-administered with a compound having GIP agonist activity. In one embodiment, the compound showing partial agonism in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the GLP-IR HEK293 cell membrane is administered as an active agent within one week before or after a compound having GIP agonist activity. In one embodiment, a method for the treatment of diabetes comprises administering an effective amount of a compound showing 35% or less in the CHO cell β-arrestin recruitment assay for GLP and administering an effective amount of a compound showing a partial agonism of 75% or less in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the GLP-IR HEK293 cell membrane. The compounds of the present invention can be reacted with any of a number of inorganic and organic acids / bases to form pharmaceutically acceptable acid / base addition salts. Such pharmaceutically acceptable salts and the common methodology for preparing them are well known in the art. (See, eg, P. Stahl, et al., Handbook of Pharmaceutical Salts: Properties, Selection and Use, 2nd Revised Edition (Wiley-VCH, 2011)) Pharmaceutically acceptable salts of the present invention include, but are not limited to . sodium, trifluoroacetate, hydrochloride, ammonium, and acetate salts. In one embodiment, a pharmaceutically acceptable salt is selected from the group consisting of sodium, hydrochloride, and acetate salts. The present invention further encompasses novel intermediates and processes useful for the synthesis of compounds of the present invention, or a pharmaceutically acceptable salt thereof. The intermediates and compounds of the present invention can be prepared by a variety of procedures known in the art. In particular, the following Examples Χ-21852 -31FR / nnn / Lznz / e / YiAi describe a process using chemical synthesis. The specific synthetic steps for each of the described pathways can be combined in different ways to prepare the compounds of the present invention. Reagents and starting materials are readily accessible to those skilled in the art. When used herein, the term "effective amount" refers to the amount or dose of a compound of the present invention, or a pharmaceutically acceptable salt thereof, which, upon administration of. single or multiple doses to the patient provide the desired effect in the patient being diagnosed or treated. One skilled in the art can determine an effective amount by using known techniques and by observing results obtained under analogous circumstances. In determining the effective amount for a subject, a number of factors are considered, including, but not limited to, the species of mammal; your size, age and general health; the specific disease or disorder involved; the degree or involvement or severity of the disease or disorder; the response of the individual patient; the particular compound administered; the mode of administration; the bioavailability characteristics of the administered preparation; the selected dose regimen; the use of concomitant medication; and other relevant circumstances. When used herein, the term 'subject in need' refers to a mammal, preferably a human, with a disease or condition that requires treatment or therapy, including, for example, those listed in the preceding paragraphs. . As used herein, EDTA means ethylenediaminetetraacetic acid. As used herein, DMSO means dimethyl sulfoxide. As used in the present, CPM” means counts per minute. As used herein. IBMX stands for 3-isobutyl-lmethylxanthine. As used herein, LC / MS means liquid chromatography / mass spectrometry. As used herein, HTRF means homogeneous time-resolved fluorescence. As used herein, BSA means bovine serum albumin. The invention is illustrated in more detail by the following examples, which are not to be construed as limiting. Χ-21852 -32PEPTIDE SYNTHESIS Example 1 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)i8- CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 (SEQ ID NO: 10). The structure of SEQ ID NO: 10 is represented below using the standard single letter amino acid codes with the exception of the residues Aib2, aMeF(2F)6, aMeL13, K17, Aib20, D-Glu24 and Ser39, where the structures of these amino acid residues have been expanded: FR / nnn / Lznz / e / YiAi The peptide backbone of Example 1 is synthesized by fluorenylmethyloxycarbonyl (Fmoc) / tert-butyl (t-Bu) chemistry on a Symphony X Peptide Synthesizer (Gyros Protein Technologies. Tucson, AZ). The resin consists of 1% DVB crosslinked polystyrene (Fmoc-Rink-MBHA low loading resin, 100-200 mesh, EMD Millipore) at a substitution of 0.3-0.4 meq / g. Standard side chain protecting groups were used. Fmoc-Lys(Mtt)-OH is used for lysine at position 17. and Boc-Tyr(tBu)-OH) is used for tyrosine at position 1. Fmoc groups are removed before each coupling step ( 2x7 minutes) by using 20% ​​piperidine in DMF. All standard amino acid couplings are performed for 1 hour to a primary amine and 3 hours to a secondary amine, using an equal molar ratio of Fmoc amino acid (0.3 mM), diisopropylcarbodiimide (0.9 mM) and oxyma. (0.9 mM), in a 9-fold molar excess over the theoretical peptide loading. The exceptions are Ca-mediated amino acid couplings, which are coupled over 3 hours. After the synthesis of the peptide backbone is complete, the resin is washed extensively with DCM 6 times to remove residual DMF. The Mtt protecting group on lysine in the Χ-21852 -33FR / nnn / Lznz / e / YiAi position 17 is selectively removed from the peptide resin by the use of two treatments of 30% hexafluoroisopropanol (Oakwood Chemicals) in DCM (2 x 40 minute treatment). Subsequent attachment of the linker-fatty acid moiety is accomplished by coupling 2-[2-(2-Fmoc-amino-ethoxy)-ethoxy]-acetic acid (Fmoc-AEEA-OH, ChemPep, Inc.), Fmoc acid -L-glutamic α-tert-butyl ester (Fmoc-Glu-OtBu, Ark Pharm, Inc.), mono-otBueicosanedioic acid (WuXi AppTec, Shanghai, China). A 3-fold excess of reagents (AA: PyAOP: DIPEA — 1:1:1 mol / mol) are used for each coupling lasting 1 hour. Once the . synthesis, the. peptide resin is washed with DCM and then dried completely in air. The dried resin is treated with 10 ml of cleavage cocktail (trifluoroacetic acid:water:triisopropylsilane, 95:2.5:2.5 v / v) for 2 hours at room temperature. The resin is filtered off, washed twice, each with 2 mL of neat TFA, and the combined filtrates are treated with excess volume of cold diethyl ether 5 times (-20°C) to precipitate the crude peptide. The peptide / ether suspension is then centrifuged at 3,500 rpm for 2 minutes to form a solid pellet, the supernatant decanted, and the solid pellet triturated with ether two more times and dried in vacuo. The crude peptide is solubilized in 20% acetonitrile / 20% acetic acid / 60% water and purified by RPHPLC on a Luna 5 μηι phenyl-hexyl preparative column (21 x 250 mm, Phenomenex) with linear gradients. of 100% acetonitrile and system, 0.1% TFA buffer / water (30-50% acetonitrile in 60 min). Peptide purity is assessed by analytical RPHPLC and the pooling criterion is >95%. The purity of the main pool of compound 1 is found to be 98.0%. Subsequent lyophilization of the final major product pool produces a lyophilized peptide TFA salt. Molecular weight is determined by LCMS (obsd: M+3=1657.2; Cale M+3=1657.0). Χ-21852 -34FR / nnn / Lznz / e / YiAi Example 2 Y-Aib-EGT-aMeF(2F)-TSDYSI-«MeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO- (CH2)i6-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 (SEQ ID NO: 11) The structure of SEQ ID NO: 11 is represented below using the standard single-letter amino acid codes, with the exception of the residues Aib2, aMeF(2F)6, aMeL13, Omló, K17, Aib20, D -Glu24 and Ser39, where the structures of these amino acid residues have been expanded: The compound according to SEQ ID NO: 11 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 = 1642.6; Cale M+3 = 1642.8). Example 3 Example 3 is a compound represented by the following description: Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-( CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 (SEQ ID NO: 12) The structure of SEQ ID NO: 12 is represented below using the standard single-letter amino acid codes, with the exception of the residues Aib2, aMeF(2F)6, aMeL13, Omló, K17, Aib20, D -Glu24 and Ser39, where the structures of these amino acid residues have been expanded: Χ-21852 -35FR / nnn / Lznz / e / YiAi Ε1 compound according to SEQ ID NO: 12 is prepared substantially as described in the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 = 1651.8; Chile M + 3 = 1652 ,2). Example 4 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-«MeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu )-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(D-Glu)-aMeY-LIEGGPSSGAPPPSNH2(SEQ ID NO: 13) The structure of SEQ ID NO: 13 is represented below using the 10 standard single-letter amino acid codes with the exception of the residues Aib2, aMeF(2F)6, 4PallO, aMeL13, Oml6, K17, Aib20 , D-Glu24 aMeY25 and Ser39, where the structures of these amino acid residues have been expanded: D. The compound according to SEQ ID NO: 13 is prepared substantially as described in the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M + 3 = 1642.5; Cale M+3 = 1642,1). Χ-21852 -36pR / nnn / Lznz / e / YiAi Example 5 Y-Aib-EGT-aMeF(2F)-TSDVSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-( CH2)i6-CO2H)AQ-Aib-EFI-(D-Glu)-aMeY-LIEGGPSSGAPPPS-NH2 (SEQ ID NO: 14) The structure of SEQ ID NO: 14 is depicted below using the standard single letter amino acid codes with the exception of the Aib2, aMeF(2F)6, aMeL13, Oml6, K17, Aib20, D residues. -Glu24, aMeY25 and Ser39, where the structures of these amino acid residues have been expanded: The compound according to SEQ ID NO: 14 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 = 1626.1; Cale M+3 = 1626 ,1). From example 6 to example 287 Compounds according to Examples 6 (SEQ ID NO: 15) through Example 287 (SEQ ID NO: 296) are prepared substantially as described by the procedures of Example 1. Χ-21852 -37pR / nnn / Lznz / e / γΐΛΐ Example Compound name SEQ ID NO Calculated PM (average) Found PM (average) 6 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO (CH2)i8-CO2H)AQ-Aib- AFIEYLLEGGPS S GAPPPS -NH2 15 4863.5 4862.1 7 Y-Aib-EGTFTSDYSILLDSK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-( y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLLEGGPS S GAPPPS -NH2 16 4822.4 4821.3 8 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)- ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-AibAFIEYLIEGGPS S GAPPPS -NH2 17 4863.5 4863.2 9 Y-Aib-EGTFTSDYSILLDSK((2-[2-(2amino -ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 18 4822.4 4820.7 10 Y-Aib-EGTFTSDYSILLDSIAQ-Aib- AFIK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2) i 8-CO2H) YLLA-AibGPSSGAPPPS- NH2 19 4776.5 4775.4 11 Y-Aib-EGTFTSDYSILLDSIAQ-AibAFIEYLLK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)i8-CO2H)-AibGPSS GAPPPS-NH2 20 4834.5 4834.8 12 Y-Aib-EGTFTSDYSILLDKIAQK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)-AFIEYLIEGGPSSGAPPPSnh2 21 4891 .6 4890.0 Χ-21852 -38FR / nnn / Lznz / e / YiAi 13 Y-Aib-EGTFTSDYSILLD-Aib-IAQK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)-AFIEYLIEGGPSSGAPPPSnh2 22 4848, 5 4846.8 14 Y-Aib-EGTFTSDYSILLDKIAQK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)EFIQYLLE-AibGPSSGAPPPS-NH2 23 4976.7 4975.5 15 H- Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2) i8-CO2H)AQ- Aib-AFIEYLLE-AibGPSSGAPPPS-NH2 24 4865.5 4863.9 16 H-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i8-CO2H)AQ-Aib-AFIEYLIE-AibGPSSGAPPPS-NH2 25 4865.5 4863.9 17 H-Aib-EGTFTSDYSILLDKIAQK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu )-CO(CH2) i 8-CO2H) AFIEYLLE-Aib-GPS S G-NH2 26 4444.1 4442.7 18 H-Aib-EGTFTSDYSI-aMeL-LDKK(Dab-(2[2-(2-amino- ethoxy)- ethoxy]-acetyl)-Dab-(2-[2(2-amino- ethoxy)- ethoxy]-acetyl)-CO-(CH2)i8CO2H)AQ-0tMeK-AFIQYLLA-AibGPSSGAPKPS-NH2 27 4979.8 4978.8 19 H-Aib-EGTFTSDYSI-aMeL-LDKK(Dab-(2[2-(2-amino-ethoxy)-ethoxy]-acetyl)-Dab-(2-[2(2-amino-ethoxy)- ethoxy]-acetyl)-CO-(CH2)i8CO2H)AQ-ocMeK-AFIQYLLA-AibGPSSGAPPPS-NH2 28 4948.8 4947.2 Χ-21852 -39FR / nnn / Lznz / e / YiAi 20 Y-Aib-EGTFTSDYSl-aMeL-LDKK((2-|2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 29 4877.5 4875.9 21 Y-Aib-EGTFTSDYSI-aMeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO( CH2)i8-CO2H)AQ-ccMeK- AFIEYLLEGGPS S GAPPPS -NH2 30 4935.6 4934.1 22 Y-Aib-EGTFTSDYSI-aMeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl )2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-ccMeK-AFIEYLLE-AibGPSS GAPPPS-NH2 31 4963.6 4962.0 23 Y-Aib-EGTFTSDK((2-[2-(2- amino-ethoxy)ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)i8CO2H)SILLDKIAQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 32 4813.5 4812.9 24 Y-Aib-EGTFTSDYK((2- [2-(2-amino-ethoxy)- ethoxy]-aceti)2-(Y-Glu)-CO-(CH2)i8- CO2H)ILLDKIAQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 33 4889.6 4888.6 25 Y-Aib-EGTFTSDYSK((2-[2-(2-amino-ethoxy)-ethoxy]-acelyl)2-(Y-Glu)-CO-(CH2)i8- CO2H)LLDKIAQ-Aib- AF1E YL1EGGPS S GAPPPS -NH2 34 4863.5 4862.5 26 Y-Aib-EGTFTSDYSIK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8CO2H)LDKIAQ- Aib- AFIEYLIEGGPS S GAPPPS -NH2 35 4863.5 N / I Χ-21852 -40pR / nnn / Lznz / e / γΐΛΐ 27 Y-Aib-EGTFTSDYSILK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)i8- CO2H)DKIAQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 36 4863.5 N / I 28 Y-Aib-EGTFTSD YS ILLK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)i8CO2H) KIAQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 37 4861.6 N / I 29 Y-Aib-EGTFTSDYSILLDK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO- (CH2)i8CO2H)IAQ-Aib-AFIEYLIEGGPSSGAPPPSnh2 38 4848.5 N / I 30 Y-Aib-EGTFTSDYSILLDKIK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO (CH2)i8-CO2H)Q-Aib- AFIEYLIEGGPS S G APPPS -NH2 39 4905.6 N / I 31 Y-Aib-EGTFTSDYSILLDKIAK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-( Y-Glu)-CO(CH2)i8-CO2H)-Aib- AFIEYLIEGGPS S G APPPS -NH2 40 4848.5 N / I 32 Y- Aib-EGTFTSD YSILLDKIAQ-Aib-K( (2[2-(2-amino- ethoxy)-ethoxy]-acetyl)2-(Y-Glu)CO-(CH2)i8- CO2H)FIE YLIEGGPS SG APPPS -NH2 41 4905.6 N / I 33 Y-Aib-EGTFTSDYSILLDKIAQ-Aib- AFK((2 -[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y- Glu)-CO-(CH2)i8- CO2H)E YLIEGGPS S GAPPPS -NH2 42 4863.5 N / I 34 Y- Aib-EGTFTSD YSILLDKIAQ-Aib- AFIK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (Y-Glu)-CO-(CH2)i8- CO2H) YLIEGGPS SG APPPS -NH2 43 4847.6 N / I Χ-21852 -41pR / nnn / Lznz / e / γΐΛΐ 35 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2) 18CO2H)IEGGPS s g appps -nh2 44 4863, 5 N / I 36 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLK((2- [2-(2-amino-ethoxy)-ethoxy] acetyl)2-(y-Glu)-CO-(CH2)isCO2H)EGGPS SG APPPS - NH2 45 4863.5 N / I 37 Y-Aib-EGTFTSDYSILLDKIAQ-Aib- AFIEYLIK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2 )i8- CO2H)GGPS s g appps nh2 46 4847.6 N / I 38 Y-Aib-EGTFTSDYSILLDKIAQ-Aib- AFIEYLIEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y- Glu)-CO-(CH2) 18- CO2H)GPS SG APPPS -NH2 47 4919.6 N / I 39 Y-Aib-EGTFTSDYSILLDKIAQ-Aib- AFIEYLIEGK((2-[2-(2-amino-ethoxy)-ethoxy ]- acetyl)2-(y-Glu)-CO-(CH2)is- CO2H)PS s gappps -nh2 48 4919.6 N / I 40 Y-Aib-EGTFTSDYSILLDKIAQ-Aib- AFIEYLIEGGK((2-[2- (2-amino-ethoxy)- ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8- CO2H)S S GAPPPS -NH2 49 4879.5 N / I 41 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPK( (2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8CO2H)S GAPPPS -NH2 50 4889.6 N / I 42 Y-Aib-EGTFTSDYSILLDKIAQ -AibAFIEYLIEGGPSK((2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8CO2H)GAPPPS-NH2 51 4889.6 N / I Χ-21852 -42pR / nnn / Lznz / e / γΐΛΐ 43 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPSSK((2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)i8CO2H)APPPS-NH2 52 4919.6 N / I 44 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPSSGK((2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(7-Glu)-CO-(CH2)i8CO2H)PPPS-NH2 53 4905, 6 N / I 45 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPS S G AK((2- [2-(2-aminoethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO-(CH2)isCO2H)PPS-NH2 54 4879.5 N / I 46 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPSSGAPK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO-(CH2)i8CO2H)PS- NH2 55 4879.5 N / I 47 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPSSGAPPK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO-(CH2)i8CO2H)S -NH2 56 4879.5 N / I 48 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPSSGAPPPK((2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO-(CH2)i8CO2H) -NH2 57 4889.6 N / I 49 Y-Aib-EGTFTSDYSILLDKIAQ-AibAFIEYLIEGGPS S G APPPS K((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2) i8-CO2H)-NH2 58 4976.7 N / I 50 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2 ) i 8-CO2H) AQ-Aib-AFIE YLIEGGPS S Gnh2 59 4414.0 N / I Χ-21852 -43FR / nnn / Lznz / e / YiAi 51 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 8-CO2H) AQ-Aib-AFIE YLIEGG-NH2 60 4085.7 N / I 52 Y-Aib-EGTFTSDYSI-aMeL-LDSK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H) AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 61 4836.4 N / I 53 H-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 62 4851.5 N / I 54 H-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2(2-amino-ethoxy) -ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQHAFIE YLIEGGPS SG APPPS -NH2 63 4903.5 N / I 55 H-Aib-EGTFTSD YS I-aMeL-LDEK((2 - [2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQHAFIE YLIEGGPS SGAPPPS -NH2 64 4904.5 N / I 56 Y-Aib-EGTFTSDYSI -aMeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18-CO2H) AQH AFIEYLIEGGPS SGAPPPS -NH2 65 4930.5 N / I 57 Y-Aib-EGT-aMeF-TSDYSILLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 66 4877.5 N / I 58 Y-Aib-EGTFTSDYSSLLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8- CO2H)AQ-Aib- AI1EYI IEGGPS S GAPPPS -ΝH2 67 4837.4 N / l Χ-21852 -44pR / nnn / Lznz / e / γΐΛΐ 59 Y-Aib-EGTFTSDYSl-aMeL-LDEK((2-|2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 68 4878.5 N / I 60 Y-Aib-EGTFTSDYSI-aMeL-LD-Aib-K((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu )CO-(CH2) 18-CO2H) AQ-AibAFIEYLIEGGPS S G APPPS -NH2 69 4834.5 N / I 61 Y Aib EGTFTSDYSI aMeL LDSK((2 [2 (2-amino-ethoxy)-ethoxy]-acetyl)2-( Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLLEGGPS S G APPPS -NH2 70 4836.4 N / I 62 Y-Aib-EGTFTSD YS I-aMeL-LDKK((2- [2(2- amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-AFIEYLIEGG-NH2 71 4099.7 N / I 63 Y-Aib-EGTFTSD YS I-aMeL -LDEK((2- [2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2) 18-CO2H) AQ-Aib-AFIE YLIEGG-NH2 72 4100.6 N / I 64 Y- Aib-EGTFTSD YSI-aMeL-LDSK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib -AFIEYLIEGG-NH2 73 4058.6 N / I 65 Y-Aib-EGTFTSD YS I-aMeL-LDTK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)- CO(CH2)i8-CO2H)AQ-Aib-AFIEYLIEGG-NH2 74 4072.6 N / I 66 Y-Aib-EGTFTSD YS I-aMeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy] -acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLLEGGPS S GAPPPS -NH2 75 4878.5 N / I Χ-21852 -45FR / nnn / Lznz / e / YiAi 67 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-A-aMeFIE YLIEGGPS S G APPPS -NH2 76 4877.5 N / I 68 Y-Aib-EGTFTSDY-otMeS-ILLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 77 4877.5 N / I 69 Y Aib EGT «MeF TSDYSI ocMeL LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 78 4891.6 N / I 70 Y-Aib-EGTFTSDK((2-[2-(2-amino-ethoxy )ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8- CO2H)SILLDKIAQ-Aib-AFIEYLIEGG-NH2 79 4035.7 N / I 71 Y-Aib-EGTFTSDYSILK((2-[2- (2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8CO2H)DKIAQ-Aib-AFIEYLIEGG-NH2 80 4085.7 N / I 72 Y-Aib-EGTFTSDYSILLDKIAQ-Aib-K ((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)CO-(CH2) 18-CO2H)FIEYLIEGG-NH2 81 4127.8 N / I 73 Y-Aib- EGTFTSDYSILLDKIAQ-Aib- AFIEYLIK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)i8-CO2H)GG-NH2 82 4069.7 N / I 74 Y-Aib-EGTFTSD YS I-aMeL-LDKK((2- [2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ- Aib-A-aMeF- IE YLIEGGPS S G APPPS -NH2 83 4891.6 N / I Χ-21852 -46pR / nnn / Lznz / e / γΐΛΐ 75 Y-Aib-EGTFTSDYSl-aMeL-LDKK((2-|2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-AFIEY -ocMeLIEGGPS S GAPPPS -NH2 84 4891.6 N / I 76 Y-Aib-EGT-aMeF-TSDYSI-ocMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu )-CO-(CH2)i8-CO2H)AQ-Aib-AocMeF-IEYLIEGGPSS GAPPPS -NH2 85 4905.6 N / I 77 Y-Aib-EGTFTSDYSILLKIAQ-AibAFIEYLIEGGPSSGAPPK((2-[2-(2-aminoethoxy)-ethoxy ]-acetyl)2-(Y-Glu)-CO-(CH2)i8CO2H)S-NH2 86 4764.5 N / I 78 (D-Tyr)-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy )-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 87 4863.5 N / I 79 Ac-(D-Tyr)-AEGTFTSDYSILLDKK( (2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)is-CO2H)AQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 88 4891.5 N / I 80 Y-(D-Ala)-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 89 4849.5 N / I 81 Y-Aib-EGTFTSDY-(D-Ser)-ILLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu) -CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S GAPPPS -NH2 90 4863.5 N / I Χ-21852 -47FR / nnn / Lznz / e / YiAi 82 Y-Aib-EGTFTSD YS-(D-Ile)-LLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H) AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 91 4863.5 N / I 83 Y-Aib-EGTFTSD YS ILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)- CO(CH2)i8-CO2H)AQ-Aib-AFIEYLI-(D-Glu)GGPSSG APPPS-NH2 92 4863.5 N / I 84 Y-Aib-EGTFTSD YS ILLDKK((2-[2-(2amino-ethoxy) -ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-AFI-(D-Glu)YLIEGGPS S G APPPS -NH2 93 4863.5 N / I 85 Y-Aib- EGTFTSDASILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 94 4771.4 N / I 86 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIE AGPS S G APPPS -NH2 95 4877.5 N / I 87 Y-otMePro-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H) AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 96 4889.5 N / I 88 Y-Pro-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO( CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 97 4875.5 N / I 89 Y-Aib-Aad-GTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2- (Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 98 4877.5 N / I Χ-21852 -48FR / nnn / Lznz / e / YiAi 90 Y-Aib-NGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 99 4848.5 N / I 91 Y-Aib-(y-Glu)-GTFTSDYSILLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 8-CO2H) AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 100 4863.5 N / I 92 Y-Aib-EGT-aMeF-TSDK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) 2-(y-Glu)-CO-(CH2)i8- CO2H)SILLDKIAQ-Aib-AFIEYLIEGG-NH2 101 4049.7 N / I 93 Y-Aib-EGT-ocMeF-TSDYSILK((2-[2-(2amino -ethoxy)-ethoxyJ-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)DKIAQ-Aib-AFIEYLIEGGnh2 102 4099.7 N / I 94 Y-Aib-EGT-aMeF-TSDYSILLDKIAQ-Aib- K ((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- G1u)-CO-(CH2)18-CO2H)FIEYLIEGG-NH2 103 4141.8 N / I 95 Y- Aib-EGT-aMeF-TSDYSILLDKIAQ-Aib- AFIEYLIK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)i8-CO2H)GG-NH2 104 4083.7 N / I 96 Y-Aib-EGTFTSDK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)i8-CO2H) SIaMeL-LDKIAQ-Aib-AFIEYLIEGG-NH2 105 4049.7 N / I 97 Y-Aib-EGTFTSDYSI-aMeL-LDKIAQ-AibAFIEYLIK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-( y-Glu)-CO-(CH2)i8-CO2H)GG-NH2 106 4083.7 N / I 98 Y-Aib-EGT-aMeF-TSDYSILLDKK((2-[2(2-amino-ethoxy)-ethoxy] -acetyl)2-(y-Glu)-CO(CH2) i s-CO2H) AQ-Aib-AFIE YLIEGG-NH2 107 4099.7 N / I Χ-21852 -49FR / nnn / Lznz / e / YiAi 99 Y-Aib-EGT-ocMeF-TS D YSl-ocMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) i 8 -CO2H) AQ- AibAFIEYLIEGG-NH2 108 4113.7 N / I 100 Y-Aib-EGT-otMeF-TSDYSI-otMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (7-Glu)-CO-(CH2)i8-CO2H)AQ-AibAFIEYLIEGG-NH2 109 4114.7 N / I 101 Y Aib EGT ocMeF(2F) TSDYSI Aib LDEK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-AibAFIEYLIEGG-NH2 110 4090.6 N / I 102 Y-Aib-EGT-ocMeF-TSDYSI-Aib-LDEK ((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)CO-(CH2) 18-CO2H) AQ- Aib-AFIE YLIEGGnh2 111 4072.6 N / I 103 Y -Aib-EGT-otMeF(2F)-TSDYSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ -AibEFIEYLIEGG-NH2 112 4190.7 N / I 104 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7- Glu)-CO-(CH2)i6-CO2H)AQ-AibEFIEYLIEGG-NH2 113 4162.6 N / I 105 DesHis^[NHCO]-Aib- EGTFTSDYSILLDKK((2-[2-(2-aminoethoxy)-ethoxy]- acetyl)2-(7-Glu)-CO-(CH2)i8CO2H) AQ- Aib-AFIE YLIEGGPS S G APPPS nh2 114 4822.5 N / I Χ-21852 -50FR / nnn / Lznz / e / YiAi 106 DesHis-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 115 4822.5 N / I 107 DesTyr-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 8-CO2H) AQ-Aib - AFIEYLIEGGPS S G APPPS -NH2 116 4848.5 N / I 108 Y-Aib-EGTFTSD YS ILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)-AOC-(y-Glu)-CO( CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 117 4859.6 N / I 109 Y-Aib-EGTFTSDYSILLDKK(AOC-(2-[2-(2amino-ethoxy)-ethoxy]-acetyl)-( y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 118 4859.6 N / I 110 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)- ethoxy]-acetyl)-(y-Glu)-(Trx)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 119 N / I 111 Y-Aib-EGTFTSD YS ILLDKK((2- [ 2-(2amino-ethoxy)-ethoxy]-acetyl)-(Trx)-(y-Glu)-CO(CH2)is-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 120 N / I 112 Y-Aib- EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-eloxy]-acetyl)-(sK)-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 121 4846, 5 N / I 113 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy] -acetyl)2-(sK)-CO-(CH2) i sCO2H) AQ-Aib-AFIE YLIEGGPS S G APPPS nh2 122 4862.6 N / I Χ-21852 -51FR / nnn / Lznz / e / YiAi 114 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)-(sK)-(sK)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 123 4845.6 N / I 115 Y-Aib-EGT-otMeF-TSDYSI-otMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO- (CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 124 4892.5 N / I 116 Y Aib EGT «MeF TSDYSI «MeL LDEK((2-[2-(2-amino-ethoxy)-ethoxy] -acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIEGGPS S G APPPS - NH2 125 4950.5 N / I 117 Y-Aib-EGT-ocMeF-TSDYSI-Aib-LDEK ((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)CO-(CH2) 18-CO2H) AQ- Aib- AFIEYLIEGGPS S G APPPS -NH2 126 4850.4 N / I 118 Y-Aib-EGT-otMeF(2F)-TSDYSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8- CO2H)AQ-Aib- EFIEYLIEGGPS S G APPPS -NH2 127 4968.5 N / I 119 F-Aib-EGT ocMeF-TSDYSI-ocMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl )2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 128 4876.5 N / I 120 Y-Aib-cTA-GT-ocMeF-TSDYSI-ocMeL- LDEK( (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) i 8-CO2H) AQ- Aib- AFIEYLIEGGPS S G APPPS -NH2 129 4902.5 N / YO Χ-21852 -52pR / nnn / Lznz / e / Yi / u 121 Y-Aib-EGT-ocMeF-TS D YSI-ocMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (7-Glu)-CO-(CH2)i8 - CO2H) AQQAFIE YLIEGGPS SG APPPS -NH2 130 4935.5 N / I 122 Y-Aib-EGT-otMeF-TSDYSI-otMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) 2(7-Glu)-CO-(CH2)i8-CO2H)AQQAFIEYLIEAib-GPSSGAPPPS-NH2 131 4963.6 N / I 123 Y Aib EGT ocMeF TSDYSI ocMeL LDKK((2-[2-(2-amino-ethoxy) -ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIEYLIEGGPS S G-NH2 132 4500.1 N / I 124 Y-Aib-EGT-ocMeF-TSDYSI-ocMeL - LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) i 8-CO2H) AQ- AibEFIEYLIEGGPS S G-NH2 133 4501.0 N / I 125 Y-Aib-EGT-otMeF-TSDYSI-otMeLLDKK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2(7-Glu)2-CO-(CH2)i8- CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 134 5,020.7 N / I 126 Y-Aib-EGT-aMeF-TSDYSI-ocMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]- acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIEYLIE AGPS S G APPPS -NH2 135 4905.6 N / I 127 Y-Aib-EGT-aMeF-TSDISILLDKK((2-[ 2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 136 4827.5 N / I Χ-21852 -53pR / nnn / Lznz / e / γΐΛΐ 128 Y-Aib-EGT-aMeF-TSDHSlLLDKK((2-|2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 137 4851.5 N / I 129 Y-Aib-EGT-otMeF-TSDLSILLDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO( CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 138 4827.5 N / I 130 Y Aib EGT ocMeF TSDESILLDKK((2 [2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y -Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 139 4843.5 N / I 131 Y-Aib-EGT-ocMeF-TSD-ocMeF- SILLDKK((2-[2-( 2-amino-ethoxy)-ethoxy]- acetyl)2-(Y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 140 4875.6 N / I 132 Y-Aib- EGT-otMeF-TSD-3Pal-SILLDKK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)CO-(CH2) 18-CO2H) AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 141 4862.5 N / I 133 DesTyr-Aib-EGT-ocMeF-TS D YSI- AibLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu) -CO-(CH2)i8-CO2H)AQ-AibAFIEYLIEGGPS S G APPPS -NH2 142 4835.4 N / I 134 DesTyr-Aib-EGT-ocMeF(2F)-TSDYSIaMeL-LDEK((2-[2-(2-amino -ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFIE YLIEGGPS S G APPPS - NH2 143 4953.5 N / I Χ-21852 135 H-Aib-NGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 144 4822.5 N / I 136 Y-Aib-EGTFTSD AS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 8-CO2H) AQ -Aib- AFIEYLIE AGPS S G APPPS -NH2 145 4785.4 N / I 137 Y-Aib-EGT-aMeF-TSDYST-aMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) 2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-AadFIE YLIEGGPS S G APPPS -NH2 146 4963.6 N / I 138 Y-Aib-EGT-aMeF-TSDYSI-ocMeL-LDKK((2 -[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-AibSFIEYLIEGGPSSGAPPPS-NH2 147 4907.6 N / I 139 Y-Aib- EGT-ocMeF-TSDYSI-ocMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2) i s-CO2H) AQ- Aib- TFIE YLIEGGPS S G APPPS - NH2 148 4921.6 N / I 140 Y-Aib-EGT-otMeF-TSDYSI-otMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y -Glu)-CO-(CH2)i8-CO2H)AQ-Aib- DFIEYLIEGGPS S G APPPS -NH2 149 4935.6 N / I 141 Y-Aib-EGT-aMeF-TSDYSI-ocMeL- LDKK((2-[2- (2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- IFIEYLIEGGPSS GAPPPS -NH2 150 4933.6 N / I Χ-21852 -55FR / nnn / Lznz / e / YiAi 142 Y-Aib-EGT-aMeF-TS D YSl-aMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) i 8 -CO2H) AQ- AibHFIEYLIEGGPS S G APPPS -NH2 151 4957.6 N / I 143 Y-Aib-EGT-otMeF-TSDYSLaMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-Aib- FIE YLIEGGPS S G APPPS -NH2 152 4905.6 N / I 144 Y Aib EGT aMcF TSDYSI aMeL LDKK((2-[2-( 2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQH-Aib- FIE YLIEGGPS S G APPPS -NH2 153 4957.6 N / I 145 Y-Aib- EGT-aMeF-TSDASI-aMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) 18-CO2H) AQ- AibAFIEYLIEGGPS S G APPPS -NH2 154 4799.5 N / I 146 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu) -CO-(CH2)i8-CO2H)AQ-Aib- EFIQYLIEGGPS S G APPPS -NH2 155 4967.5 N / I 147 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2 -amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFl- Aad- YLIEGGPS S G APPPS -NH2 156 4982.6 N / I 148 Y- Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2)18-CO2H) AQ- Aib- EFIA YLIEGGPS S G APPPS -NH2 157 4910.5 N / I Χ-21852 -56FR / nnn / Lznz / e / YiAi 149 Y-Aib-EGT-ocMeF(2F)-TSDYSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) i 8- CO2H) AQ- AibEFIVYLIEGGPS S GAPPPS -NH2 158 4938.5 N / I 150 Y-Aib-EGT-otMeF(2F)-TSDYSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl )2(7-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFISYLIEGGPSSGAPPPS-NH2 159 4926.5 N / I 151 Y Aib EGT o.MeF(2F) TSDYSI aMeL LDEK((2-[2-( 2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFIPYLIEGGPSSGAPPPS-NH2 160 4936.5 N / I 152 Y-Aib-EGT-ocMeF(2F )-TSDYSLotMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) 18-CO2H) AQ-Aib-EFI-AibYLIEGGPS S GAPPPS -NH2 161 4924.5 N / I 153 Y-Aib-EGT-otMeF(2F)-TSDYSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO -(CH2)i8-CO2H)AQ-Aib- EFIHYLIEGGPS S GAPPPS -NH2 162 4976.6 N / I 154 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino -ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIEGGPS S GAPPPS - NH2 163 4942.5 N / I 155 Y-Aib-EGT-ocMeF (2F)-TSD-cTA-SLocMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2)18-CO2H) AQ-Aib- EFIE YLIEGGPS S GAPPPS - NH2 164 4944.5 N / I Χ-21852 -57FR / nnn / Lznz / e / YiAi 156 Y-Aib-EGT-ocMeF(2F)-TSD-2Pal-SLaMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) i 8-CO2H) AQ- Aib- EFIE YLIEGGPS S G APPPS - NH2 165 4953.5 N / I 157 Y-Aib-EGT-otMeF(2F)-TSD-3Pal-SI-aMeLLDEK((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIEGGPS S G APPPS - NH2 166 4953.5 N / I 158 Y Aib EGT ocMeF(2F ) TSD 4Pal SI ocMeL LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIEGGPS S G APPPS - NH2 167 4953.5 N / I 159 Y-Aib-EGT-ocMeF(2F)-TSD-aMeF-SIo.MeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2 -(7-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFIE YLIEGGPS S G APPPS - NH2 168 4938.5 N / I 160 Y-Aib-EGT-ocMeF(2F)-TSD-Aib-SI-oiMeLLDEK ((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) 18-CO2H) AQ- Aib-TFI-(DGlu)-YLIEGGPS S G APPPS - NH2 169 4862.4 N / I 161 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxyJ-acetyl)2(7-Glu)2- CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-YLIEGGPSSG-NH2 170 4594.1 N / I 162 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2 -(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)2-CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-HLIEGGPSSG-NH2 171 4568.1 N / Yo Χ-21852 -58pR / nnn / Lznz / e / γΐΛΐ 163 H-Aib-EGT-ocMeF(2F)-TSDYSl-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) i 8- CO2H) AQ- Aib- EFIE YLIEGGPS S GAPPPS - NH2 172 4942.5 N / I 164 Y-Aib-EGT-otMeF(2F)-TSDHSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy ]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-YLI-(D-Glu)-GGPSSGAPPPS-NH2 173 4914.5 N / I 165 Y Aib EGT ocMeF(2F) TSDHSI aMeL LDEK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-TFI -(DGlu)-aMeF-LI-(D-Glu)-GGPSSGAPPPSnh2 174 4912.5 N / I 166 Y-Aib-EGT-a.MeF(2F)-TSDHSI-0(.MeLLDEK((2-[2- (2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-YLIEGG-NH2 175 4136.7 N / I 167 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H) AQ-Aib-TFI-(DGlu)-YLIEGGPSSG-NH2 176 4465.0 N / I 168 Y-Aib-EGT-ocMeF(2F)-TSDHSI-otMeLLDEK((2-[2-(2-amino-ethoxy)- ethoxy]-acetyl)2(7-Glu)-CO-(CH2) 18-CO2H) AQ- Aib-TFI-(DGlu)-YLIEGGPS S GAPPPS -NH2 177 4914.5 N / I 169 Y-Aib-EGT- aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-TFI- (D-Glu)-YLIEGGPSS GAPPPS -NH2 178 4886.4 N / I Χ-21852 -59FR / nnn / Lznz / e / YiAi 170 Y-Aib-EGT-ocMeF(2F)-TSDHSI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i4-CO2H )AQ-Aib-TFI-(DGlu)-YLIEGGPS S G APPPS -NH2 179 4858.4 N / I 171 Y-Aib-EGT-otMeF(2F)-TSDHSI-otMeL-LDOrn-K((2-[2-( 2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 180 4899.5 N / I 172 Y Aib EGT ocMeF(2F) TSDHSI aMeL LD Dab-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ -Aib-TFI-(D-Glu)-YLIEGGPS S GAPPPS -NH2 181 4885.5 N / I 173 Y-Aib-EGT-ocMeF(2F)-TSDHSI-otMeL-LDDap-K((2-[2-( 2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) i 8-CO2H) AQ- Aib-TFI-(DGlu)-YLIEGGPS S GAPPPS -NH2 182 4871.5 N / I 174 Y-Aib-EGT-otMeF(2F)-TSDHSI-otMeL- LDEK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2- CO-(CH2)i8-CO2H)AQ -Aib-TFI-(D-Glu)- YLIEGGPS S GAPPPS -NH2 183 4785.4 N / I 175 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(sK)-CO-(CH2)i8-CO2H)AQ-Aib-TFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 184 4913.5 N / I 176 Y-Aib-EGT- aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(sK)-CO-(CH2)i6-CO2H)AQ-Aib-TFI-(DGlu )-YLIEGGPSS GAPPPS -NH2 185 4885.5 N / I Χ-21852 -60FR / nnn / Lznz / e / YiAi 177 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H )AQ-Aib-HFI-(DGlu)-YLIEGGPS S G APPPS -NH2 186 4922.5 N / I 178 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i4-CO2H)AQ-Aib-HFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 187 4894.4 N / I 179 Y Aib EGT aMeF (2F) TSDHSI aMeL LDEK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-HFI-(D - G1u)-YLIEGGPSSG-NH2 188 4473.0 N / I 180 Y-Aib-EGT-aMeF(2F)-TSDHSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-HFI-(DG1u)-YLIEGG-NH2 189 4144.6 N / I 181 Y-Aib-EGT-aMeF(2F)-TSD-3Pal -SI-aMeLLDEK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)- YLIEGGPSS GAPPPS -NH2 190 4953.5 N / I 182 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-aMeLLDEK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl) 2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS SGAPPPS -NH2 191 4953.5 N / I 183 Y-Aib-EGT-aMeF(2F)- TSDLSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu) -YLIEGGPS S GAPPPS -NH2 192 4918.5 N / I Χ-21852 -61FR / nnn / Lznz / e / YiAi 184 Y-Aib-EGT-aMeF(2F)-TSD-(D-Tyr)-Sla.MeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu )-CO-(CH2)i8-CO2H)AQ-AibEFI-(D-G1u)-YLIEGGPSSGAPPPS-NH2 193 4968.5 N / I 185 Y-Aib-EGT-ocMeF(2F)-TSD-(D-His) -SIa.MeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFL(D Glu) YLIEGGPSSGAPPPS NH2 194 4942.5 N / I 186 Y-Aib-EGT-aMeF(2F)-TS D-ocMeY-S IaMeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2- (y-Glu)-CO-(CH2)i8-CO2H)AQ-AibEFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 195 4982.6 N / I 187 Y-Aib-EGT-aMeF(2F)-TSDQSI-otMeLLDEK ((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2) 18-CO2H) AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS - NH2 196 4933.5 N / I 188 Y-Aib-EGT-ot.MeF(2F)-TSD-3Pal-SI-o(.MeLLDEK((2-[2-(2-amino-ctoxy)-ctoxy]- accyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-AibYLIEGGPS S G APPPS -NH2 197 4909.5 N / I 189 Y-Aib-EGT-a.MeF(2F)- TSD-4Pal-SI -aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-AibYLIEGGPS S G APPPS -NH2 198 4909.5 N / I 190 H-Aib-EGT-aMeF(2F)-TSD-3Pal-SI-ocMeLLDEK((2-f2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (y-Glu)-CO-(CH2) 1 s-CO2H) AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS -NH2 199 4927.5 N / I Χ-21852 -62pR / nnn / Lznz / e / γΐΛΐ 191 Y-Aib-EGT-ocMeF(2F)-TSDVSl-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) 18-CO2H ) AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS -NH2 200 4904.5 N / I 192 Y-Aib-EGT-otMeF(2F)-TSDASI-otMeLLDEK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 201 4876.4 N / I 193 Y ocMePro EGTFTSDYSILLDEK( (2 [2 (2 amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)18- CO2H)AQQAFIE YLIEGGPS SGAPPPS -NH2 202 4933.5 N / I 194 Y-aMePro-EGTFTSDYSILLDEK ((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)18- CO2H) AQHAFIE YLIEGGPS SGAPPPS -NH2 203 4942.5 N / I 195 Y-otMePro -EGTFTSDYSILLDRK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)18- CO2H) AQQ AFIEYLIEGGPS SGAPPPS -NH2 204 4960.6 N / I 196 Y -aMePro-EGTFTSDYSILLDRK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)18- CO2H) AQHAFIE YLIEGGPS SGAPPPS -NH2 205 4969.6 N / I 197 Y-aMePro-EGTFTSDYSILLDEK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)16-CO2H)AQQAFIEYLIEGGPSSGnh2 206 4456.0 N / I Χ-21852 -63FR / nnn / Lznz / e / YiAi 198 (D-Tyr)-aMePro-EGTFTSDYSILLDEK((2- [2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO-(CH2)i6- CO2H)AQQAFIEYLIEGGPSSG-NH2 207 4456.0 N / I 199 DesTyr-Aib-EGTFTSDYSILLDEK((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO- (CH2)18- CO2H) AQQAFIE YLIEGGPS SG APPPS -NH2 208 4892.5 N / I 200 DesTyr-AEGTFTSDYSILLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO- (CH2) 18- CO2H) AQQAFIE YLIEGGPS SG APPPS -NH2 209 4878.4 N / I 201 DesHis-ccMePro-EGTFTSDYSILLDEK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)CO -(CH2)i8- CO2H) AQQAFIE YLIEGGPS SG APPPS -NH2 210 4892.5 N / I 202 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-SI-ocMeLLDKK((2-[2-(2- Amino-ethoxy)-ethoxy]-acetyl)(y-Glu)-(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)CO-(CH2)is-CO2H)AQ-Aib-EFI- (D-Glu)YLIEGGPS S G APPPS -NH2 211 4938.6 N / I 203 Y-Aib-EGT-ocMcF(2F)-TSD-4Pal-SI-aMcLLDKK((2-[2-(2-amino-eloxy) -ethoxy]-acelyl)2(y-Glu)-CO-(CH2) 18-CO2H) AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS -NH2 212 4952.6 N / I 204 Y-Aib-EGT -otMeF(2F)-TSD-4Pal-SI-otMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i6-CO2H)AQ -Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 213 4924.5 N / I Χ-21852 -64pR / nnn / Lznz / e / Yi / u 205 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-Sl-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2CO-(CH2)i6-CO2H)AQ- Aib-EFI-(D-Glu)YLIEGGPS S G APPPS -NH2 214 4795.4 N / I 206 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-aMeLLDEK((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)YLIEGGPS S G APPPS -NH2 215 4823.5 N / I 207 Y Aib EGT aMeF(2F) TSD 4Pal SI aMeL LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(sK)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 216 4923.6 N / I 208 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu )-CO-(CH2)i4-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS SGAPPPS -NH2 217 4912.4 N / I 209 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LDDab -K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS S GAPPPS -NH2 218 4911.4 N / I 210 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LDDap-K((2-[2-(2-amino-ethoxy)-ethoxyJ-acetyl)2( 7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS GAPPPS -NH2 219 4897.5 N / I 211 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDKK ((2-[2-(2-Amino-ethoxy)-ethoxy]-acetyl)(7-Glu)-(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)CO-(CH2) i8-CO2H)AQ-Aib-EFI-(D-Glu)- YLIEGGPS S GAPPPS -NH2 220 4953.6 N / I Χ-21852 -65FR / nnn / Lznz / e / YiAi 212 Y-Aib-EGT-ocMeF(2F)-TSDYSI-otMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2) 18-CO2H ) AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS -NH2 221 4967.5 N / I 213 Y-Aib-EGT-otMeF-TSDYSI-otMeL- LDEK((2-[2-(2-amino-ethoxy )-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 222 4922.4 N / I 214 Y Aib EGT ocMeF( 2F) TSDYSI aMeL LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- CO-(CH2)i6-CO2H)AQ-Aib-EFI-(D-Glu)- YLIEGGPSS GAPPPS -NH2 223 4811.4 N / I 215 Y-Aib-EGT-ocMeF(2F)-TSDYSI-otMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2CO-(CH2 )i8-CO2H)AQ-Aib-EFI-(D-Glu)- YLIEGGPS S GAPPPS -NH2 224 4839.4 N / I 216 Y-Aib-EGT-otMeF(2F)-TSDYSI-otMeLLDEK((2-[2 -(2-amino-ethoxy)-ethoxy]-acetyl)2(8K)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPS SGAPPPS -NH2 225 4967.5 N / I 217 Y-Aib-EGT-a.MeF(2F)-TSDYSI-aMeL-LDDab-K((2-[2-(2-amino-ethoxy)-ethoxyJ-acetyl)2(7-Glu)-CO -(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 226 4939.5 N / I 218 Y-Aib-EGT-a.MeF(2F)-TSDYSI-aMeL-LDDap-K ((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS S GAPPPS - NH2 227 4925.5 N / I Χ-21852 -66pR / nnn / Lznz / e / γΐΛΐ 219 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H )AQ-Aib-EFI-(DGlu)-YLIEGGPS S G-NH2 228 4491.0 N / I 220 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGG-NH2 229 4162.6 N / I 221 Y Aib EGT aMeF( 2F) TSDYSI aMeL LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(D- Glu)-YLIEGGPS S GAPPPS -NH2 230 4940.5 N / I 222 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) 2(7-G1u)-CO-(CH2) i 8-CO2H) AQ- Aib-EFI-(DGlu)-aMe Y-LIEGGPS SGAPPPS -NH2 231 4982.6 N / I 223 Y-Aib-EGT-aMeF (2F)-TSDYSI-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2)18-CO2H) AQ-Aib-EFIEaMeY-LIEGGPS S GAPPPS -NH2 232 4982.6 N / I 224 Y-Aib-EGT-aMeF(2F)-TSDYSI-Aib- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2( 7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPS SGAPPPS -NH2 233 4926.4 N / I 225 Y-Aib-EGT-aMeF-TSDYSI-Aib -LDEK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)YLIEGGPS S GAPPPS -NH2 234 4908.5 N / I Χ-21852 -67FR / nnn / Lznz / e / YiAi 226 Y-Aib-EGT-ocMeF(2F)-TSDYSILLDEK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)CO-(CH2)i8-CO2H)AQ- Aib-EFI-(D-Glu)YLIEGGPS SG APPPS -NH2 235 4954.5 N / I 227 Y-Aib-EGT-aMeF-TSDYSLaMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy] -acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 236 4950.5 N / I 228 Y Aib EGT aMeF TSDYSI aMeL LDKK(( 2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSSG-NH2 237 4500, 1 N / I 229 Y-Aib-EGT-aMeF(2F)-TSDYS-aMeLLDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-G1u)-CO-(CH2 ) i 8-CO2H) AQ- Aib-EFI-(DGlu)-YLIEGGPS S GAPPPS -NH2 238 4855.4 N / I 230 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDHK((2- [2- (2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 239 4976.6 N / I 231 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H )AQ-Aib-EFl-(DGlu)-YLIEGGPS S GAPPPS -NH2 240 4939.5 N / I 232 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-aMeLLD-Orn- K((2- [2-(2-amino-ethoxy)-ethoxy]acetyl)2-(7-Glu)-CO-(CH2)i6-CO2H)AQ-AibEFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 241 4910.5 N / YO Χ-21852 -68pR / nnn / Lznz / e / γΐΛΐ 233 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-Sl-aMeLLD-Dab-K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)- CO-(CH2)i6-CO2H)AQ-AibEFI-(D-G1u)-YLIEGGPSSGAPPPS-NH2 242 4896.5 N / I 234 Y-Aib-EGT-otMeF(2F)-TSD-4Pal-SILLDDab-K(( 2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 243 4882 ,4 N / I 235 Y Aib EGT «MeF TSD 4Pal SI aMeL LD Dab-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2 )i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS SGAPPPS -NH2 244 4878.5 N / I 236 Y-Aib-EGT-ocMeF(2F)-TSDYSI-otMeL-LDOrn-K((2- [2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI (D- Glu)-aMe Y-LIEGGPS S GAPPPS - NH2 245 4939.5 N / I 237 Y-Aib-EGT-aMeF(2F)-TSDASI-otMeL-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y -Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-ocMe Y-LIEGGPS S GAPPPS -NH2 246 4847.4 N / I 238 Y-Aib-EGT-ocMeF(2F)- TSDLSI-ocMeL-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-( DGlu)-aMe Y-LIEGGPS S GAPPPS -NH2 247 4889.5 N / I 239 Y-Aib-EGT-a.MeF(2F)-TSD-4Pal-SI-a.MeLLD-Orn-K((2-[ 2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)i6-CO2H)AQ-AibTFI-(D-Glu)-aMeY-LIEGGPSSGAPPPSnh2 248 4896.5 N / Yo Χ-21852 -69FR / nnn / Lznz / e / YiAi 240 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-Sl-aMeLLD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)- CO-(CH2)i6-CO2H)AQ-AibAFL(D-Glu)-ocMeY-LIEGGPSSGAPPPSnh2 249 4866.5 N / I 241 Y-Aib-EGT-a.MeF(2F)-TSDVSI-otMeL-LDOm-K( (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-TFI-(DGlu)-aMc YLIEGGPS S GAPPPS -NH2 250 N / I N / I 242 Y-Aib-EGT-a,MeF(2F)-TSDVSI-aMeL-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2 (Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-AFI-(DGlu)-ocMe Y-LIEGGPS S GAPPPS -NH2 251 N / I N / I 243 Y-Aib-EGT-a.MeF( 2F)-TSDLSI-ocMeL-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib- TFI-(DGlu)-aMe Y-LIEGGPS S GAPPPS -NH2 252 N / I N / I 244 Y-Aib-EGT-a,MeF(2F)-TSDLSI-ocMeL-LDOrn-K((2-[2-(2 -amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-AFI-(DGlu)-ocMe Y-LIEGGPS S GAPPPS -NH2 253 N / I N / I 245 Y-Aib-EGT-aMeF(2F)-TSDASI-aMeL-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-( CH2)i6-CO2H)AQ-Aib-TFI-(D-Glu)-ocMe Y-LIEGGPS S GAPPPS -NH2 254 N / I N / I 246 Y-Aib-EGT-ocMeF(2F)-TSDASI-ocMeL-LDOrn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-AFI-(DGlu)-ocMe Y- LIEGGPS SGAPPPS -NH2 255 N / I N / I Χ-21852 -70FR / nnn / Lznz / e / YiAi 247 Y-Aib-EGT-ocMeF(2F)-TSDYSI-Aib-LDOrn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2 )i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPS S G APPPS -NH2 256 4883.4 N / I 248 Y-Aib-EGT-otMeF(2F)-TSDYSILLD-OmK((2-[2-( 2-amino-ethoxy)-ethoxy]-acetyl)2-(7Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFI-(DGlu)-YLIEGGPSS GAPPPS -NH2 257 4911.5 N / I 249 Y Aib EGT ocMeF(2F) TSDYSI Nle LD Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2)i6-CO2H)AQ- Aib-EFI-(D-Glu)-YLIEGGPS SGAPPPS -NH2 258 4911.5 N / I 250 Y-Aib-EGT-ocMeF(2F)-TSDYSI-Aib-LDOrn-K((2-[2-(2 -amino-ethoxy)-ethoxy]-acetyl)2(7-Glu)-CO-(CH2) i 8-CO2H) AQ- Aib-EFI-(DGlu)-YLIEGGPS S GAPPPS -NH2 259 4911.5 N / I 251 Y-Aib-EGT-otMeF(2F)-TSD-4Pal-SI-ocMeLLD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(sK)-CO- (CH2)i8-CO2H)AQ-AibAFI-(D-Glu)-ocMeY-LIEGGPSSGAPPPSnh2 260 4893.6 N / I 252 Y-Aib-EGT-a.MeF(2F)-TSD-4Pal-SI ocMeLLD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(sK)-CO-(CH2)i8-CO2H)AQ-AibAFI-(D-Glu)-ocMeY-LIAGGPSSGAPPPSnh2 261 4835 .6 N / I 253 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(7-Glu)-CO(CH2)18- CO2H) AQ AAFIE YLIEGGPS SGAPPPS - NH2 262 4849.5 N / I Χ-21852 -71pR / nnn / Lznz / e / γΐΛΐ 254 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQQAFIE YLIEGGPS SG APPPS -nh2 263 4906.5 N / I 255 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQHAFIE YLIEGGPS SGAPPPS -NH2 264 4915.5 N / I 256 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQKAFIE YLIEGGPS SGAPPPS -NH2 265 4906.6 N / I 257 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H ) AQRAFIE YLIEGGPS S G APPPS -NH2 266 4934.6 N / I 258 Y-Aib-EGTFTSDYSILLDEK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) 18- CO2H) AQKAFIEYLIEGGPS SGAPPPS -NH2 267 4907.5 N / I 259 Y-Aib-EGTFTSD YS ILLDEK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO (CH2)i8-CO2H)AQ-AibAFIEYLIEGGPS S G APPPS -NH2 268 4864.4 N / I 260 Y-Aib-EGTFTSDHSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIEYLIEGGPS S G APPPS -NH2 269 4837.5 N / I Χ-21852 -72FR / nnn / Lznz / e / YiAi 261 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) AQE AFIE YLIEGGPS S G APPPS -NH2 270 4907, 5 N / I 262 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18- CO2H) aqt AFIEYLIEGGPS S G APPPS -NH2 271 4879.5 N / I 263 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)18 -CO2H)AQSAFIEYLIEGGPSSGAPPPS-NH2 272 4865.5 N / I 264 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-SI-aMeLLD-Orn- K((2-[2-(2-amino-ethoxy) -ethoxy]acetyl)2-(y-Glu)-CO-(CH2)i6-CO2H)AQ-AibEFI-(D-Glu)-ocMeY-LIEGGPSSG-NH2 273 4475.0 N / I 265 Y-Aib-EGT -aMeF(2F)-TSD-4Pal-SI-aMeL- LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2 )i6-CO2H)AQ-Aib- EFI-(D-Glu)-ocMeY-LIEGG-NH2 274 4146.7 N / I 266 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)- ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIEGGPSSGnh2 275 4385.94 4386.6 267 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino -ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIEGG-NH2 276 4057.62 N / I 268 Y-Aib-EGTFTSDYSILLDEK((2-[ 2-(2amino-ethoxy)-eloxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIEGGPSSGnh2 277 4386.88 N / I Χ-21852 -73pR / nnn / Lznz / e / γΐΛΐ 269 ​​Y-Aib-EGTFTSDYSILLDEK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIEGG-NH2 278 4058, 56 N / I 270 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i6-CO2H)AQ-Aib- EFIEYLIEGGPSSG- NH2 279 4443.98 N / I 271 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i6- CO2H)AQ-Aib-EFIEYLIEGG-NH2 280 4115.66 N / I 272 Y-Aib-EGTFTSD YS ILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIAGGPSSG- NH2 281 4327.91 4327.8 273 Y-Aib-EGTFTSD YS ILLDKK((2- [2-(2amino-ethoxy)-ethoxy]-acetyl)2- (Y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-AFIEYLIAGG-NH2 282 3,999.58 N / I 274 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2ammo-ethoxy)-ethoxy]- acetyl)2-(y-Glu)-CO(CH2)16-CO2H)AQPAFIEYLIEGGPSSGnh2 283 4397.95 N / I 275 Y-Aib-EGTFTSD YS ILLDKK((2-[2-(2amino-ethoxy)-ethoxy]- acetyl)2-(y-Glu)-CO(CH2) 16-CO2H) AQPAFIEYLIEGG-NH2 284 4069.63 N / I 276 Y-Aib-EGT-ocMeF(2F)-TSDYSI-ocMeL- LDEKAQ-Aib-EFI- (D-Glu)- YLIEGGPS S G APPPS -NH2 285 4224.59 N / I 277 Y-Aib-EGT-ocMeF(2F)-TSDYSI-aMeL- LDEQAQ-Aib-EFI-(D-Glu)- YLIEGGPS S G APPPS - NH2 286 4224.55 N / I Χ-21852 278 Y-Aib-EGT-ocMeF(2F)-TSDYSl-otMeL- LDEKAQ-Aib-EFI-(D-Glu)- YLIEGGPSSGAPPPSC-NH2 287 4327.74 N / I 279 Y-Aib-EGT-a.MeF(2F) )-TSDYSI-aMeL- LDEQAQ-Aib-EFI-(D-Glu)- YLIEGGPSSGAPPPSC-NH2 288 4327.69 N / I 280 Y- Aib-EGT-aMeF(2F)-TSD YS I-aMel 40 - Orn-KAQ -Aib-EFI-(D-Glu)- YLIEGGPS S G APPPS -NH2 289 4210.61 N / I 281 Y-Aib-EGT-ocMeF(2F)-TSDYSI-aMeL-LD- Orn-QAQ-Aib-EFI-( D-Glu)- YLIEGGPS S G APPPS -NH2 290 4209.58 N / I 282 Y-Aib-EGT-aMeF(2F)-TSDYSI-ocMeL-LD- Orn-KAQ-Aib-EFI-(D-Glu)- YLIEGGPSSGAPPPSC -NH2 291 4312.77 N / I 283 Y-Aib-EGT-ocMeF(2F)-TSDYSI-otMeL-LD- Orn-QAQ-Aib-EFI-(D-Glu)- YLIEGGPSSGAPPPSC-NH2 292 4312.73 N / I 284 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-ocMeL- LD-Orn-KAQ-Aib-EFI-(D-Glu)-aMeY- LIEGGPS S GAPPPS -NH2 293 4208.64 N / I 285 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-SI-ocMeL-LD-Orn-QAQ-Aib-EFI-(D-Glu)-otMeY- LIEGGPS SGAPPPS -NH2 294 4208.6 N / I 286 Y-Aib-EGT-ocMeF(2F)-TSD-4Pal-SI-otMeL-LD-Orn-KAQ-Aib-EFI-(D-Glu)-o(.MeY-LIEGGPSSGAPPPSC-NH2 295 4311.78 N / I 287 Y-Aib-EGT-ot.MeF(2F)-TSD-4Pal-SI-o(.MeL-LD-Orn-QAQ-Aib-EFI-(D-Glu)-ocMeY-LIEGGPSSGAPPPSC-NH2 296 4311 .74 N / I Ν / Ι means Not Included Χ-21852 -75FR / nnn / Lznz / e / YiAi Example 288 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)i8CO2H)AQ-Aib-AFIEYLIAGGPSSGAPPPS-NH2 (SEQ ID NO:303) The structure of SEQ ID NO:303 is represented below using the standard single letter amino acid codes with the exception of residues Aib2, K17, Aib20 and Ser39, where the structures of these amino acid residues have been expanded: The compound according to SEQ ID NO:303 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 10 -- 1602.5: Cale M+3 - 1602.8). Example 289 Y-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-EFIEYLIAGGPSSGAPPPS -NH2 (SEQ ID NO:304) The structure of SEQ ID NO:304 is represented below using the standard single-letter amino acid codes with the exception of residues Aib2, aMeL13, K17, Aib20 and Ser39, where the structures of these amino acid residues have expanded: either The compound according to SEQ ID NO:304 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 - 1626.8; Cale M+3 - 1626 ,8). Χ-21852 -76FR / nnn / Lznz / e / YiAi Example 290 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)CO-(CH2)i8-CO2H )AQ-Aib-EFIEYLIAGGPSSGAPPPS-NH2 (SEQ ID NO:305) The structure of SEQ ID NO:305 is represented below using the standard 5 single letter amino acid codes with the exception of residues D-Tyrl, Aib2, aMeL13, K17, Aib20 and Ser39, where the structures of these amino acid residues h IAGGPSSGAPP P-N NH,HO The compound according to SEQ ID NO:305 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC MS (obsd: M+3 — 1626.6; Cale M+3 — 1626, 8). Χ-21852 -77pR / nnn / Lznz / e / YiAi Example 291 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(YGlu)-CO-(CH2) i8-CO2H)AQ-Aib-AFI-(D-Glu)-YLIAGGPSSGAPPPS-NH2 (SEQ ID NO:306) The structure of SEQ ID NO:306 is shown below using the standard single letter amino acid codes with the exception of the residues D-Tyrl, Aib2, aMeL13, Omló, K17, Aib20, D-Glu24 and Ser39, where the structures of these amino acid residues have been expanded: The compound according to SEQ ID NO:306 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 = 1602.4; Cale M+3 = 1602 ,8). FR / nnn / Lznz / e / YiAi Χ-21852 -78Example 292 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)CO-(CH2)i8- CO2H)AQ-Aib-EFIE-aMeY-LIAGGPSSGAPPPS-NH2 (SEQ ID NO:307) The structure of SEQ ID NO:307 is shown below using the standard single letter amino acid codes with the exception of residues D-Tyrl, Aib2, aMeL13, K17, Aib20, aMeY25 and Ser39, where the structures of these amino acid residues have been expanded: The compound according to SEQ ID NO:307 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 = 1631.3; Cale M+3 = 163 L5 > Example 293 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(YGlu)-CO-(CH2) i8-CO2H)AQ-Aib-EFIE-aMeY-LIAGGPSSGAPPPS-NH2 (SEQ ID NO:308) The structure of SEQ ID NO:308 is shown below using the standard single letter amino acid codes with the exception of residues D-Tyrl, Aib2, aMeL13, Oml6, K17, Aib20, aMeY25 and Ser39, where the structures of these amino acid residues have been expanded: o J NH C γ* o H H O £ X Í H H«N g t f t soys í-N YL d-n. “ tt o o O 0 JL NH H 5 r / i o r u 'X X ^~A Q-N F । E-N'Tj-L IAGGPSSGAPP P-N'TpNHj ; H O K O M O H O FR / nnn / Lznz / e / YiAi Χ-21852 -79Ε1 compound according to SEQ ID NO:308 is prepared substantially as described by the procedures of Example 1. The molecular weight is determined by LC-MS (obsd: M+3 - 1626.5; Cale M+3 = 1626.8). Example 294 through Example 381 Compounds according to Examples 294 (SEQ ID NO:309) through Example 381 (SEQ ID NO:396) are prepared substantially as described by the procedures of Example 1. Χ-21852 Example Compound name SEQ ID NO Calculated PM (average) Found PM (average) 294 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO (CH2)16-CO2H)AQQAFIEYLIEGG-NH2 309 4100.6 N / I 295 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO (CH2) i 6-CO2H) aqhafieyliegg-nh2 310 4109.7 N / I 296 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO(CH2)i6-CO2H)AQKAFIEYLIEGGPSSGnh2 311 4429.0 N / I 297 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO( CH2) i 6-CO2H) AQ-Aib-EFIE YLIAGG-NH2 312 4057.6 N / I 298 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y -Glu)-CO(CH2) i 6-CO2H) AQ- Aib- AFVE YLIEGGPS S G-NH2 313 4313.9 N / I 299 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy ]-acetyl)2-(y-Glu)-CO(CH2) i 6-CO2H) AQ- AibAFLEYLIEGGPSSG-NH2 314 4385.9 N / I 300 Y-Aib-EGTFTSDYSI-otMeL-LDKK((2-[2( 2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 6-CO2H) AQ- Aib-AFIE YLIEGGPSS Gnh2 315 4400.0 N / I 301 Y-Aib-EGT- otMeF-TSDYS ILLDKK((2- [2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 6-CO2H) AQ- Aib-AFIE YLIEGGPS S Gnh2 316 4400 .0 4399.2 FR / nnn / Lznz / e / YiAi Χ-21852 -81FR / nnn / Lznz / e / YiAi 302 Y-Aib-EGT-aMeF(2F)-TSDYSlLLDKK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)CO-(CH2)i6-CO2H)AQ- Aib- AFIE YLIEGGPS S G-NH2 317 4418.0 N / I 303 Y-Aib-EGTFTSDYSI-o.MeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y -Glu)-CO(CH2) i 6-CO2H) AQ- Aib-AFIE YLIEGGPSS Gnh2 318 4400.9 4400.7 304 Y-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2(2-amino-ethoxy) -ethoxyJ-acetyl)2-(Y-Glu)-CO(CH2) 16-CO2H)AQ-Aib-EFIE YLIEGGPS S Gnh2 319 4458.0 N / I 305 Y-Aib-EGTFTSDYSI-otMeL-LDKK((2- [2- (2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2) 16-CO2H)AQ-Aib-AFIE YLIAGGPS S Gnh2 320 4341.9 N / I 306 Y- Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2) 16-CO2H)AQ-Aib-EFIE YLIAGGPS S Gnh2 321 4400.0 N / I 307 Y-Aib-EGT-aMeF-TSDYSILLDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2) 16 -CO2H)AQ-Aib-AFIE YLIEGGPS S Gnh2 322 4400.9 N / I 308 Y-Aib-EGT-otMeF-TSDYS ILLDKK((2- [2(2-amino-ethoxy)-ethoxy]-acetyl)2- (Y-Glu)-CO(CH2) 16-CO2H) AQ- Aib-EFIE YLIEGGPS S Gnh2 323 4458.0 N / I 309 Y-Aib-EGT-otMeF-TSDYS ILLDKK((2- [2(2-amino -ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO- 324 4341.9 N / I Χ-21852 -82FR / nnn / Lznz / e / YiAi (CH2) i 6-CO2H) AQ- Aib-AFIE YLIAGGPS S Gnh2 310 Y-Aib-EGT-otMeF-TSDYS ILLDKK((2- [2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y -Glu)-CO(CH2) i 6-CO2H)AQ-Aib-EFIE YLIAGGPS S Gnh2 325 4400.0 N / I 311 Y-Aib-EGT-a.MeF(2F)-TSDYSILLDEK((2- [2- (2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)- CO-(CH2)i6-CO2H)AQ-Aib- AFIE YLIEGGPS S G-NH2 326 4418.9 N / I 312 Y- Aib-EGT-aMeF(2F)-TSD YS ILLD KK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)CO-(CH2)i6-CO2H)AQ- Aib- EFIEYLIEGGPSSG-NH2 327 4476.0 N / I 313 Y-Aib-EGT-aMeF(2F)-TSD YS ILLD KK((2[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-( y-Glu)CO-(CH2)i6-CO2H)AQ-Aib- AFIE YLIAGGPS S G- NH2 328 4359.9 N / I 314 Y-Aib-EGT-ocMeF(2F)-TSD YS ILLD KK((2[ 2-(2-amino-ethoxy)-ethoxyJ-acetyl)2-(y-Glu)CO-(CH2)16-CO2H)AQ- Aib- EFIE YLIAGGPS S G-NH2 329 4418.0 N / I 315 Y- Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib- AFIE YLIEGGPS S G APPPS -NH2 330 4835, 5 N / I 316 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO- (CH2)i6-CO2H)AQ-Aib - AFIE YLIAGGPS S G APPPS -NH2 331 4777.4 4777.2 Χ-21852 -83FR / nnn / Lznz / e / YiAi 317 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i s-CO2H)AQ-Aib-AFIE YLIAGGPS S Gnh2 332 4356.0 N / I 318 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) 1s-CO2H)AQ- Aib-EFIE YLIAGGPS S GNH2 333 4414.0 N / I 319 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8 -CO2H)AQ- Aib- EFIE YLIAGGPS S GAPPPS -NH2 334 4863.5 N / I 320 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu )-CO(CH2) 16-CO2H) AQ- Aib-DFIE YLIEGGPSS Gnh2 335 4430.0 N / I 321 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2- (y-Glu)-CO(CH2) 16-CO2H) AQ-Aib-TFIE YLIEGGPS S Gnh2 336 4416.0 N / I 322 Y-Aib-EGTFTSDYSILLDKK((2-[2-(2- amino-ethoxy)- ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib-HFIEYLIEGGPSSGnh2 337 4452.0 N / I 323 Y-Aib-EGTFTSDYSI-o.MeL-LDEK((2-[ 2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 338 4850.4 N / I 324 Y- Aib-EGTFTSDYSI-o.MeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO- 339 4819.5 N / I Χ-21852 -84pR / nnn / Lznz / e / γΐΛΐ (CH2) i 8-CO2H) AQ-Aib- AFIE YLIAGGPS S G APPPS -NH2 325 Y-Aib-EGT-otMeF(2F)-TSD YS ILLD KK((2[2-(2-amino-ethoxy)-ethoxy] -acetyl)2-(y-Glu)CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 340 4895.5 N / I 326 F- Aib-EGTFTSD YSILLDKK((2-[2- (2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 341 4847.5 N / I 327 F-Aib-EGTFTSD YSI-aMeL-LDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 342 4861.5 N / I 328 F- Aib-EGTFTSD YSI-aMeL-LDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i6-CO2H )AQ-Aib- AFIE YLIEAGPS S GAPPPS -NH2 343 4847.5 N / I 329 (D-Tyr)-Aib-EGT-aMeF- TSDYSILLDKK((2-[2-(2-amino-ethoxy)ethoxyJ-acetyl) 2-(y-Glu)-CO-(CH2)i8- CO2H)AQ-Aib-AFIE YLIEGGPS S GAPPPS nh2 344 4877.5 N / I 330 Y-Aib-EGTFTSDYSILLDEK((2-[2-(2amino-ethoxy )-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIE YLI AGGPS S GAPPPS -NH2 345 4806.4 4805.4 331 Y-Aib-EGTFTSDYSI-aMeL- LDEK((2-[2(2-amino-ctoxy)-ctoxy]-acctil)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 346 4878.5 NEITHER Χ-21852 -85FR / nnn / Lznz / e / YiAi 332 Y-Aib-EGTFTSDYSl-ocMeL-LDEK((2-|2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIE YLIAGGPS S GAPPPS -NH2 347 4820.4 N / I 333 Y-Aib-EGTFTSDYSI-ocMeL-LDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO (CH2)is-CO2H)AQ-Aib- EFIE YLIEGGPS S GAPPPS -NH2 348 4935.6 N / I 334 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL- LDKK((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 349 4877.5 N / I 335 (D-Tyr)-Aib- EGT-aMeF-TSDYSI-ocMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)i8-CO2H)AQ-AibAFIE YLIEGGPS S GAPPPS - NH2 350 4891.6 N / I 336 (D-Tyr)-Aib-EGT-aMeF(2F)-TSDYSIaMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y -Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLIEGGPS S GAPPPS -NH2 351 4909.5 N / I 337 F-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2amino- ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- AFIE YLI AGGPS S GAPPPS -NH2 352 4803.5 N / I 338 F-Aib-EGTFTSDYSI-aMeL -LDKK((2-[2-(2amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 353 4861.5 N / I 339 Y-Aib-EGTFTSDYSI-ocMeL-LDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)-(y-Glu)-CO- 354 4732.4 4732.2 Χ-21852 -86FR / nnn / Lznz / e / YiAi (CH2) i 8-CO2H) AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 340 (D-Tyr)-Aib-EGTFTSDYSI-ctMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]- acetyl)2- (y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLIAGGPS S GAPPPS -NH2 355 4819.5 4818.8 341 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL- LDEK ((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLIAGGPS S GAPPPS -NH2 356 4820, 4 N / I 342 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL- LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (y-Glu)-CO-(CH2 )i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 357 4878.5 N / I 343 Y-Aib-EGTFTSDYSI-ocMeL-LDEK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl )2-(y-Glu)-CO(CH2)i8-CO2H)AQ-Aib-AFI-(D-Glu)YLIAGGPSSGAPPPS-NH2 358 4820.4 N / I 344 Y-Aib-EGTFTSDYSI-ocMeL-LDEK(( 2-[2(2-amino-ethoxy)-ethoxyJ-acetyl)2-(y-Glu)-CO(CH2) 18-CO2H)AQ- Aib- DFIE YLIAGGPS S GAPPPS -NH2 359 4864.4 N / I 345 (D-Tyr)-Aib-EGT-ocMeF TSDYSI-ocMeLLDKK((2-[2-(2-ammo-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H) AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 360 4891.6 N / I 346 (D-Tyr)-Aib-EGTFTSDYSI-o(.MeL-LD-Orn- K((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AF1E Y L1AGGPS S GAPPPS -NH2 361 4805.5 4804.8 Χ-21852 -87pR / nnn / Lznz / e / Yi / u 347 (D-Tyr)-Aib-EGTFTSDYSLocMeL-LD-DabK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i8-CO2H)AQ -Aib- AFIE YLIAGGPS S GAPPPS -NH2 362 4791.4 N / I 348 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-Dap- K((2-[2-(2-amino-ethoxy)-ethoxy ]-acetyl)2-(y- Glu)-CO-(CH2)i8-CO2H)AQ-Aib- AFIE YLI AGGPS S GAPPPS -NH2 363 4807.5 N / I 349 (D-Tyr)-Aib-EGTFTSDYSI- ocMeL-LD-OrnK((2-L2-(2-amino-ethoxy)-ethoxyJ-acetyl)2-(yGlu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 364 4863 .5 4862.7 350 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-Dab-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu) -CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 365 4849.5 N / I 351 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LD-Dap- K((2-[ 2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EF1E YLIAGGPS S GAPPPS -NH2 366 4835.5 N / I 352 (D-Tyr)-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ -Aib-AFI-(DG1u)-YLIAGGPSSGAPPPS-NH2 367 4819.5 N / I 353 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LDKK((2-[2-(2-amino-ethoxy)-ethoxy] -acetyl)2(y-Glu)-CO-(CH2)is-CO2H)AQ-Aib-EFI-(D- Glu)- YLIEGGPS S GAPPPS -NH2 368 4935.6 N / I 354 (D-Tyr)- Aib-EGTFTSDYSI-aMeL-LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- 369 4863.5 N / I Χ-21852 -88FR / nnn / Lznz / e / YiAi Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D- Glu)- YLIAGGPS S G APPPS -NH2 355 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-OrnK((2-[ 2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i8-CO2H)AQ-Aib-EFI-(D-Glu)- YLIEGGPS S G APPPS -NH2 370 4921, 5 N / I 356 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2- (y-Glu)-CO-(CH2 )i8-CO2H)AQ-Aib-AFI-(D-Glu)- YLIEGGPS S G APPPS -NH2 371 4877.5 N / I 357 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-OrnK((2-[ 2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yG1u)-CO-(CH2) i 8-CO2H) AQ- Aib-AFI-(DGlu)- YLIEGGPS S G APPPS -NH2 372 4863.5 N / I 358 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO -(CH2) i s-CO2H) AQ-Aib- AFVE YLIAGGPS S G APPPS -NH2 373 4791.4 N / I 359 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-ED-Orn- K((2-[2 -(2-amino-ethoxy)-ethoxyJ-acetyl)2-(y- Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFVE YLIAGGPS S G APPPS -NH2 374 4849.5 N / I 360 (D -Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i8- CO2H)AQ-Aib- AFVE YLIEGGPS S G APPPS -NH2 375 4849.5 N / I 361 (D-Tyr)-Aib-EGTFTSDYSI-o(.MeL- LDKK((2-[2-(2-amino-ethoxy) -ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-AFV-(DGlu)-YL1AGGPSSGAPPPS-NH2 376 4805.5 N / I Χ-21852 -89pR / nnn / Lznz / e / γΐΛΐ 362 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-OrnK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i8-CO2H )AQ-Aib-AFV-(DGlu)-YLIAGGPSSGAPPPS-NH2 377 4791.4 N / I 363 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-Orn-K((2-[2-(2-amino -ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i6-CO2H)AQ-Aib-AFI-(D- Glu)- YLIAGGPS S GAPPPS -NH2 378 4777.4 N / I 364 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-OrnK((2-[2-(2-amino-ethoxy)-ethoxyJ-acetyl)2-(yGlu)-CO-(CH2)i6-CO2H) AQ-Aib-AFV-(DGlu)-YLIAGGPSSGAPPPS-NH2 379 4763.4 N / I 365 (D-Tyr)-Aib-EGTFTSDYSI-ocMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]- acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-AFIEaMeY-LIAGGPS SGAPPPS -NH2 380 4833.5 4832.4 366 (D-Tyr)-Aib-EGTFTSDYSI-aMcL-LD -OrnK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i8-CO2H)AQ-Aib-AFlEaMeY-LIAGGPS S GAPPPS -NH2 381 4819 .5 4818.3 367 Y-Aib-EGTFTSDYSI-aMeL-LDKK((2-[2(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO(CH2) i 8-CO2H ) AQ-Aib-EFIE-aMe YLIAGGPS S GAPPPS -NH2 382 4891.6 N / I 368 (D-Tyr)-Aib-EGTFTSDYSI-otMeL-LD-Orn- K((2-[2-(2-amino- ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i6-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 383 4835.5 N / I 369 (D-Tyr)-Aib -EGTFTSDYSI-otMeL-LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y- 384 4849.5 N / I Χ-21852 -90pR / nnn / Lznz / e / γΐΛΐ Glu)-CO-(CH2)is-CO2H)AQ-Aib- DFIE YLIAGGPS S GAPPPS -NH2 370 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-Orn- K((2-[2-(2- amino-ethoxy)-ethoxy]-acetyl)2-(y- Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S G-NH2 385 4414.0 N / I 371 (D-Tyr) -Aib-EGTFTSDYSI-ccMeL-LD-Orn- K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)-(y-G1u)-CO-(CH2) i 8-CO2H) AQ - Aib- EFIE YLIAGGPS S GAPPPS -NH2 386 4718.3 N / I 372 (D-Tyr)-Aib-EGTFTSDYSI-ccMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)(y -Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFIEotMeY-LIAGGPS S GAPPPS -NH2 387 4746.4 N / I 373 (D-Tyr)-Aib-EGTFTSDYSI-ocMeLLDKK((2-[2- (2-amino-ethoxy)-ethoxy]-acetyl)(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-AFIEaMeY-LIAGGPS S GAPPPS -NH2 388 4,688.3 N / I 374 (D- Tyr)-Aib-EGTFTSDYSLccMeLLDKK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-EFIEaMeY-LIAGGPS S GAPPPS -NH2 389 4863.5 N / I 375 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-OrnK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu )-CO-(CH2)i6-CO2H)AQ-Aib-EFIEaMeY-LIAGGPS S GAPPPS -NH2 390 4849.5 N / I 376 (D-Tyr)-Aib-EGTFTSDYSI-aMeL- LDKK((2-[2- (2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i6-CO2H)AQ-Aib-AFIE- aMeY-LIAGGPS S GAPPPS -NH2 391 4805.5 N / I Χ-21852 -91FR / nnn / Lznz / e / YiAi 377 (D-Tyr)-Aib-EGTFTSDYSI-ocMeL-LD-OrnK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i6-CO2H )AQ-Aib-AFIEaMeY-LIAGGPS S G APPPS -NH2 392 4791.4 4790.7 378 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL- LDKK((2-[2-(2-amino-ethoxy)-ethoxy] -acetyl)- (y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib- EFIE YLIAGGPS S GAPPPS -NH2 393 4732.4 N / I 379 (D-Tyr)-Aib-EGTFTSDYSI-ccMeLLDKK(( 2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-EFIEocMeY-LIEGGPS SGAPPPS -NH2 394 4949.5 N / I 380 (D-Tyr)-Aib-EGTFTSDYSI-ccMeL-LD-OrnK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(yGlu)-CO-(CH2)i8 -CO2H)AQ-Aib-EFIEaMeY-LIEGGPS S GAPPPS -NH2 395 4935.5 N / I 381 (D-Tyr)-Aib-EGTFTSDYSI-otMeLLDEK((2-L2-(2-amino-ethoxy)-ethoxyJ-acetyl )2(y-Glu)-CO-(CH2)i8-CO2H)AQ-Aib-AFIEaMeY-LIAGGPS SGAPPPS -NH2 396 4934.4 N / I Ν / Ι means Not Included binding assays Glucagon (referred to as Gcg) is a reference standard prepared at Eli Lilly 5 and Company. GLP-1, 7-36-NH2 (referred to as GLP-1) is obtained from CPC Scientific (Sunnyvale, CA, 97.2% purity, 100 µM aliquots in 100% DMSO). GIP 1-42 (referred to as GIP) is prepared at Lilly Research Laboratories using peptide synthesis and HPLC chromatography as described previously (>80% purity, 100 μΜ aliquots in 100% DMSO). [ 125 I] radiolabeled Gcg, GLP-1 or GIP is prepared using [ 125 I] lacteroxidase and obtained from Perkin Elmer (Boston, MA). Χ-21852 -92FR / nnn / Lznz / e / YiAi Stably transfected cell lines are prepared by subcloning the receptor cDNA into a pcDNA3 expression plasmid and transfected into human embryonic kidney (HEK) 293 (hGcgR and hGLP-IR) or Chinese hamster ovary (CHO) (hGIPR) cells. followed by selection with geneticin (hGLP-IR and hGIPR) or hygromycin B (hGcgR). Two methods are used for the preparation of crude cell membranes. Method 1: Frozen cell pellets are lysed on ice in hypotonic buffer containing 50 mM Tris HC1, pH 7.5, and Roche Complete™ EDTA protease inhibitors. The cell suspension is broken using a Potter-Elvehjem glass homogenizer fitted with a Teflon® mortar in 25 strokes. The homogenate is centrifuged at 4 °C at 1,100 x g for 10 minutes. The supernatant is collected and stored on ice, while the pellets are resuspended in homogenization buffer and rehomogenized as described above. The homogenate is centrifuged at 1,100 x g for 10 minutes. The second supernatant is combined with the first supernatant and centrifuged at 35,000 x g for 1 hour at 4°C. The resulting membrane pellet is resuspended in homogenization buffer containing protease inhibitors at approximately 1 to 3 mg / mL, snap frozen in liquid nitrogen, and stored as aliquots in a -80°C freezer until use. Method 2: Frozen cell pellets are lysed on ice in hypotonic buffer containing 50 mM Tris HC1, pH 7.5, 1 mM MgCh, Roche Complete™ non-EDTA protease inhibitors, and 25 units / mL DNase I (Invitrogen). . The cell suspension is broken using a Potter-Elvehjem glass homogenizer fitted with a Teflon® mortar in 20 to 25 strokes. The homogenate is centrifuged at 4 °C at 1,800 x g for 15 minutes. The supernatant is collected and stored on ice, while the pellets are resuspended in homogenization buffer (without DNase I) and rehomogenized as described above. The homogenate is centrifuged at 1,800 x g for 15 minutes. The second supernatant is combined with the first supernatant and centrifuged an additional time at 1,800 x g for 15 minutes. The bulk supernatant is then centrifuged at 25,000 x g for 30 minutes at 4°C. The resulting membrane pellet is resuspended in homogenization buffer (without DNase I) containing protease inhibitors at approximately 1 to 3 mg / mL and stored as aliquots in a -80°C freezer until use. pR / nnn / Lznz / e / YiAi binding determination methods Χ-21852 -93 Equilibrium binding dissociation constants (Kd) for the various receptor / radioligand interactions are determined from analysis of homologous competition binding rather than saturation binding due to the high propanol content in the [125I] stock material . The Kd values ​​determined for the receptor preparations were as follows: hGcgR (3.9 nM), hGLP-lR (1.2 nM) and hGIPR (0.14 nM). r125H-glucagon binding Human Gcg receptor binding assays are performed using a scintillation proximity assay (SPA) format with wheat germ agglutinin (WGA) beads (Perkin Elmer). Binding buffer contains 25 mM 4-(2-hydroxyethyl)-lpiperazineethanesulfonic acid (HEPES), pH 7.4, 2.5 mM CaCh, 1 mM MgCl 2 , 0.1% (w / v) bacitracin (Products research), polyoxyethylene sorbitan monolaurate (TWEEN®20) 0.003% (w / v) and Roche Complete™ protease inhibitors without EDTA. Peptides and Gcg are thawed and serially diluted 3-fold in 100% DMSO (10 point concentration response curves). Next, 5 µl of serially diluted compound or DMSO is transferred to Corning® 3632 clear bottom assay plates containing 45 µl of unlabeled Gcg control or assay binding buffer (non-specific binding or NSB, at 1 pM final). ). Then, 50 µl of [125I]-Gcg (0.15 nM final), 50 µl of human GcgR membranes (1.5 pg / well) and 50 µl of SPA WGA beads (80 to 150 pg / well) are added. well) with a Biotek Multiflo dispenser. Plates are sealed and mixed on a plate shaker (setting 6) for 1 minute and read with a PerkinElmer Trilux MicroBeta® scintillation counter after 12 hours incubation / settling time at room temperature. Final assay concentration ranges for peptides tested in response curves are typically 1,150 nM to 0.058 nM and for the Gcg control 1,000 nM to 0.05 nM. F125I1-GLP-1 Union The human GLP-1 receptor binding assay is performed using a SPA format with WGA beads. Binding buffer contains 25 mM HEPES, pH 7.4, 22.5 mM CaCl, 21 mM MgCl, 0.1% (w / v) bacitracin, 0.003% (w / v) TWEEN®-20, and inhibitors of Roche Complete™ protease without EDTA. Peptides and GLP-1 are thawed and serially diluted 3-fold in 100% DMSO (10 point concentration response curves). Next, 5 pl of serially diluted compound or DMSO is transferred to Χ-21852 -943632 Corning® Clear Bottom Assay Plates containing 45 μΐ of unlabeled GLP-1 Assay or Control Binding Buffer (non-specific binding or NSB, at 0.25 μΜ final). Then, 50 μΐ of [125I]-GLP-1 (0.15 nM final), 50 μΐ of human GLP-1R membranes (0.5 pg / well) and 50 μΐ of WGA SPA beads (100 at 150 pg / well) with a Biotek Multiflo dispenser. Plates are sealed and mixed on a plate shaker (setting 6) for 1 minute and read with a PerkinElmer Trilux MicroBeta® scintillation counter after 5 to 12 hours incubation / settling time at room temperature. Final assay concentration ranges for peptides tested in response curves are typically 1150 nM to 0.058 nM and for the GLP-1 control 250 nM to 0.013 nM. Binding of Γ12511-GIP The human GIP receptor binding assay is performed using a SPA format with WGA beads. Binding buffer contains 25 mM HEPES, pH 7.4, 2.5 mM CaC12, 1 mM MgCh, 0.1% (w / v) bacitracin, 0.003% (w / v) TWEEN®-20, and Roche Complete™ protease inhibitors without EDTA. Peptides and GIP are thawed and serially diluted 3-fold in 100% DMSO (10 point concentration response curves). Next, 5 μΐ of serially diluted compound or DMSO is transferred to Corning® 3632 Clear Bottom Assay Plates containing 45 μΐ of unlabeled GIP Control or Assay Binding Buffer (Non-Specific Binding or NSB, at 0.25 end μΜ). Then, 50 μΐ of [125I]-GIP (0.075-0.15 nM final), 50 μΐ of human GIPR membranes (3 pg / well), and 50 μΐ of SPA WGA beads (100 to 150 pg / well) are added. well) with a Biotek Multiflo dispenser. Plates are sealed and mixed on a plate shaker (setting 6) for 1 minute and read with a PerkinElmer Trilux MicroBeta® scintillation counter after 2.5 to 12 hours incubation / settling time at room temperature. Final assay concentration ranges for peptides tested in response curves are typically 1150 nM to 0.058 nM or 115 nM to 0.0058 and for the GIP control 250 nM to 0.013 nM. Analysis of binding assay data Primary CPM data for peptide, Gcg, GLP-1, or GIP concentration curves are converted to percent inhibition by subtracting nonspecific binding (binding on FR / nnn / Lznz / e / YiAi Χ-21852 -95FR / nnn / Lznz / e / YiAi presence of excess unlabeled Gcg, GLP-1, or GIP, respectively) from individual CPM values ​​and divide by total binding signal, also corrected by subtracting binding Not specific. Data are analyzed using four parameter nonlinear regression routines (maximum curve, minimum curve, IC50, Hill slope) (Genedata Screener, version 12.0.4, Genedata AG, Basal, Switzerland). The affinity constant (Ki) is calculated from the absolute IC50 value based on the equation Ki = ICso / (l + D / Ka) where D is the concentration of radioligand used in the experiment, IC50 is the concentration that produces a 50% inhibition of binding and Ka is the equilibrium binding dissociation constant of the radioligand (described above). Ki values ​​are reported as the geometric mean, with the error expressed as the standard error of the mean (SEM) and n equals the number of independent replicates (determined in analyzes performed on different days). The geometric means are calculated as follows: Geometric mean = 10 (Arithmetic mean of the Log values ​​of Ki)) The ratio of Ki (Ki for the native control peptide / Ki for the test compound) in each recipient and in each species is calculated. The Ki Ratio is a quick indicator of the apparent affinity of a peptide compared to the native control peptide. A Ki Ratio < 1 indicates that the test peptide has a lower affinity (higher Ki value) for the receptor than the native peptide, while a Ki Ratio > 1 indicates that the test peptide has a higher affinity (lower Ki value). Ki) by the receptor than the native peptide. n=l / x means that only one value of the total number of replicates (x) is used to express the mean. SEM is calculated only when n=2 or when there are larger unqualified results. Means are expressed as geometric means with the standard error of the mean (SEM) and the number of replicates (n) indicated in parentheses. Χ-21852 -96Table 1. In vitro binding affinity (Ki) of the listed examples and comparative molecules for human GLP-1R, GcgR and GIPR. Example or Comparator hGLcgR Ki, nM (SEM, n) hGIPR Ki, nM (SEM, n) hGLPIR Ki, (nM) (SEM, n) hGcg 3.65 (0.26, n=10) hGIP amide 0, 0922 (0.0085, n=11) hGLP-1 amide 0.614 (0.066, n=12) 1207 (13.8, n=5) 0.0546 (0.0120, n=5) 6.67 ( 1.25, n=6) 2361 (55.1, n=5) 0.0600 (0.0150, n=5) 2.35 (0.220, n=5) 3242 (56.2, n= 6) 0.0458 (0.00357, n=6) 2.23 (0.366, n=6) 4 686 (n=l / 5) 0.0528 (0.00647, n=5) 1.63 (0.260 , n=5) 5 519 (109, n=4) 0.0611 (0.00592, n=4) 0.902 (0.114, n=4) 6 55.8 (10.2, n=2) 0.0835 (0.00437, n=2) 6.71 (1.25, n=2) 7 198 0.252 43.3 8 206 (25.7, n=2) 0.0772 (0.0155, n=2) 2.84 (0.753, n=2) 9 375 (87.5, n=2) 0.127 (0.0118, n=2) 14.9 (2.15, n=2) 10 226 (67.4, n=2) 0.109 (0.0927, n=2) 9.33 (1.49, n=2) 11 174 (25.3, n=2) 0.226 (0.0728, n=2) 15.7 (4.37, n=2) Χ-21852 12 684 (141, η=2) 0.167 (0.0853, η=2) 12.9 (2.71, η=2) 13 >1060 (η=1 / 2) 0.296 (0.0291, η=2 ) 31.1 (11.9, η=2) 14 160 0.0494 29.6 15 130 0.284 2.19 16 371 0.0841 2.78 17 261 (115, η=2) 0.606 (0.363, η= 2) 7.63 (2.47, η=2) 18 50.1 0.0798 0.319 19 60.5 0.0518 0.24 20 228 (65.3, η=2) 0.0849 (0.0168 , η=2) 3.30 (1.01, η=2) 21 149 0.529 14.5 22 53.4 0.624 23.1 23 >1010 0.258 6.32 24 49.8 0.232 5.04 25 81.1 0.179 4.8 26 >960 0.176 4.22 27 315 ​​0.103 3.68 28 >902 0.24 21.1 29 132 0.377 8 30 123 0.151 6.2 31 290 0.0275 6.58 32 44.7 0, 0205 3.96 33 >979 6.4 361 34 134 0.0467 3.41 35 >964 0.0358 54.6 36 413 0.141 16.4 37 255 0.0523 3.84 38 >974 0.104 31.3 Χ-21852 39 161 0.0499 16.8 40 150 0.0345 7.56 41 165 0.0551 13.4 42 160 0.0514 13.2 43 134 0.101 11.8 44 121 0.0516 10.6 45 11.1 0.0463 5.65 46 133 0.0852 13.4 48 111 0.074 15.7 49 236 0.087 12.3 50 220 (61.2, η=2) 0.0568 (0.00744, η=2) 4 .71 (1.22, η=2) 51 195 (65.9, η=2) 0.0620 (0.0131, η=2) 5.62 (0.658, η=2) 52 >1100 0.0342 5.81 53 216 0.188 1.23 54 333 0.965 1.66 55 >1100 6.24 7.29 56 >1060 0.148 10.3 57 26.1 (4.31, η=2) 0.0583 (0, 0131, η=2) 3.00 (0.293, η=2) 58 339 0.105 2.77 59 292 (11.8, η=2) 0.136 (0.00422, η=2) 8.20 (4.13 , η=2) 60 237 0.0655 9.55 61 110 0.102 11.1 62 168 0.0545 2.03 63 273 0.141 7.79 64 260 0.0866 4.86 65 194 0.0643 4.53 66 93.7 0.106 7.53 Χ-21852 67 270 0.061 10.2 68 99.2 0.0243 1.58 69 22.1 (4.18, η=3) 0.0300 (0.00657, η=3) 1.22 (0.353, η=3 ) 74 69.8 0.0279 5.99 75 283 0.103 24.4 76 14.4 0.0659 2.64 78 215 (66.2, η=3) 0.163 (0.0356, η=2) 3, 94 (1.21, η=2) 79 429 (η=1 / 2) 0.0313 2.69 80 347 (η=1 / 2) 0.0931 2.16 81 344 0.198 2.88 82 >1060 14 .9 6.82 83 320 0.142 7.1 84 >1100 0.143 10.2 85 >894 (η=1 / 2) 0.621 1.87 86 >1060 0.0401 3.74 87 278 (η=1 / 2) 0.0340 (0.00150, η=2) 1.79 (0.417, η=2) 88 545 (57.8, η=2) 0.0717 4.24 89 324 (22.9, η=2) 0.045 2.64 90 245 (7.55, η=2) 0.0472 4.76 91 540 1.8 5.23 93 15.7 0.0859 1.89 99 23.6 0.027 1.15 100 44 0.115 4.13 101 117 0.0953 8.1 103 40.3 0.0645 6.68 Χ-21852 -100- 104 123 (17.1, η=5) 0.0565 (0.0153, η=5) 3.91 (0.955, η=5) 105 20.4 0.119 0.871 106 515 0.179 1.2 107 303 0.0425 0.867 108 171 0.0732 3 109 43.1 0.0279 1.34 110 73.9 0.0395 4.38 115 9.89 0.0302 3.43 116 137 (13.9, η=2) 0, 0597 (0.0486, η=2) 6.80 (1.85, η=2) 117 192 (14.6, η=3) 0.0497 (0.0111, η=3) 6.96 (1 .95, η=3) 118 53.0 (7.07, η=3) 0.0859 (0.00402, η=3) 6.10 (0.870, η=3) 119 30.6 0.0925 9 .87 120 93.6 0.11 11.7 121 51.9 0.177 3.16 122 43.3 (8.07, η=2) 0.190 (0.0189, η=2) 3.36 (0.799, η =2) 123 80.1 (11.7, η=6) 0.0469 (0.00804, η=6) 1.31 (0.197, η=6) 124 41.5 (9.39, η=2 ) 0.0424 (0.00200, η=2) 4.87 (0.277, η=2) 125 54.4 (0.365, η=2) 0.0624 (0.0117, η=2) 3.19 ( 0.123, η=2) 126 101 (11.5, η=2) 0.0644 (0.0267, η=2) 1.46 (0.299, η=2) 127 43.6 0.126 1.86 128 433 ( 203, η=2) 0.0625 (0.0355, η=2) 1.88 (0.296, η=2) Χ-21852 -101FR / nnn / Lznz / e / YiAi 129 14.9 0.0278 1 130 >1060 0.177 3.66 133 216 0.157 11.4 (2.31, η=2) 134 60.5 0.14 12.7 (0.947, η=2) 135 454 0.161 3.01 137 98.1 (14.8, η=3) 0.0373 (0.00200, η=3) 1.24 (0.341, η=3) 138 61.2 (4.65, η=2 ) 0.0295 (0.00145, η=2) 0.926 (0.201, η=2) 139 105 (6.68, η=2) 0.0360 (0.00446, η=2) 1.25 (0, 0904, η=2) 140 175 (40.1, η=3) 0.0474 (0.00461, η=3) 1.46 (0.0630, η=3) 142 53.1 (1.60, η=2) 0.0275 (0.00210, η=2) 1.06 (0.300, η=2) 143 65.5 0.0304 1.15 144 77 0.0341 1.78 145 158 0.0652 2 .22 147 64.9 (19.9, η=2) 0.0981 (0.0285, η=2) 4.47 (0.742, η=2) 149 127 0.0708 26.1 150 63.2 0 .0649 30.5 152 93.4 0.117 48 153 43.8 0.0578 22.2 154 762 (51.7, η=3) 0.0610 (0.00457, η=3) 5.64 (2, 52, η=3) 157 179 (82.9, η=3) 0.0937 (0.0160, η=3) 8.97 (2.28, η=3) Χ-21852 -102FR / nnn / Lznz / e / YiAi 158 285 (17.4, η=2) 0.114 (0.0193, η=2) 11.8 (5.32, η=2) 160 >1060 (η-1 / 2) 5.98 (1.46 , η=2) 14.4 (3.72, η=2) 163 117 0.116 10.8 181 413 (132, η=2) 0.145 (0.0856, η=2) 7.28 (0.798, η= 2) 182 565 (335, η=2) 0.0669 (0.0311, η=2) 4.64 (0.655, η=2) 183 304 (128, η=2) 0.0869 (0.0118, η=2) 4.11 (0.369, η=2) 189 146 (7.81, η=2) 0.128 (0.0817, η=2) 8.81 (0.434, η=2) 191 348 (54, 7, η=2) 0.144 (0.0676, η=2) 4.52 (1.95, η=2) 192 >1110 (η=1 / 2) 0.118 (0.108, η=2) 2.89 ( 0.516, η=2) 202 394 0.0579 5.38 203 845 (η=1 / 2) 0.0337 (0.00260, η=2) 3.90 (1.10, η=2) 204 >1150 0.0704 1.9 205 438 0.0367 3.05 206 176 (126, η=2) 0.0814 (0.00608, η=2) 5.27 (0.359, η=2) 207 74.2 0 .0786 1.37 208 >1060 0.0537 2.13 209 >1060 (η=1 / 2) 0.0664 (0.0267, η=2) 1.43 (0.466, η=2) 210 >1010 0 .0399 1.58 211 131 0.0243 2.64 212 205 0.0978 2.76 Χ-21852 -103FR / nnn / Lznz / e / YiAi (1.77, η=2) (0.0730, η=2) (0.561, η=2) 213 544 0.365 2.75 214 126 0.0304 1.99 215 75.2 0.0666 6.85 216 45.2 0.0559 2.34 217 516 0.0376 2.02 218 270 0.0593 2.54 219 373 0.0689 2.01 220 377 0.0919 2.71 221 154 (η=1 / 2) 0.0414 (0.00291, η=2) 1.77 (0.900, η=2) 222 71.3 (11.9, η=2) 0.0495 (0.0210, η=2) 3.59 (0.660, η=2) 223 46.5 0.0921 5.62 224 627 (267, η=2) 0.0482 (0.0174, η=2) 6.86 (1.85, η=2) 225 714 (η=1 / 2) 0.0622 (0.0208, η=2) 8.79 (4.24, η=2) 226 200 0.0254 4.1 227 113 0.0146 2.01 228 182 0.028 2.43 229 >1100 2.47 36.2 230 494 0.042 4.68 231 440 0.0394 3.03 232 >1150 0.0544 5.62 233 >1150 0.0445 5.99 234 >1100 0 .0563 10.9 235 >1200 0.0581 7.65 236 200 (15.1, η=2) 0.0425 (0.00194, η=2) 1.05 (0.173, η=2) 237 >1060 0.131 1.04 Χ-21852 -104FR / nnn / Lznz / e / YiAi 238 230 0.0403 0.548 239 596 (215, η=3) 0.101 (0.0172, η=3) 2.71 (0.0420, η=3) 240 204 0.0284 0.552 241 167 (45.6, η=2) 0.0420 (0.0118, η=2) 0.799 (0.401, η=2) 242 95.9 (14.1, η=2) 0.0604 (0.00642, η=2) 0.853 (0 .0475, η=2) 243 145 (5.05, η=2) 0.0325 (0.00840, η=2) 0.670 (0.0478, η=2) 244 87.8 (2.39, η =2) 0.0308 (0.0150, η=2) 0.820 (0.141, η=2) 246 >1010 (η=1 / 3) 0.0509 (0.0147, η=3) 0.812 (0.0900 , η=3) 247 >1100 >55.1 4.39 248 >1050 0.0397 2.4 249 >1000 0.0394 2.35 250 198 0.0171 1.72 251 21.2 0.0249 1, 09 252 26 0.00971 0.383 253 >912 0.138 2.57 254 148 0.108 2.58 255 257 0.0772 2.58 264 388 0.015 0.412 265 567 0.0224 0.539 0.539 26) .0666 (0.0189, η=2) 2.01 (0.256, η=2) 267 349 (178, η=2) 0.0628 (0.00765, η=2) 1.57 (0.109, η= 2) 268 >1190 0.0814 3.98 269 >1100 0.152 7.1 Χ-21852 -105- 270 >1190 0.117 8.27 271 >1150 0.107 5.09 272 550 (243, η=2) 0.0353 (0.00276, η=2) 1.22 (0.291, η=2) 273 724 0.0698 1.13 288 345 (35.7, η=3) 0.0580 (0.0105, η=3) 1.60 (0.866, η=3) 289 >1050 (η=1 / 3) 0.0457 ( 0.0220, η=3) 2.63 (1.74, η=3) 290 308 (η=1 / 3) 0.0617 (0.0115, η=3) 2.44 (0.162, η=3 ) 291 >872 (η=1 / 2) 0.129 (0.0346, η=3) 3.16 (0.270, η=3) 292 595 0.0547 1.19 293 668 0.0775 1.64 294 629 0.205 2.92 295 >1000 0.181 4.12 296 >1000 0.444 3.33 297 >1240 0.0958 2.98 298 >1370 0.0578 3.03 299 >1040 0.734 54.3 300 251 0.0504 2.13 301 44.4 (6.17, η=3) 0.0273 (0.00127, η=3) 0.875 (0.0889, η=3) 302 18.5 0.0289 0.617 Χ-21852 -106- 303 502 (189, η=3) 0.0580 (0.0151, η=3) 3.69 (1.86, η=3) 304 >855 0.0499 4.44 305 352 (30.8, η =2) 0.0250 (0.00586, η=2) 0.830 (0.481, η=2) 306 >1040 0.0349 2.86 307 117 0.0773 5.1 308 94.2 0.0288 1.01 309 64.1 0.0264 1.04 310 174 (8.97, η=2) 0.0315 (0.00162, η=2) 1.70 (0.144, η=2) 311 115 0.0497 11, 5 312 106 0.0348 1.63 313 27.6 0.0261 0.815 314 116 0.027 0.717 315 ​​539 0.0677 2.28 316 654 (76.5, η=3) 0.0418 (0.00224, η= 3) 0.957 (0.180, η=3) 317 253 0.0215 2.63 318 730 (η=1 / 2) 0.0452 (0.00883, η=2) 7.52 (0.256, η=2) 319 >984 0.0349 3.61 Χ-21852 -107- 320> 1040 0.136 5,17 321 770 0.064 4.2 322 1,030 0.175 2.31 323 300 0.0516 1,65 324 449 0.0278 0.609 325 13 0.0209 0.475 326 207 0.251 2.92 327 327 114 (8, 8, 53, η=2) 0.0667 (0.0211, η=2) 2.10 (0.287, η=2) 328 >1450 (η=1 / 2) 0.136 (0.0602, η=2) 3, 98 (0.339, η=2) 329 17.0 (2.51, η=2) 0.0439 (0.0105, η=2) 3.28 (0.327, η=2) 330 >1050 0.114 12.7 331 > 969 (η=1 / 2) 0.0851 (0.00508, η=2) 11.4 (0.160, η=2) 332 397 (272, η=2) 0.0497 (0.00681, η =2) 7.87 (0.333, η=2) 333 578 (68.8, η=2) 0.0634 (0.00255, η=2) 4.25 (0.180, η=2) 334 192 0, 0646 2.17 335 27.1 0.0444 2.54 Χ-21852 -108- 336 17.1 0.0277 2.44 337 335 0.0363 1.61 338 >1060 0.0831 3.23 339 873 (19.4, η=2) 0.0388 (0.0198, η=2) 2.69 (0.218, η=2) 340 250 (60.8, η=2) 0.0507 (0.0177, η=2) 2.08 (0.0742, η=2) 341 39.7 0 .0559 6.49 342 >1000 0.129 15.4 343 >1070 0.0374 13.3 344 >1080 0.0507 14.8 346 310 (26.0, η=3) 0.0559 (0.0248, η =2) 1.67 (0.911, η=2) 349 >1060 (η=1 / 3) 0.0800 (0.0215, η=3) 1.72 (0.0730, η=3) 352 >1030 (η-1 / 2) 0.0726 (0.00687, η=3) 3.03 (0.673, η=3) 354 >953 0.175 (0.0209, η=2) 7.85 (0.190, η= 2) 356 >1010 0.350 (0.0397, η=2) 10.3 (1.53, η=2) 357 >977 0.316 (0.0233, η=2) 7.02 (1.19, η= 2) 358 915 (η=1 / 2) 0.0636 (0.00684, η=3) 1.37 (0.189, η=3) 359 >982 (η=1 / 2) 0.0874 (0.0159 , η=3) 2.59 (0.833, η=3) Χ-21852 -109FR / nnn / Lznz / e / YiAi 360 485 0.128 (0.00895, n=2) 1.74 (0.0269, n=2) 362 >1050 0.337 (0.00484, n=2) 6.95 (0.446, n=2) 363 >1020 (n=1 / 2) 0.170 (0.0113, n=3) 3.89 (0.864, n=3) 364 >1150 (n=1 / 2) 0.672 (0.0431, n=3) 17.2 (2.26, n=3) 367 777 0.0282 0.809 Functional activity (with BSA) Functional activity is determined in HEK-293 clonal cell lines expressing hGLP-1R, hGcgR and hGIP-R. Each cell line overexpressing the receptor is treated with peptide (CRC 20 points, Labcyte Echo 2.75-fold direct dilution) in DMEM (Gibco Cat# 31053) supplemented with GlutaMAX™ IX supplement (Gibco L-alanyl-L-glulamin dipepd). ®), 0.25% FBS (fetal bovine serum), 0.05% BSA fraction V (bovine serum albumin), 3-isobutyl-l-methylxanthine (IBMX) 250 μΜ and 4-(2-hydroxyethyl) acid 20 mM lpiperazineethanesulfonic acid (HEPES) in a 20 µl assay volume. After a 60-minute incubation at room temperature, the resulting increase in intracellular cAMP is determined quantitatively using the CisBio cAMP Dynamic 2 Homogeneous Time-Resolved Fluorescence (HTRF) Assay Kit. detected by adding the cAMP-d2 conjugate in cell lysis buffer followed by the anti-cAMP-Eu3+ cryptate antibody, also in cell lysis buffer. The resulting competitive assay is incubated for at least 60 minutes at room temperature and then detected using an instrument with excitation at 320 nm and emission at 665 and 620 nm. Envision units (emission at 665nm / 620nm*10,000) are inversely proportional to the amount of cAMP present and are converted to nM cAMP per well using a cAMP standard curve. The amount of cAMP generated (nM) in each well is converted to a percentage of the maximum response observed with either human GLP-1(7-36)NH2, human Gcg, or human GIP(142)NH2. A relative EC50 value is derived by nonlinear regression analysis using FR / nnn / Lznz / e / YiAi Χ-21852 -110 the percentage of maximum response against the concentration of peptide added, adjusted to a logistic equation of four parameters. Determination of the EC50 of human GLP-1(7-36)NH2 in the human GLP-1R, human Gcg in the human GcgR, and human GIP(1-42)NH2 in the human GIP-R: the concentration ranges of peptides were from 448 pM to 99.5 nM. Determination of the EC50 of the Examples in human GLP-1R, human GcgR and human GIP-R: Peptide concentration ranges were from 51.5 fM to 11.4 μΜ. Table 2. Functional cAMP potency (EC50) for the Example and Comparator 10 peptides (hGcg, hGIP amide and hGLP-1 amide) in the presence of FBS. cAMP ECso, nM (SEM, n) Example 0 Comparator GcgR GIPR GLP-1R hGcg 0.0125 + 0.0011 (n=12) hGIP-amide 0.0979 (0.0088, n=12) hGLP-amide 1 0.0424 (0.0043, n=12) Example 1 >11,400 (n=1 / 9) 38.5 (20.2, n=12) 53.3 (21.4, n=12) Example 2 >10 900 (n=1 / 12) 2.64 (0.696, n=12) 6.52 (1.76, n=ll) Example 3 >10 900 (n=1 / 7) 9.24 (2 .23, n=7) 19.4 (7.02, n=7) Example 4 >10 900 (n=1 / 5) 1.03 (0.181, n=5) 2.02 (0.596, n=4 ) Example 5 >10 900 1.98 1.61 Pharmacological functional assay of cAMP in the presence of casein An additional set of cAMP assays is carried out in HEK293 cells expressing the human GLP-1 receptor (GLP-1R), gastric inhibitory peptide receptor (GIPR) and glucagon receptor (GcgR). The pharmacological activity of hGLPlR / GIPR peptides is determined in HEK293 cells stably expressing the GLP-1 receptor (GLP-1R), the gastric inhibitory peptide receptor (GIPR) or the GLP-2 receptor pR / nnn / lznz / e / YiAi Χ-21852 -111(GLP-2R) human. Each cell line overexpressing the receptor (20 μΐ) is treated with the test peptide in DMEM (Gibco Cat. No. 31053) supplemented with 0.1% casein (Sigma Cat. No. C4765), IBMX 250 μΜ, IX GlutaMAXTM (Gibco Cat. No. 35050), and 20 mM HEPES (HyClone Cat. No. SH30237.01) in a 20 µL assay volume. After a 60 minute incubation at room temperature, the resulting increase in intracellular cAMP is determined quantitatively using the CisBio cAMP Dynamic 2 HTRF Assay Kit (62AM4PEJ). Then, the lysis buffer containing the cAMP-d2 conjugate (20 μΐ) and the anti-cAMP antibody-Eu3+ Cryptate (20 μΐ) are added to determine the cAMP level. After 1 hour incubation at room temperature, the HTRF signal is detected with an Envision 2104 plate reader (PerkinElmer). Fluorescent emission is measured at 620 nm and 665 nm and the ratio between 620 nm and 665 nm is calculated and then converted to nM cAMP per well using a cAMP standard curve. Dose-response curves of compounds are plotted as percent stimulation normalized to the minimum (buffer only) and maximum (maximum concentration of each control ligand) values ​​and are analyzed by a four-parameter nonlinear regression fit with a variable slope (Genedata Screener 13). ECso is the concentration of the compound that produces the mean maximal stimulation in a dose response curve. A relative EC50 value is derived by non-linear regression analysis using percent maximal response versus concentration of added peptide, fitted to a four parameter logistic equation. Using homogeneous time-resolved fluorescence methods, assays are performed to determine the intrinsic potency of example molecules and comparator molecules performed in the presence of casein (instead of serum albumin) as a non-specific blocker, which it does not interact with the fatty acid residues of the analyzed molecules. Intracellular cAMP levels are determined by extrapolation using a standard curve. Dose-response curves of compounds are plotted as percent stimulation normalized to the minimum (buffer only) and maximum (maximum concentration of each control ligand) values ​​and are analyzed by a four-parameter nonlinear regression fit with a variable slope (Genedata Screener 13). EC50 is the concentration of the compound that elicits mean maximal stimulation on a curve of pR / nnn / Lznz / e / YiAi Χ-21852 -112dose response. Each relative EC50 value for the geometric mean calculation is determined from a curve fit. Dose-response curves of compounds are plotted as percent stimulation normalized to the minimum (buffer only) and maximum (maximum concentration of each control ligand) values ​​and are analyzed using a nonlinear regression fit of four parameters with a variable slope (Genedata Screener 13). EC50 is the concentration of the compound that produces the mean maximal stimulation in a dose response curve. EC50 summary statistics are calculated as follows: Geometric mean: GM = 10Λ(arithmetic mean of logium-transformed EC50 values). The standard error of the mean is reported: SEM = geometric mean x (standard deviation of logio-transformed EC50 values / square root of number of runs) x log of 10. The logarithmic transformation represents EC50 values ​​that fall on a multiplicative scale, rather than an arithmetic one. Each day, the assay is run, test peptides plus native GIP and GLP-1 ligands are run, buffer only as reference (minimum), and the highest concentration of the respective GIP and GLP-1 standard is used as the maximum. for calculations. To illustrate, as shown in Example 1, the test peptide is tested in 8 runs of the assay. For the avoidance of doubt, the EC50's of hGIP amide and hGLP-1 amide in Table 3 are illustrative of geometric mean values ​​from a series of 18 assay values, and values ​​will vary each day compared to buffer. zero. Accordingly, each Example will use the geometric mean of those values ​​to normalize the Example test runs. Χ-21852 -113Table 3. Functional activation of hGLP-lR, hGIPR, hGcgR in the presence of 0.1% casein. Example or Comparator hGIPR cAMP ECso Rei, nM (SEM, n) hGIPR cAMP Ratio ECso (SEM, n) hGLPIR cAMP ECso Rei, nM (SEM, n) hGLPIR cAMP Ratio ECso (SEM, n) hGIP Amide 0.170 (0.012, n=18) hGLP-1 amide 0.0396 (0.0030, n=16) 1 0.0356 (0.00576, n=8) 4.65 (0.514, n=8) 0, 0410 (0.00720, n=7) 1.12 (0.0949, n=7) 2 0.0339 (0.00650, n=5) 5.89 (1.10, n=5) 0.0441 (0.00670, n=5) 0.888 (0.0993, n=5) 3 0.0411 (0.00541, n=5) 4.51 (0.355, n=5) 0.0338 (0.00156, n=4) 1.25 (0.0916, n=4) 4 0.0272 (0.00358, n=6) 5.95 (0.466, n=6) 0.0297 (0.00319, n=6 ) 1.41 (0.241, n=6) 5 0.0309 (0.00402, n=5) 6.27 (0.808, n=5) 0.0164 (0.00219, n=5) 2.69 ( 0.547, n=5) 6 0.0899 (0.0196, n=2) 2.09 (0.301, n=2) 0.374 (0.0100, n=2) 0.185 (0.00340, n=2) 7 0.461 0.317 0.470 (0.0988, n=2) 0.130 (0.0215, n=2) 8 0.0848 (0.00744, n=6) 1.97 (0.170, n=6) 0.148 (0.00926 , n=6) 0.419 (0.0352, n=6) 9 0.210 (0.0335, n=6) 0.768 (0.122, n=6) 0.194 (0.0284, n=6) 0.314 (0.0384, n=6) 10 1.28 (0.270, n=2) 0.151 (0.0416, n=2) 7.64 (0.786, n=2) 0.00912 (0.000859, n=2) 11 0.486 ( 0.108, n=2) 0.399 (0.114, n=2) 6.89 (2.68, n=3) 0.0111 (0.00387, n=3) Χ-21852 -114- 12 0.300 (0.0827, η=2) 0.659 (0.221, η=2) 1.15 (0.00296, η=2) 0.0603 (0.000359, η=2) 13 1.05 (0.236, η=2) 0.180 (0.0272, η=2) 5.39 (1.35, η=2) 0.0133 (0.00338, η=2) 14 0.284 (0.0828, η=2) 0.545 (0.161, η=2) 1.87 (0.534, η=2) 0.0306 (0.00519, η=2) 15 0.613 (0.141, η=2) 0.273 (0.00678, η=2) 0, 0336 (0.0000222, η=2) 1.65 (0.0634, η=2) 16 0.975 (0.241, η=2) 0.157 (0.0401, η=2) 0.0437 (0.00494, η =4) 1.43 (0.260, η=3) 17 5.81 (0.758, η=2) 0.0257 (0.00368, η=2) 0.152 (0.0166, η=2) 0.398 (0, 0260, η=2) 18 0.610 (0.200, η=2) 0.275 (0.0204, η=2) 0.0945 (0.00823, η=2) 0.589 (0.0732, η=2) 19 0.386 ( 0.0583, η=2) 0.436 (0.0449, η=2) 0.104 (0.00342, η=2) 0.532 (0.0375, η=2) 20 0.0556 (0.00518, η=5 ) 2.81 (0.293, η=5) 0.117 (0.0121, η=8) 0.577 (0.0706, η=8) 21 0.0748 (0.00682, η=8) 1.95 (0.145, η=8) 0.160 (0.00495, η=7) 0.402 (0.0178, η=7) 22 0.0842 (0.0103, η=4) 1.86 (0.109, η=4) 0.206 (0 0.0172, η=5) 0.290 (0.0233, η=5) 23 0.204 (0.0160, η=5) 0.754 (0.0348, η=5) 0.190 (0.00766, η=7) 0.342 ( 0.0255, η=7) 24 0.762 (0.206, η=2) 0.228 (0.0443, η=2) 13.0 (η=1 / 2) 0.00416 (η=1 / 2) 25 0.230 ( 0.0191, η=6) 0.636 (0.0564, η=6) 0.356 (0.0415, η=6) 0.197 (0.0287, η=6) 26 0.251 (0.0264, η=6) 0.585 (0.0531, η=6) 0.293 (0.0442, η=5) 0.238 (0.0309, η=5) Χ-21852 -115- 27 0.0789 (0.00792, η=6) 1.90 (0.295, η=6) 0.557 (0.0717, η=5) 0.123 (0.0102, η=5) 28 1.66 (0.257, η=2) 0.106 (0.0238, η=2) 32.7 (η=1 / 2) 0.00166 (η=1 / 2) 29 0.320 (0.0548, η=2) 0.536 (0.0522 , η=2) 0.999 (0.336, η=2) 0.0671 (0.0283, η=2) 30 0.114 (0.00650, η=2) 1.50 (0.0246, η=2) 1, 84 (0.280, η=2) 0.0331 (0.00127, η=2) 31 0.388 (0.0773, η=2) 0.456 (0.121, η=2) 0.891 (0.147, η=2) 0.0708 (0.0192, η=2) 32 0.179 (0.0200, η=5) 0.840 (0.0750, η=5) 0.498 (0.0124, η=5) 0.136 (0.00728, η=5) 33 63.3 (6.65, η=2) 0.00222 (0.000125, η=2) 251 (η=1 / 2) 0.000256 (η=1 / 2) 34 0.360 (0.0200, η=2) 0.393 (0.00105, η=2) 1.56 (0.132, η=2) 0.0392 (0.00119, η=2) 35 0.0905 (0.00717, η=2) 1 .58 (0.215, η=2) 8.38 (0.707, η=2) 0.00728 (0.000221, η=2) 36 0.309 (0.0126, η=2) 0.458 (0.00789, η= 2) 2.29 (0.390, η=2) 0.0268 (0.00309, η=2) 37 0.269 (0.0546, η=2) 0.532 (0.0765, η=2) 1.15 (0.216 , η=2) 0.0533 (0.00707, η=2) 38 0.147 (0.0217, η=2) 0.967 (0.0861, η=2) 2.82 (0.0832, η=2) 0.0217 (0.00181, η=2) 39 0.133 (0.0242, η=2) 1.07 (0.132, η=2) 1.92 (0.447, η=2) 0.0323 (0.00571 , η=2) 40 0.136 (0.0164, η=2) 1.06 (0.188, η=2) 0.746 (0.118, η=2) 0.0801 (0.0105, η=2) 41 0.229 (0 .0451, η=2) 0.637 (0.159, η=2) 0.960 (0.0203, η=2) 0.0637 (0.00478, η=2) Χ-21852 -116- 42 0.161 (0.00967, η=2) 0.897 (0.149, η=2) 1.45 (0.328, η=2) 0.0471 (0.0107, η=2) 43 0.112 (0.0129, η= 2) 1.28 (0.0105, η=2) 0.862 (0.0963, η=2) 0.0777 (0.00826, η=2) 44 0.128 (0.0118, η=2) 1.11 (0.0174, η=2) 0.752 (0.201, η=2) 0.0918 (0.0245, η=2) 45 0.106 (0.0158, η=2) 1.75 (0.164, η=2) 1.03 (0.194, η=2) 0.0569 (0.00591, η=2) 46 0.172 (0.0231, η=2) 0.828 (0.0222, η=2) 0.687 (0.0147, η =2) 0.0969 (0.00159, η=2) 47 0.287 (0.0529, η=2) 0.654 (0.0819, η=2) 0.702 (0.197, η=2) 0.0890 (0, 0310, η=2) 48 0.168 (0.0126, η=2) 0.863 (0.156, η=2) 0.691 (0.0491, η=2) 0.0966 (0.00733, η=2) 49 0, 0868 (0.0288, η=2) 1.69 (0.372, η=2) 0.597 (0.0314, η=2) 0.112 (0.00642, η=2) 50 0.0794 (0.0104, η =5) 1.96 (0.179, η=5) 0.0961 (0.00519, η=7) 0.675 (0.0492, η=7) 51 0.0960 (0.0106, η=7) 1, 69 (0.201, η=7) 0.153 (0.0110, η=7) 0.426 (0.0376, η=7) 52 0.0997 (0.0119, η=6) 1.40 (0.154, η=6 ) 0.132 (0.0143, η=5) 0.514 (0.0413, η=5) 53 0.628 (0.161, η=2) 0.287 (0.0912, η=2) 0.0339 (0.000266, η= 2) 1.80 (0.190, η=2) 54 1.57 (0.144, η=2) 0.110 (0.0181, η=2) 0.0242 (0.00711, η=2) 2.55 (0.456 , η=2) 55 5.45 (η=1 / 2) <0.00159 0.0286 (0.000346, η=2) 2.33 (0.0282, η=2) 56 0.167 (0.0132 , η=2) 1.02 (0.00567, η=2) 0.136 (0.00964, η=2) 0.491 (0.0347, η=2) 57 0.0849 (0.0107, η=6) 1.74 (0.148, η=6) 0.0668 (0.00654, η=7) 0.996 (0.0730, η=7) Χ-21852 -117- 58 0.266 (0.0307, ​​η=5) 0.522 (0.0439, η=5) 0.180 (0.0151, η=5) 0.378 (0.0347, η=5) 59 0.0922 (0.0134, η=5) 1.54 (0.186, η=5) 0.0840 (0.00742, η=5) 0.812 (0.0816, η=5) 60 0.135 (0.0107, η=2) 1.06 (0.0296, η=2) 0.287 (0.0377, η=3) 0.237 (0.0270, η=3) 61 0.0739 (0.0140, η=2) 1.94 (0.158, η= 2) 0.371 (0.0664, η=3) 0.187 (0.0341, η=3) 62 0.0601 (0.00469, η=5) 2.33 (0.234, η=5) 0.159 (0.0151 , η=5) 0.463 (0.0644, η=5) 63 0.0925 (0.0106, η=7) 1.58 (0.156, η=7) 0.190 (0.0195, η=5) 0.386 ( 0.0466, η=5) 64 0.0916 (0.0104, η=6) 1.57 (0.192, η=6) 0.172 (0.0184, η=5) 0.429 (0.0598, η=5 ) 65 0.143 (0.0264, η=2) 1.04 (0.295, η=2) 0.289 (0.0215, η=3) 0.233 (0.0144, η=3) 66 0.0743 (0.00740 , η=5) 1.89 (0.209, η=5) 0.285 (0.0291, η=5) 0.255 (0.0245, η=5) 67 0.0913 (0.00577, η=2) 1, 61 (0.0648, η=2) 0.447 (0.0958, η=2) 0.123 (0.0314, η=2) 68 0.0881 (0.00725, η=2) 1.67 (0.0990 , η=2) 0.153 (0.0169, η=2) 0.354 (0.0550, η=2) 69 0.0712 (0.0156, η=4) 2.73 (0.431, η=3) 0, 0844 (0.00548, η=4) 0.850 (0.0870, η=4) 70 0.480 (0.0706, η=2) 0.351 (0.0135, η=2) 0.283 (0.0281, η=3 ) 0.207 (0.0330, η=3) 71 0.166 (0.0417, η=2) 1.02 (0.0668, η=2) 1.02 (0.227, η=3) 0.0604 (0, 0170, η=3) 72 0.252 (0.0456, η=2) 0.715 (0.251, η=2) 0.906 (0.127, η=3) 0.0645 (0.0103, η=3) 73 0.979 (0.317, η=2) 0.174 (0.0239, η=2) 2.55 (0.337, η=3) 0.0225 (0.00178, η=3) Χ-21852 -118- 74 0.0866 (0.00653, η=2) 1.70 (0.166, η=2) 0.467 (0.00217, η=2) 0.115 (0.00580, η=2) 75 0.214 (0.0234, η=2) 0.690 (0.0905, η=2) 1.49 (0.00142, η=2) 0.0359 (0.00168, η=2) 76 0.124 (0.000853, η=2) 1 .24 (0.0255, η=2) 0.125 (0.00942, η=2) 0.630 (0.0992, η=2) 77 135 (22.8, η=2) 0.00102 (0.000331, η=2) >2000 (η=1 / 2) <0.0000325 (η=1 / 2) 78 0.532 (0.120, η=2) 0.293 (0.0571, η=2) 0.544 (0.0263, η =2) 0.143 (0.00495, η=2) 79 0.0732 (0.0127, η=2) 2.11 (0.305, η=2) 2.02 (0.562, η=2) 0.0410 ( 0.0142, η=2) 80 0.140 (0.0130, η=2) 1.09 (0.0709, η=2) 0.351 (0.0522, η=2) 0.227 (0.0516, η=2 ) 81 0.428 (0.0445, η=2) 0.373 (0.0131, η=2) 1.29 (0.00950, η=2) 0.0630 (0.00192, η=2) 82 24.3 (8.06, η=2) 0.00679 (0.00175, η=2) 26.1 (6.81, η=2) 0.00325 (0.000941, η=2) 83 0.182 (0, 0176, η=2) 0.804 (0.0637, η=2) 0.387 (0.0648, η=2) 0.166 (0.0265, η=2) 84 0.0915 (0.00451, η=2) 1 .59 (0.0514, η=2) 0.374 (0.0762, η=2) 0.173 (0.0337, η=2) 85 1.67 (0.143, η=2) 0.111 (0.00296, η= 2) 0.0518 (0.00318, η=2) 1.13 (0.0246, η=2) 86 0.0452 (0.00765, η=2) 3.29 (0.605, η=2) 0.271 (0.0756, η=2) 0.243 (0.0647, η=2) 87 0.0945 (0.0277, η=2) 1.1 0.0801 0.786 Χ-21852 -119- 88 0.475 (0.00187, η=2) 0.392 (0.0215, η=2) 0.640 (0.00544, η=2) 0.0918 (0.00840, η=2) 89 0.119 (0.0150, η=2) 1.57 (0.107, η=2) 0.335 (0.00771, η=2) 0.175 (0.0105, η=2) 90 0.0361 (0.000915, η=2) 5.17 (0.434, η=2) 0.532 (0.0564, η=2) 0.110 (0.00250, η=2) 91 19.2 (η=1 / 2) 0.0103 (η=1 / 2) >5000 (η=1 / 2) <0.0000108 (η=1 / 2) 92 0.338 0.546 0.257 0.258 93 0.185 (0.0241, η=2) 0.956 (0.292, η=2) 0.115 (0.0143, η= 3) 0.498 (0.0199, η=3) 94 0.425 0.434 0.338 0.196 95 1.17 (0.0326, η=2) 0.145 (0.0227, η=2) 1.01 (0.229, η=3) 0.0576 (0.00824, η=3) 96 0.712 (0.0736, η=2) 0.238 (0.0195, η=2) 0.590 (0.0509, η=3) 0.0977 (0.0101 , η=3) 97 1.85 (0.214, η=2) 0.0953 (0.0278, η=2) 2.18 (0.347, η=3) 0.0268 (0.00442, η=3) 98 0.0718 2.43 0.157 0.384 99 0.0643 (0.0120, η=5) 2.27 (0.208, η=5) 0.0986 (0.0104, η=4) 0.629 (0.0938, η=4) 100 0.120 (0.0169, η=2) 1.48 (0.191, η=2) 0.0790 (0.00439, η=2) 0.724 (0.0809, η=2) 101 0, 0704 (0.00913, η=5) 2.07 (0.138, η=5) 0.0579 (0.00589, η=4) 1.06 (0.131, η=4) 102 0.178 0.983 0.0628 (0 0.00458, η=2) 0.913 (0.118, η=2) 103 0.0693 (0.0165, η=4) 2.01 (0.183, η=4) 0.101 (0.0132, η=3) 0.655 ( 0.108, η=3) 104 0.0323 (0.00474, η=8) 4.93 (0.595, η=8) 0.0248 (0.00679, η=6) 1.85 (0.242, η=6 ) Χ-21852 -120pR / nnn / Lznz / e / γΐΛΐ 105 1.85 (0.133, η=2) 0.101 (0.00134, η=2) 0.0401 (0.00740, η=2) 1.51 (0.396, η=2) 106 6.54 (η= 1 / 2) 0.0302 (η=1 / 2) 0.0413 (0.000823, η=2) 1.42 (0.0898, η=2) 107 0.241 (0.0209, η=5) 0.747 (0.0859, η=5) 0.0539 (0.00678, η=5) 1.10 (0.128, η=5) 108 0.0885 (0.00413, η=2) 2.19 (0, 0798, η=2) 0.294 (0.0441, η=2) 0.218 (0.0253, η=2) 109 0.109 (0.0252, η=2) 1.83 (0.397, η=2) 0.350 (0 .0142, η=2) 0.182 (0.0134, η=2) 110 0.218 (0.0657, η=2) 0.929 (0.263, η=2) 0.179 (0.0168, η=2) 0.358 (0, 0452, η=2) 111 0.141 (0.0253, η=2) 1.1 0.308 (0.0144, η=2) 0.209 (0.0151, η=2) 112 0.124 (0.00217, η=2 ) 1.53 0.160 (0.0115, η=2) 0.402 (0.0185, η=2) 113 0.166 (0.0364, η=2) 1.39 0.233 (0.0133, η=2) 0.275 ( 0.0228, η=2) 114 0.133 (0.0220, η=2) 1.65 0.267 0.234 115 0.102 (0.0163, η=5) 1.85 (0.319, η=5) 0.0880 (0 .00660, η=4) 0.743 (0.0516, η=4) 116 0.0867 (0.0141, η=5) 2.13 (0.255, η=5) 0.0703 (0.0111, η= 4) 0.956 (0.147, η=4) 117 0.0648 (0.00602, η=7) 2.44 (0.263, η=6) 0.0615 (0.00275, η=7) 0.998 (0.0681 , η=7) 118 0.0538 (0.00395, η=7) 3.42 (0.247, η=6) 0.0588 (0.00577, η=6) 1.13 (0.115, η=6) 119 0.216 (0.0107, η=2) 0.901 (0.0541, η=2) 0.0913 (0.00729, η=2) 0.702 (0.0788, η=2) 120 0.122 (0.0397, η=2) 1.67 (0.509, η=2) 0.201 (0.0318, η=2) 0.319 (0.0398, η=2) Χ-21852 -121- 121 0.0760 (0.0189, η=2) 1.44 0.0849 (0.0136, η=2) 0.760 (0.128, η=2) 122 0.0923 (0.0122, η=2) 1 .73 (0.399, η=2) 0.0760 (0.0221, η=2) 0.856 (0.223, η=2) 123 0.0423 (0.00604, η=8) 4.04 (0.586, η= 8) 0.0344 (0.00562, η=5) 1.58 (0.180, η=5) 124 0.0762 (0.00816, η=4) 2.18 (0.283, η=4) 0.0475 (0.00318, η=4) 1.29 (0.0473, η=4) 125 0.0381 (0.00482, η=5) 3.79 (0.152, η=5) 0.0478 (0, 00569, η=4) 1.31 (0.229, η=4) 126 0.0685 (0.00653, η=4) 2.53 (0.361, η=3) 0.0715 (0.00249, η=4 ) 0.869 (0.0332, η=4) 127 0.158 (0.0401, η=2) 0.917 0.145 (0.00951, η=2) 0.443 (0.0176, η=2) 128 0.0694 (0, 00856, η=4) 2.46 (0.344, η=3) 0.0924 (0.0147, η=4) 0.700 (0.119, η=4) 129 0.106 (0.00707, η=2) 1.88 0.121 (0.0220, η=2) 0.543 (0.112, η=2) 130 1.55 0.116 0.368 0.182 131 0.183 1.03 0.156 0.425 132 0.0657 2.88 0.26 0.255 1379 0.0879 0298, η=2) 1.89 (1.13, η=2) 0.0436 1.52 134 0.104 (0.00639, η=2) 1.43 (0.244, η=2) 0.0654 (0 .00394, η=2) 0.942 (0.00985, η=2) 135 0.373 0.482 0.131 0.509 136 3.39 0.0544 0.06 1.1 137 0.0333 (0.00461, η=8) 4, 47 (0.381, η=8) 0.0397 (0.00540, η=5) 1.25 (0.114, η=5) 138 0.0581 (0.00498, η=3) 2.18 (0.423, η =3) 0.0471 (0.00784, η=3) 1.12 (0.105, η=3) Χ-21852 -122- 139 0.0370 (0.00460, η=5) 3.61 (0.444, η=5) 0.0417 (0.00760, η=5) 1.13 (0.105, η=5) 140 0.0349 ( 0.00428, η=5) 3.76 (0.415, η=5) 0.0424 (0.00487, η=5) 1.16 (0.0926, η=5) 141 0.2 0.538 0.0975 0.414 142 0.0489 (0.00436, η=2) 2.84 (0.637, η=2) 0.0426 (0.00626, η=2) 1.22 (0.0942, η=2) 143 0 .0515 (0.0105, η=2) 2.78 (0.920, η=2) 0.0745 (0.0109, η=2) 0.714 (0.152, η=2) 144 0.0375 (0.00249, η=3) 3.60 (0.373, η=3) 0.0608 (0.00352, η=3) 0.851 (0.0845, η=3) 145 0.0514 (0.0124, η=3) 2 .46 (0.300, η=3) 0.0427 (0.00108, η=2) 1.22 (0.116, η=2) 146 0.0583 1.98 0.0604 0.951 147 0.0304 (0.00146 , η=3) 4.14 (0.241, η=3) 0.0527 (0.00623, η=3) 1.13 (0.117, η=3) 148 0.0430 (0.00713, η=3) 2.70 (0.462, η=3) 0.0626 (0.00751, η=3) 0.859 (0.167, η=3) 149 0.0711 (0.0109, η=2) 1.82 (0.0572 , η=2) 0.0916 (0.0149, η=2) 0.484 (0.0343, η=2) 150 0.0511 (0.00569, η=2) 2.64 (0.761, η=2) 0.0575 (0.00855, η=2) 0.790 (0.186, η=2) 151 0.41 0.262 1.60 (0.338, η=2) 0.0278 (0.00331, η=2) 152 0, 0504 (0.00566, η=2) 2.57 (0.188, η=2) 0.0915 (0.0128, η=2) 0.484 (0.0236, η=2) 153 0.0634 1.7 0 .0904 (0.0113, η=2) 0.501 (0.107, η=2) 154 0.0266 (0.00348, η=7) 5.90 (0.513, η=7) 0.0393 (0.00511, η=5) 1.23 (0.117, η=5) 155 0.266 0.584 0.495 0.0978 156 >30.0 <0.00519 0.638 0.0759 Χ-21852 -123- 157 0.0453 (0.00495, η=6) 3.15 (0.444, η=6) 0.0431 (0.00557, η=4) 1.25 (0.135, η=4) 158 0.0454 ( 0.0102, η=5) 3.22 (0.527, η=5) 0.0374 (0.00374, η=5) 1.34 (0.0947, η=5) 159 4.6 0.039 0.33 0.176 160 21.0 (0.568, η=2) 0.00712 (0.00165, η=2) 0.0461 (0.00206, η=2) 1.24 (0.0824, η=2) 161 0.254 0.706 4.8 0.0121 162 4.56 0.0393 36 0.00161 163 0.121 1.29 0.0316 1.54 164 3.09 0.0581 15.6 0.00373 165 1.04 0.172 5.81 0.01 166 0.355 0.504 4.08 0.0143 167 0.617 0.291 1.2 0.0487 168 0.572 0.313 1.8 0.0323 169 0.86 0.122 3.37 0.0136 170 0.41 0.569 0.569 0.569 171 0.223 0.471 0.75 0.0609 172 1.05 0.1 1.2 0.038 173 0.586 0.179 1.23 0.0373 174 0.217 0.483 0.472 0.0968 175 0.0881 1.19 161 1.41 0.523 0.201 1.07 0.0427 177 1.4 0.0749 6.79 0.00673 178 3.08 0.0341 13.1 0.00349 179 1.83 0.0575 2.7 0.0169 180 0, 79 0.133 2.16 0.0212 181 0.0459 (0.0122, η=5) 4.10 (0.698, η=5) 0.0592 (0.00966, η=6) 0.718 (0.0586, η =6) 182 0.0442 (0.0133, η=5) 4.37 (0.940, η=5) 0.0463 (0.00578, η=6) 0.873 (0.0433, η=6) Χ-21852 -124FR / nnn / Lznz / e / YiAi 183 0.0615 (0.0175, η=5) 3.10 (0.600, η=5) 0.0551 (0.0125, η=5) 0.843 (0.121, η=5) 184 0.0477 2.45 0.392 0.135 185 0.632 0.185 7.16 0.00739 186 0.0939 0.572 187 0.0371 (0.00593, η=6) 4.61 (0.839, η=6) 0.0577 (0.00695, η=6 ) 0.702 (0.0431,η=6) 188 0.121 0.969 0.13 0.408 189 0.0775 (0.0140, η=5) 2.41 (0.314, η=5) 0.0608 (0.00976, η =6) 0.668 (0.0450, η=6) 190 0.738 0.158 0.0241 2.2 191 0.0645 (0.0139, η=3) 2.53 (0.131, η=3) 0.0356 (0 .00490, η=3) 1.60 (0.182, η=3) 192 0.0615 (0.0139, η=5) 2.83 (0.340, η=5) 0.0289 (0.00261, η= 5) 1.73 (0.0510, η = 5) 193 0.336 0.538 0.162 0.359 194 0.423 0.427 0.284 0.205 195 0.193 0.936 0.0966 0.602 196 0.277 0.653 0.175 0.332 197 0.211 0.211 0.855 0.24 0.139 0.337 199 >30.0 <0.00602 0.0422 1.11 200 12.3 0.0146 0.0818 0.573 201 >30.0 <0.00602 0.0385 1.22 202 0.0392 (0, 00958, η=3) 4.79 (0.700, η=3) 0.0608 (0.00408, η=2) 0.712 (0.0866, η=2) 203 0.0387 (0.00465, η=4 ) 4.95 (0.383, η=4) 0.0679 (0.0116, η=3) 0.671 (0.130, η=3) 204 0.0424 (0.0132, η=3) 4.58 (1, 01, η=3) 0.0654 (0.0166, η=2) 0.689 (0.207, η=2) 205 0.0281 5.71 0.0261 1.46 Χ-21852 -125- (0.000581, η=2) (0.519, η=2) (0.00703, η=3) (0.102, η=3) 206 0.0409 (0.00271, η=2) 4.75 (0 0.0828, η=2) 0.0270 (0.00477, η=3) 1.42 (0.139, η=3) 207 0.0395 (0.0103, η=3) 4.76 (0.715, η= 3) 0.0359 (0.00622, η=2) 1.23 (0.275, η=2) 208 0.0371 (0.00797, η=4) 5.33 (0.808, η=4) 0.0753 (0.00608, η=3) 0.587 (0.0362, η=3) 209 0.0308 (0.00636, η=5) 5.73 (0.721, η=5) 0.0374 (0.00451, η=4) 1.12 (0.108, η=4) 210 0.0383 (0.0124, η=4) 5.40 (1.22, η=4) 0.0432 (0.00554, η=3 ) 1.03 (0.118, η=3) 211 0.0442 (0.00939, η=5) 4.59 (0.656, η=5) 0.0337 (0.00481, η=4) 1.28 ( 0.203, η=4) 212 0.0501 (0.0132, η=4) 4.17 (0.999, η=4) 0.0572 (0.00467, η=3) 0.771 (0.0330, η=3 ) 213 0.0523 (0.0140, η=4) 3.87 (0.721, η=4) 0.0710 (0.0146, η=4) 0.694 (0.110, η=4) 214 0.0251 (0 .00459, η=4) 6.92 (0.628, η=4) 0.0221 (0.00364, η=5) 1.74 (0.122, η=5) 215 0.0525 (0.00720, η= 3) 3.53 (0.379, η=3) 0.0529 (0.00177, η=2) 0.813 (0.0175, η=2) 216 0.0401 (0.0151, η=3) 4.91 (1.22, η=3) 0.0327 (0.00291, η=2) 1.31 (0.0447, η=2) 217 ​​0.0563 (0.0165, η=3) 3.41 ( 0.665, η=3) 0.0383 (0.00448, η=2) 1.14 (0.193, η=2) 218 ​​0.0413 (0.00450, η=3) 4.43 (0.113, η=3 ) 0.0423 (0.00335, η=2) 1.02 (0.137, η=2) 219 0.0341 (0.00595, η=5) 5.86 (0.825, η=5) 0.0403 ( 0.00221, η=4) 1.03 (0.0601, η=4) 220 0.0315 (0.00564, η=5) 6.30 (0.786, η=5) 0.0312 (0.00267 , η=4) 1.36 (0.176, η=4) Χ-21852 -126FR / nnn / Lznz / e / YiAi 221 0.0445 (0.0102, η=4) 4.50 (0.773, η=4) 0.0570 (0.0101, η=3) 0.795 (0.138, η=3) 222 0.0306 (0, 00648, η=4) 5.84 (0.924, η=4) 0.0248 (0.00375, η=5) 1.55 (0.110, η=5) 223 0.0670 (0.00561, η=2 ) 2.93 (0.487, η=2) 0.0363 (0.00532, η=3) 0.962 (0.0435, η=3) 224 0.0545 (0.00995, η=3) 3.52 ( 0.580, η=3) 0.0349 (0.00788, η=4) 1.06 (0.145, η=4) 225 0.101 (0.0194, η=2) 1.99 (0.536, η=2) 0 .0670 (0.0107, η=3) 0.523 (0.0355, η=3) 226 0.0461 (0.00446, η=2) 4.27 (0.762, η=2) 0.0284 (0, 00805, η=3) 1.25 (0.167, η=3) 227 0.0414 (0.00954, η=2) 4.73 (0.688, η=2) 0.0329 (0.00627, η=3 ) 1.07 (0.0870, η=3) 228 0.0503 (0.00265, η=2) 3.86 (0.119, η=2) 0.0282 (0.00274, η=2) 1, 10 (0.218, η=2) 229 4.79 0.0298 2.11 0.0139 230 0.0431 3.31 0.0491 0.599 231 0.0253 5.64 0.0611 0.481 232 0.027 5.28 0, 0724 0.406 233 0.0288 4.95 0.0549 0.535 234 0.0372 3.83 0.0926 0.317 235 0.0372 3.83 0.136 0.216 236 0.0249 (0.00475, η=6 (5) 6.7 0.804, η=5) 0.0231 (0.00333, η=5) 1.65 (0.260, η=5) 237 0.0883 2.16 0.0187 2.34 238 0.0296 7.33 0, 0241 1.15 239 0.0353 (0.00282, η=4) 5.27 (0.434, η=4) 0.0376 (0.00836, η=4) 0.987 (0.213, η=4) 240 0, 0223 9.73 0.0393 0.706 241 0.0257 (0.00164, η=3) 7.12 (0.471, η=3) 0.0175 (0.00373, η=3) 1.89 (0.340, η =3) Χ-21852 -127- 242 0.0333 (0.00196, η=3) 5.58 (0.823, η=3) 0.0164 (0.00209, η=3) 1.96 (0.186, η=3) 243 0.0214 ( 0.00212, η=3) 8.69 (1.21, η=3) 0.0265 (0.00423, η=3) 1.22 (0.158, η=3) 244 0.0225 (0.00136 , η=3) 8.27 (1.30, η=3) 0.0252 (0.00415, η=3) 1.29 (0.174, η=3) 245 0.0552 2.82 0.0222 1 .55 246 0.0258 (0.00180, η=6) 6.36 (0.340, η=6) 0.0144 (0.00106, η=5) 2.56 (0.216, η=5) 247 0, 0622 2.58 0.0491 0.614 248 0.0328 (0.000561, η=2) 5.08 (0.118, η=2) 0.0428 (0.00493, η=2) 0.800 (0.00908, η =2) 249 0.0437 (0.00337, η=2) 3.84 (0.449, η=2) 0.0446 (0.0131, η=2) 0.778 (0.129, η=2) 250 0.0376 4.27 0.0306 0.985 251 0.0292 5.12 0.081 1.37 252 0.093 1.61 0.0483 1.44 253 0.219 0.684 0.109 0.638 254 0.215 0.695 0.7 0.0652 55 0.0652 1.21 0407 1.71 256 0.643 0.233 0.0506 1,38 257 0.474 0.316 0.0779 0.895 258 2.43 0.0616 0.174 0.401 259 0.257 0.582 0.145 0.482 260 0.617 0.242 0.408 0.171 262 0.13 1.15 0.0943 0.754 263 0.317 0.473 0.0785 0.906 264 0.0196 (0.00197, η=2) 8.40 (1.51, η=2) 0.0229 (0.00180 , η=2) 3.19 (0.327, η=2) Χ-21852 -128- 265 0.0229 (0.00918, η=2) 7.56 (2.21, η=2) 0.0223 (0.00115, η=2) 3.27 (0.0894, η=2) 266 0.0442 (0.0109, η=6) 2.82 (0.430, η=6) 0.0883 (0.0104, η=6) 0.627 (0.103, η=6) 267 0.108 (0.0203, η =5) 1.50 (0.0726, η=5) 0.0540 (0.0118, η=5) 0.974 (0.256, η=5) 268 0.239 (0.00366, η=3) 0.851 (0, 0652, η=3) 0.0572 (0.0135, η=5) 0.935 (0.247, η=5) 269 0.257 (0.0546, η=3) 0.825 (0.187, η=3) 0.0595 (0 0.0158, η=3) 0.828 (0.202, η=3) 270 0.328 (0.0226, η=3) 0.627 (0.0795, η=3) 0.128 (0.0355, η=4) 0.400 (0.132, η=4) 271 0.334 (0.0609, η=3) 0.614 (0.0761, η=3) 0.0352 (0.00104, η=2) 1.35 (0.0587, η=2) 272 0.0464 (0.0119, η=6) 2.97 (0.286, η=6) 0.0435 (0.0117, η=4) 1.19 (0.355, η=4) 273 0.0790 (0 .0165, η=5) 2.15 (0.333, η=5) 0.0352 (0.0230, η=3) 1.85 (0.845, η=3) 274 >30.0 <0.00741 14, 5 (5.14, η=2) 0.00353 (0.000807, η=2) 275 >30.0 <0.00741 14.0 (0.390, η=2) 0.00357 (0.000336, η =2) 276 0.0757 1.43 0.108 (0.0236, η=2) 0.491 (0.117, η=2) 277 0.0554 2.02 0.133 0.536 278 0.293 0.845 0.123 (0.0121, η=2) 0.517 (0.0592, η=2) 279 0.564 0.439 0.11 0.461 Χ-21852 -129pR / nnn / Lznz / e / γΐΛΐ 280 0.204 1,53 0.0767 0.663 281 0.166 1.87 0.16 0.318 282 0.323 0.962 0.247 0.23 283 0.301 1.03 0.155 0.329 284 0.113 2.74 0.0462 1,1 285 0.0884 3,52 3,522 3,52 0.072 0.706 286 0.184 1.69 0.0602 0.845 287 0.15 2.08 0.112 0.455 288 0.0732 (0.0140, η=7) 1.20 (0.268, η=7) 0.172 (0.0288, η =4) 0.393 (0.128, η=4) 289 0.0228 (0.00219, η=5) 4.13 (0.741, η=5) 0.0544 (0.00661, η=6) 1.33 ( 0.325, η=6) 290 0.0629 (0.0118, η=5) 1.09 (0.176, η=5) 0.179 (0.0336, η=6) 0.279 (0.0844, η=6) 291 0.118 (0.0226, η=4) 0.746 (0.0858, η=4) 0.150 (0.0253, η=5) 0.188 (0.0294, η=5) 292 0.0682 (0.0192, η =2) 1.10 (0.0631, η=2) 0.183 (0.0328, η=2) 0.143 (0.0191, η=2) 293 0.0562 (0.00736, η=2) 1, 36 (0.278, η=2) 0.132 (0.000967, η=2) 0.197 (0.00743, η=2) 294 0.183 0.75 0.185 0.249 295 0.281 0.481 0.116 0.398 296 296 0.5648 0.8 0.8 0.0451 (0.00597, η=4) 3.00 (0.569, η=4) 0.111 (0.0151, η=5) 0.445 (0.0482, η=5) 298 0.0430 (0.00578 , η=6) 2.87 (0.349, η=6) 0.0957 (0.0139, η=7) 0.507 (0.0734, η=7) Χ-21852 -130FR / nnn / Lznz / e / YiAi 299 0.932 (0.507, η=2) 0.146 (0.0780, η=2) 2.54 (0.629, η=4) 0.0244 (0.00551, η=4) 300 0.0234 (0.00482, η=7) 5.38 (1.40, η=7) 0.0867 (0.0105, η=9) 0.636 (0.0568, η=9) 301 0.0346 (0.00764, η=12 ) 4.11 (0.921, η=11) 0.0441 (0.00684, η=7) 1.61 (0.433, η=7) 302 0.0308 (0.00225, η=8) 3.78 ( 0.554, η=7) 0.0275 (0.00247, η=6) 1.96 (0.175, η=6) 303 0.0254 (0.00381, η=9) 4.20 (1.10, η =9) 0.104 (0.0157, η=6) 0.602 (0.0702, η=6) 304 0.0296 (0.00440, η=7) 2.68 (0.425, η=7) 0.191 (0, 0386, η=5) 0.481 (0.151, η=5) 305 0.0225 (0.00306, η=7) 4.28 (0.953, η=7) 0.107 (0.0149, η=6) 0.685 (0 0.0980, η=6) 306 0.0191 (0.00502, η=4) 3.97 (0.582, η=4) 0.0711 (0.0202, η=4) 0.912 (0.339, η=4) 307 0.0285 (0.00345, η=5) 2.48 (0.481, η=5) 0.0437 (0.00943, η=4) 1.29 (0.238, η=4) 308 0.0262 ( 0.00432, η=8) 4.06 (1.01, η=8) 0.0392 (0.00818, η=4) 1.45 (0.307, η=4) 309 0.0389 (0.00473 , η=4) 1.64 (0.313, η=4) 0.0330 (0.00555, η=3) 1.27 (0.312, η=3) 310 0.0176 (0.00109, η=4) 5.56 (1.23, η=4) 0.0283 (0.00985, η=3) 1.43 (0.262, η=3) 311 0.0334 (0.00431, η=4) 3.50 (0.928, η=4) 0.0393 (0.0132, η=3) 1.04 (0.220, η=3) 312 0.0207 (0.00251, η=5) 4.76 (1.32, η=5) 0.0262 (0.00799, η=3) 1.53 (0.342, η=3) 313 0.0233 (0.00223, η=2) 2.87 (0.830, η=2) 0 .0388 (0.00647, η=3) 0.867 (0.197, η=3) Χ-21852 -131- 314 0.0290 (0.0123, η=2) 2.81 (0.669, η=2) 0.0290 (0.00867, η=3) 1.48 (0.476, η=3) 315 0.0408 ( 0.00771, η=4) 2.06 (0.452, η=4) 0.0651 (0.0141, η=4) 1.00 (0.245, η=4) 316 0.0240 (0.00478, η =7) 3.75 (0.723, η=7) 0.122 (0.00791, η=6) 0.644 ( 0.146, η=6) 317 0.0948 (0.0240, η=4) 1.01 (0.478, η=4) 0.172 (0.00643, η=3) 0.333 (0.104, η=3) 318 0.0547 (0.00365, η=4) 1.69 (0.536, η=4) 0.124 (0.0271 , η=4) 0.482 (0.188, η=4) 319 0.0540 (0.0220, η=4) 2.77 (2.07, η=4) 0.113 (0.00689, η=3) 0.522 ( 0.171, η = 3) 320 0.161 0.241 0.397 0.224 321 0.0752 0.517 0.204 0.437 322 0.146 0.266 0.711 0.125 323 0.0251 (0.00551, η = 4) 3.24 (0.508, η = 4) 0.00797, η=4) 1.32 (0.527, η=4) 324 0.0374 (0.00637, η=4) 2.13 (0.185, η=4) 0.0926 (0.0147, η =4) 0.798 (0.264, η=4) 325 0.0301 (0.00366, η=5) 2.65 (0.180, η=5) 0.0586 (0.0119, η=5) 1.16 ( 0.224, η=5) 326 0.0754 1.5 0.0369 1.4 327 0.0548 (0.0274, η=2 / 3) 1.47 (0.273, η=2 / 3) 0.27 0.191 328 0.0965 0.94 0.117 0.575 329 0.132 0.687 0.125 0.535 330 0.0919 0.562 0.199 0.255 331 0.0547 (0.0162, η=2) 1.40 (0.145) 0.092 η=2 0237, η=2) 0.808 (0.277, η=2) Χ-21852 -132FR / nnn / Lznz / e / YiAi 332 0.0745 (0.0143, η=3) 0.949 (0.0533, η=3) 0.184 (0.0348, η=3) 0.345 (0.0711, η=3) 333 0.0492 2.31 0.131 0.487 334 0.0718 0.844 0.303 0.151 335 0.0477 1.27 0.122 0.374 336 0.0312 1,95 0.0874 0.523 337 0.0515 1,18 0.173 0.265 338 0.0472 1,29 0.174 0.262 33 0219 (0.00722, η=3) 3.18 (0.768, η=3) 0.0986 (0.0180, η=4) 0.574 (0.231, η=4) 340 0.0823 (0.0288, η =3) 0.852 (0.312, η=3) 0.252 (0.00594, η=4) 0.183 (0.0554, η=4) 341 0.238 0.213 0.373 0.0674 342 0.159 0.32 0.127 0.198 342 0.00 .84 0.124 0.662 344 0.0433 1.79 0.044 1.86 345 0.0649 2.16 0.035 0.937 346 0.144 (0.0284, η=2) 0.604 (0.00648, η=2) 0.128 (0.033 , η=3) 0.210 (0.0493, η=3) 347 0.0827 0.872 0.102 (0.0247, η=2) 0.245 (0.0142, η=2) 348 0.193 0.373 0.113 (0.00703, η =2) 0.224 (0.0269, η=2) 349 0.117 (0.00129, η=2) 0.756 (0.131, η=2) 0.121 (0.0287, η=3) 0.214 (0.0378, η= 3) 350 0.189 0.741 0.107 0.307 Χ-21852 -133- 351 0.298 0.47 0.149 0.22 352 0.127 (0.0116, η=2) 0.815 (0.193, η=2) 0.142 (0.0267, η=3) 0.201 (0.0439, η=3) 353 0.497 0.145 1.09 (0.0881, η=2) 0.0231 (0.00235, η=2) 354 0.233 (0.0309, η=2) 0.441 (0.0871, η=2) 0.540 (0.126, η=3) 0.0517 (0.00657, η=3) 355 0.685 (0.318, η=2) 0.111 (0.0498, η=2) 0.896 (0.00185, η=2) 0.0285 (0 0.00509, η=2) 356 0.386 0.364 0.506 0.0647 357 0.384 0.366 0.181 0.181 358 0.183 (0.0347, η=2) 0.662 (0.0284, η=2) 0.117.02=2) 0.260 (0.0901, η=2) 359 0.172 (0.0235, η=2) 0.706 (0.00679, η=2) 0.131 (0.0201, η=2) 0.227 (0.0647, η=2 ) 360 0.197 0.53 0.145 0.171 361 0.401 0.261 0.955 0.0259 362 0.302 (η=1 / 2) 0.347 (η=1 / 2) 0.365 (0.0425, η=2) 0.0805 (0.0202, η=2) 363 0.145 (0.0185, η=2) 0.835 (0.0159, η=2) 0.208 (0.0485, η=2) 0.146 (0.0522, η=2) 364 0.351 (0, 0809, η=2) 0.347 (0.0290, η=2) 1.00 (0.213, η=2) 0.0303 (0.0103, η=2) 365 0.0678 0.784 0.175 0.155 366 0.0889 0.598 0.366 0.074 367 0.0179 5.85 0.0641 0.386 368 0.0757 0.109 0.108 0.299 Χ-21852 -134pR / nnn / Lznz / e / YiAi 369 0,166 0,499 0,101 0,319 370 0,117 0,704 0,186 0,172 371 0,135 0,393 0,132 0,206 372 0,0781 0,68 0,365 0,0741 373 0,185 0,287 0,436 0,0621 374 0,0468 1,76 0,190 0,169 375 0,0471 1,13 0,152 0.178 376 0.0723 0.734 0.170 0.159 377 0.0544 0.976 0.136 0.199 378 0.067 0.793 0.191 0.142 379 0.079 0.672 0.238 0.115 0.114 380 0.115 0.14 380 As demonstrated by the data in Table 3, the example compounds stimulate cAMP from human GLP-1R and GIPR in the presence of 0.1% casein. IN VIVO STUDIES Pharmacokinetics in male CD-I mice The pharmacokinetics of selected Examples are evaluated after a single subcutaneous administration of 200 nMol / kg to male CD-I mice. Blood samples are collected over 168 hours and resulting individual plasma concentrations are used to calculate pharmacokinetic parameters. Plasma concentrations (K3 EDTA) were determined using a qualified LC / MS method that measures the intact mass of Examples. Each Example and an analogue as internal standard are 100% extracted from mouse plasma using immunoaffinity-based precipitation with antibodies. Χ-21852 FR / nnn / Lznz / e / YiAi anti-GIP / GLP 1. Instruments are combined for LC / MS detection. The mean pharmacokinetic parameters are shown in Table 4. Table 4. Mean pharmacokinetic parameters of peptides after single subcutaneous administration of 200 nMol / kg to male CD-I mice (N=2 / time point non-serial sampling). Peptide Ti / 2(h) Tmax (h) C^max / O (kg * nmol / l / nmo 1) AUClNF_D_obs (h*kg*nmol / l / nmol) Cl / F (ml / h / Kg) Example 1 17.54 12 4.84 135.61 7.37 Example 2 7.55 6 5.4 77.23 12.95 Example 3 15.04 6 4.42 158.49 6.31 Abbreviations: T1 / 2 = half-life, Tmax = time to maximum concentration, Cmax = maximum plasma concentration, AUCINF_D_obs = AUCinf divided by dose, CL / F = clearance / bioavailability. Notes: Data are the mean, where n=2 / time point / group. The results of this study for the Examples tested are consistent with an extended pharmacokinetic profile. Χ-21852 -136FR / nnn / Lznz / e / YiAi Pharmacokinetics in male Cynomolgus monkeys The pharmacokinetics of selected Examples are evaluated after a single subcutaneous administration of 50 nMol / kg to male cynomolgus monkeys. Blood samples are collected over 336 hours and the resulting individual plasma concentrations are used to calculate the pharmacokinetic parameters. Plasma peptide (K3 EDTA) concentrations were determined using a qualified LC / MS method that measures intact compound mass. Each peptide and an analogue as internal standard are 100% extracted from cynomolgus monkey plasma using immunoaffinity-based precipitation with anti-GIP / GLG 1 antibodies. Instruments are combined for LC / MS detection. The mean pharmacokinetic parameters are shown in Table 5. Table 5. Mean pharmacokinetic parameters of peptides after a single subcutaneous administration of 50 nMol / kg to male Cynomolgus monkeys. Example Ti / 2(h) Tmax (h) Cmax / D (kg*nmol / l / nmol) AUCINF_D_obs (h*kg*nmol / l / nmol) Cl / F (ml / h / Kg) Example 1 125.0 18 6.5 1458 0.69 Example 2 102.1 24 11.7 2059 0.49 Example 3 180.6 30 11.38 3420 0.29 Abbreviations: T1 / 2 = half-life, Tmax = time to maximum concentration, Cmax = maximum plasma concentration, AUCINF_D_obs = AUCinf divided by dose, CL / F = clearance / bioavailability. Notes: Data are the mean, where η-2 / group. Notes: Data are the mean, where n=2 / group. As seen in Table 5, the results of this study for the exemplary peptides tested are consistent with an extended pharmacokinetic profile. Pharmacokinetics in male Sprague Dawley rats after subcutaneous or intrajejunal administration The pharmacokinetics of selected examples are evaluated after a single subcutaneous (SC) administration of 50 nMol / kg (dissolved in PBS, pH 7.4) or a single administration Χ-21852 1 pmol / kg intrajejunal (IJ) -137FR / nnn / Lznz / e / YiAi (mixed with 250 mM sodium decanoate (IOC) and 12 mg / ml soybean trypsin inhibitor (SBTI)) to male Sprague Dawley rats . Blood samples are collected for 168 hours after SC administration and 72 hours after U administration. Pharmacokinetic parameters are calculated using individual plasma concentrations. A qualified LC / MS method measuring the intact mass of Example is used to determine plasma concentrations (K3 EDTA). Each peptide is tested with an analogous peptide as an internal standard. Immunoaffinity-based precipitation with anti-GIP / GLP1 antibodies is used to extract each test peptide and the analog. The mean pharmacokinetic parameters for the Examples are shown in Table 6 and Table 7. Table 6. Mean (+ / - SD) pharmacokinetic parameters of peptides after single subcutaneous administration of 50 nMol / kg to male Sprague Dawley rats. Example Ti / 2(h) Tmax (h) Cmax / D (kg * nmol / l / nmol) AUCINF_D_obs (h*kg*nmol / l / nmol) Cl / F (ml / h / Kg) Example 1 44.7 (6.2) 21.3 (4.6) 3.34 (0.22) 294.2 (30.0) 3.42 (0.33) Example 2 20.3 (0.9) 14.7 (2.3) 5.19 (0.20) 231.7 (9.6) 4.32 (0.17) Example 3 32.1 (1.9) 21.3 (4.6) 4.71 (0.50) 371.8(21.8) 2.70 (0.16) Abbreviations: T1 / 2 = half-life, Tmax = time to maximum concentration, Cmax = maximum plasma concentration, AUCINF_D_obs = AUCinf divided by dose, CL / F = clearance / bioavailability. Notes: Data are the mean, where n=3 / group (Table 6) As seen in Table 6, the results of this study using these example peptides are consistent with an extended pharmacokinetic profile. Table 7. Mean (+ / - SD) pharmacokinetic parameters of peptides after a single intrajejunal administration of 1 pmol / kg to male Sprague Dawley rats. Example Tmax (h) Cmax / D (kg * nmol / l / nmol) AUCINF_D_obs (h*kg*nmol / l / nmol) Example 1 1.33 (0.82) 0.08 (0.05) 1.31 (0.85) Χ-21852 -138FR / nnn / Lznz / e / YiAi Example 2 0.25 (0.13) 0.56 (0.40) 6.6 (4.4) Example 3 0.33 (0) 0.47 (0.16) 8.45 (3.1) Data are the mean, where n—3 / group n—6 / group (Table 7). As illustrated by the results in Table 7, these Examples are consistent with exposure after intrajejunal administration. The intrajejunal exposure in this assay supports that the Examples may be suitable for oral formulation and administration. In vivo effect on insulin secretion in male Wistar rats. Male Wistar rats with femoral artery and femoral vein cannulae (Envigo, Indianapolis, IN) (280-320 grams) are housed individually in polycarbonate cages with filter lids. Rats are maintained on a 12:12 h light-dark cycle (lights on at 6:00 AM) at 21 °C and receive food and deionized water ad libitum. Rats were randomized based on body weight and administered 1.5 mL / kg s.c. at doses of 0.04, 0.1, 0.3, 1, 3 and 10 nmol / kg 16 hours before glucose administration and then fasted. Animals are weighed and anesthetized with sodium pentobarbital dosed i.p. (65mg / kg, 30mg / ml). A time 0 blood sample is collected in EDTA tubes, after which glucose is administered i.v. (0.5mg / kg, 5ml / kg). Blood samples are collected to determine glucose and insulin levels at 2, 4, 6, 10, 20, and 30 min after intravenous administration of glucose. Plasma glucose levels are determined by using a clinical chemistry analyzer. Plasma insulin is determined using an electrochemiluminescence assay (Meso Scale, Gaithersburg, MD). AUC of glucose and insulin are examined in comparison to vehicle control with n=5 animals per group. Results (SEM)(N) are presented. Table 8: The effect of example compounds on insulin secretion during the intravenous glucose tolerance test. Dose (nmol / kg, s.c.) Example i 0.0 í.......................... 0.04 32.2 0.1 3L5 (4, 5) (5) 0.3 24.7 (3.0) (5) LO 354 (4.0) (5) 3 43.5 (4.9) (5) 10 634 Χ-21852 -139pR / nnn / Lznz / e / YiAi i I (2.8) 1 1(5) (5.7) (5) (6.5) (5) í 2 | 18.9 I (4.3) (5) 32.8 (3.9) (5) 49.1 (4.8) (5) 82.2 (21.1)(5) 110.9 (23 .1) (5) 108.2 (20.2) (5) 77.3 (8.8) (5) [ 3 í 18.5 i (1.0) (5) 26.0 (3.4 ) (5) 24.6 (3.9) (5) 44.9 (9.6) (5) 60.1 (4.0) (5) 95.5 (18.4) (5) 87, 7 (7,9) (5) i 4 | 33.7 | (5.3, 5) 34.0 (3.4, 5) 42.0 (3.8, 5) 86.3 (4.5, 5) 90.2 (9.2, 5) 108.7 (9.8, 5) 114.6 (16.1, 5) í 5 [ 24.4 ¡ (3.0, 5) 28.2 (4.2, 5) 40.2 (6.0, 5 ) 41.1 (2.7, 5) 44 1 (4.5, 5) 54.3 (11.9, 5) 94.2 (10.1, 5) The data provided by Table 8 demonstrate a dose dependent increase in insulin secretion. Table 9: ivGTT insulin secretion shown by the following data: Insulin secretion (ivGTT) i Example (ED50, nmol / kg) (SEM, n) I 1 >10 ΓΣ 0.1 (0.05. 5) 3 0.7 (0.3, 5) [ i 4 0.2 (0.05, 5) Χ-21852 -140FR / nnn / Lznz / e / YiAi i 5 )3 <ED50<10 j The data provided by Table 9 demonstrate a dose dependent increase in insulin secretion. Studies in C57 / B16 mice with diet-induced obesity Male diet-induced obesity (DIO) C57 / B16 mice (Taconic, Germantown, NY) weighing 41-50 g are used. Animals are individually housed in a temperature-controlled facility (24°C) with a 12-hour light / dark photoperiod (lights off at 10:00 AM and lights on at 10:00 PM), with free access to food and water. After 2 weeks of acclimatization to the facility, mice were randomly assigned to treatment groups (n=6 / group) based on body weight, such that each group has a similar mean baseline body weight. Mice are treated with vehicle (40 mM Tris-HCl pH 8.0) or various peptides between dose ranges of 0.03 nmol / kg to 10 nmol / kg. Treatments are administered subcutaneously to DIO mice fed ad libitum for 30-90 minutes prior to the start of the daily dark (QD) cycle for 14 days. During the course of the study, body weight and food intake are monitored daily. All data are expressed as mean ± SEM of 5-6 rats per group. Statistical analyzes are evaluated by one-way ANOVA followed by Dunnett's test of multiple comparisons to compare treatment groups with the vehicle group or with each other. Significant differences are identified at p<0.05. Body Weight Percentage = Body Weight After 14 Day Treatment x 100 Body Weight Before Starting Treatment Dose group 0 represents vehicle-treated mice during each study. All data are expressed as mean ± SEM of 5-6 mice per group. Statistical analyzes are assessed by one-way ANOVA followed by Dunnett's multiple comparisons test to compare treatment groups at '0' (vehicle) dose. *Significant differences are identified at p<0.05. Change in body weight after treatment with example compounds after 15 days. "Δ from vehicle" refers to the difference between the body weights on day 15 between the test groups and the vehicle groups. % change refers to the percentage decrease in body weight between days 1 and 15 in the Χ-21852 -141pR / nnn / Lznz / e / YiAi test groups. The percentage decrease in body weight of the animals receiving the vehicle is recorded, and is less than about 1% in each study. The Δ data from vehicle and % change are statistically significantly different (p<0.05) than the control for all Examples at all doses tested. Χ-21852 -142pR / nnn / Lznz / e / YiAi Table 10. The effect of GIP / GLP-1 receptor coagonists on percent body weight in diet-induced obese mice after 14 days of treatment. Dose (nmol / kg, s.c., QD) Peptide 0 0.03 0.1 0.3 1 3 10 Example 1 99.2 ±0.8 96.2 ±1.2 95.6 ±0.9 86.7 ±1.3* 86.3 ±1.9* 74.0 ±3.8* 64.7 ±2.6* Example 2 100.5 ±1.4 101.5 ±0.2 95.0 ±1 .2 86.5 ±0.8* 76.4 ±4.0* 76.4 ±2.4* 68.1 ±3.1* Example 3 98.0 ±0.7 99.1± 1.3 95.6 ±1.3 93.0 ±1.1 85.6 ±0.8* 75.9 ±4.3* 73.6 ±1.7 * Example 4 98.3±1.1 96.6 ±0.5 94.7±1.8 88.5±1.2* 76.9±1.4* 66.6+3.9* 64.5±2.2* Example 5 98.3±1 , 1 96.0±1, 3 96.7±1, 1 94.1±1, 8 82.4±1, 6* 83.8±1, 6* 74.9±2, 3* Example 104 99 .2±0.8 94.0±0.6 94.l±0.8 89.0±0.9* 82.7±1.5* 70.8±4.2* 71.3±4, 1* Example 123 99.2±0.8 94.7±0.9 90.5±l, 6* 86.5±1.1* 81.3±2.0* 75.1±1.8* 68.6+1.9* As illustrated by the data provided in Table 10 above, the Example compounds tested in the assay dose-dependently reduce body weight in the described studies. Proteolytic stability assay The proteolytic stability assay is useful to assess the potential for oral administration of peptides. Peptide stability is compared in 1% rat small intestinal fluid (rSIF). The amount of intact peptide is measured for a sample peptide at 0, 3, 15, and 30 minutes to assess proteolytic stability. The amount of intact peptide for a sample peptide is measured in 90% pig small intestine fluid (pSIF) at 0, 30, 45, and 60 minutes to assess proteolytic stability. Sample preparation when using rat small intestinal fluid (rSIF): Peptides are prepared at 0.4 mg / ml in 50 mM Tris, pH 8.0. Rat small intestine fluid is added at a ratio of 1% (v / v). The mixture is incubated at 37 °C at 150 rpm. FR / nnn / Lznz / e / YiAi Χ-21852 -143 Thirty μΐ of each sample are extracted and placed in a new tube before adding the rSIF and at 3, 15 and 60 min. At each time point, the reaction was stopped with 1% TFA in 50% ACN at 1:1. Samples are diluted 100-fold using dilution buffer (1:1 1% TFA in 50% ACN: 50 mM Tris pH 8) and are ready for analysis using mass spectrometry (MS) . Sample preparation when using pig small intestine fluid (pSIF): Peptides are diluted to a concentration of 0.4 mg / ml in 90% pig small intestinal fluid. After mixing, 20 pl are immediately removed (time 0 for the preincubation time point). The mixture is then incubated at 37°C at 150 rpm. Twenty μΐ of each sample is withdrawn and placed in a new tube at 30, 45, and 60 min. At each time point (0, 30, 45, 60), the reaction is stopped with 1% TFA in 50% ACN at 1:1. The sample is centrifuged at 20,000 xg for 20 min at 4 °C. The supernatant is diluted 100-fold using dilution buffer (1:1 1% TFA in 50% ACN: 50 mM Tris, pH 8) and is ready for analysis using mass spectrometry (MS). ). MS Conditions: Liquid chromatography separation is performed on Waters Acquity UPLC using mobile phase A (0.1% formic acid in water) and B (0.1% formic acid in acetonitrile and an ACQUITY UPLC Protein BEH C4 column (300 Á, 1.7 pm, 1 mm x 50 mm) at 40 ° C. Gradient is 5% B over 0-1.5, 5-90% B over 1, 5-1.8, 90-95% B for 1.8-3.0, 95-95% B for 3.0-3.5, 95-5% B for 3.5-4.0 , and 5-5% B for 4.0-5.0.MS analysis is performed on a Waters Xevo G2-XS QTOF.Data are obtained using MSe Continuum over the 50- 2000 m / z in positive and sensitivity mode Data analysis is performed using MassLynx. Table 11. The percentage of each peptide uncleaved at different time points using rSIF. 0 min 3 min 15 min 60 min Example 1 100 82.4 41.4 L6 Example 2 100 75.5 18.3 0.3 Example 3 100 68.8 25.8 0.3 Example 4 100 97.9 99, 3 89.4 Example 69 100 2.2 0.0 0.0 FR / nnn / Lznz / e / YiAi Χ-21852 -144 The proteolytic peptide results provided in Table 11 suggest that the peptide of Example 4 may be suitable for oral formulation and administration. Table 12. The percentage of each peptide uncleaved at different time points using pSIF. 0 min 30 min 45 min 60 min Example 4 100 73.4 56.4 60.0 Example 5 100 76.9 56.8 60.7 The proteolytic peptide results provided in Table 12 suggest that both the peptides of Examples 4 and 5 may be suitable for oral formulation and administration. IN VIVO STUDIES The purpose of this study is to determine the relative potential for clinical immunogenicity of a compound. Methods: CD8+ T cell-depleted peripheral blood mononuclear cells are prepared and labeled with carboxyfluorescein diacetate succinimidyl ester (CFSE, Invitrogen) from a cohort of 10 healthy donors. Samples were tested in triplicate with 2.0 mL of medium control, keyhole limpet hemocyanin (“KLH”) (0.33 μΜ), anti-chemokine receptor type 4 (“CD4+”) (0.33 μΜ ), and a compound of Examples 1, 2 and 3 (10 pM). Cultures were incubated for 7 days at 37 °C with 5% CO2. On day 7, samples are analyzed by flow cytometry using a high throughput sampler (HTS). Data is analyzed using FlowJo® software (FlowJo, LLC, TreeStar). Results and discussion All donors produce a positive T cell response against KLH (100%). Analysis of the frequency and magnitude of the CD4+ T cell response for the Example compounds is shown in Table 13. Table 13: CD4+ T cell responses to the example compounds and positive control (KLH). Χ-21852 -145FR / nnn / Lznz / e / YiAi Donor Response % Mean Response Strength in Positive Donors (CDI) KLH 100% (n=ll) 391 (n=10) Example 1 (GG-212) 9% (n=ll) 0.7 (n=1 ) Example 2 (GG-353) 22% (n=9) 3.68 (n=2) Example 3 (GG-362) 0% (n=9) NA (n=0) Example 4 (GG-427) 0% (n=9) NA (n=0) Example 288 (GG-709) 10% (n=10) 5.42 (n=1) Example 289 (GG-731) 0% (n=10) NA (n=0) Example 301 (GG-650) 0% (n=10) NA (n=0) Example 303 (GG-679) 0% (n=10) NA (n=0) Example 316 (GG- 698) 0% (n=10) NA (n=0) cell division index (CDI): ratio of divided CD4+ T cells to the total number of CD4+ T cells in stimulated versus unstimulated samples. These data show that the frequency of positive CD+ T cell response (CDI>2.5) was low for the compounds of Examples 1, 2, 3, 4, 288, 289, 301, 303 and 316, and the magnitude The response rate in the few positive donors was low (ICD<6), indicating a low risk of immunogenicity using the CD4+ T-cell assay. [35S](GTPyS) binding assay in HEK293 cell membrane with GLP-1R The GLP-1 receptor is a G protein-coupled receptor that increases Gas binding to GTP upon ligand-induced receptor activation. The potency of peptides to stimulate GLP-IR induced Gas activation is determined using purified membrane preparations from HEK293 cells expressing the human GLP-IR. The assay is performed in a similar manner as previously described (Bueno et al., J. Biol. Chem., (2016) 291, 10700 and Willard et al., Mol. Pharmacol. (2012) 82,1066). Test peptides are solubilized in DMSO and diluted in reaction buffer containing 5 pg membrane in 20 mM HEPES pH 7.4, 50 mM NaCl, 5 mM MgCl 2 , 40 pg / ml saponin, 0. 1% and 500 pM 35S-labeled GTPyS for 30 min at room temperature. Reactions are terminated by the addition of 0.2% Nonidet P-40 detergent containing rabbit anti-Gas polyclonal antibody and 0.5 mg anti-polyvinyltoluene beads of pR / nnn / Lznz / e / YiAi Χ-21852 -146rabbit. Mixtures are developed for 30 minutes, centrifuged at 80 x g for 10 minutes, and counted for 1 minute / well using a MicroBeta TriLux instrument. Peptide concentration-response curves are fitted to a four parameter logistic model to calculate potency as an EC50. Data normalization to % stimulation is performed using DMSO and GLP-l(7-36) as minimum and maximum controls for the receptor (Campbell et al., Assay Guidance Manual 2017). The potency of a sample peptide to stimulate GIPR-induced activation of Gasse is reported in Table 14. The assay results identify a peptide that is a partial agonist at the GLP-1R with respect to GLP-1R-induced activation. Of gas. β-Arrestin Recruitment Assay by GLP-1R of CHO Cells Activated G protein-coupled receptors can interact with the β-arrestin family of signaling proteins. The potency of peptides for GLP-1R-induced arcstin recruitment is determined by using the PathHuntcr Enzyme Fragment Complementation approach substantially as described (von Degenfeld et al., FASEB J., 2007(14):3819-26 and Hamdouchi et al., J. Med Chem., 2016 59(24):1089110916). CHO-K1 cells expressing Pro-Link-tagged human GLP-1R and enzyme acceptor-tagged βarrestin-2 can be obtained from DiscoveRx and prepared as assay-ready frozen cells. Test peptides are solubilized in DMSO and serial dilutions are made using the Echo acoustic dispenser (LabCyte). The assay medium is PathHunter Cell Assay Buffer (DiscoveRx) containing 0.1% w / v hydrolyzed casein (Sigma). 100 ni of peptide in 10 μΐ of assay medium are dispensed into a 384-well plate and then 10 μΐ of cells in assay medium are added to give 5,000 cells per well. Plates are incubated for 90 minutes in a 37°C / 5% C02 incubator and 10 μΐ PathHunter Detection Reagent (DiscoveRx) is added and plates are incubated at room temperature for 60 minutes. The luminescence signal is measured. Peptide concentration-response curves are fitted to a four parameter logistic model to calculate potency as an EC50. Data normalization to % stimulation is done by using DMSO and GLP-1(7-36) as min and max controls (Campbell et al., Assay Guidance Manual 2017). The potency of a sample peptide to stimulate GLP-IR-induced β-arrestin recruitment is presented in Fig. Χ-21852 -147pR / nnn / Lznz / e / Yi / u Table 14. Assay results identify a peptide that is a partial agonist at the GLP-1R with respect to p-arrestin-2 recruitment. Table 14 Example hGLPIR GTPgS Rei EC50 nM (SEM, n) hGLPIR GTPgS % Higher (SEM, n) hGLPIR B- Arrestin 2 Rei EC50 uM (SEM, n) hGLPIR BArestin 2 % Higher (SEM, n) 0.475 (0.0322, n =115) 99.2 (0.659, n=115) 0.00274 (0.000359, n=42) 104 (3.45, n=42) 1 0.235 (0.0201, n=5) 91.1 ( 1.77, n=5) 0.005 105 2 0.642 (0.0294, n=2) 95.9 (0.553, n=2) 0.00882 (0.00269, n=2) 96.1 (0.742, n =2) 3 0.421 (0.181, n=2) 95.4 (2.20, n=2) 4 0.245 (0.0638, n=3) 86.9 (5.93, n=3) 0.00480 (0.000138, n=2) 92.4 (14.0, n=2) 5 0.196 (0.0375, n=3) 91.3 (6.90, n=3) 266 0.865 (0.328, n =2) 63.4 (1.31, n=2) 0.016 17.1 267 0.867 62.3 0.00901 16.5 272 0.651 (0.0427, n=2) 66.5 (0.741, n=2 ) >12.0 NA 298 1.03 57.3 300 0.405 85.6 0.0054 38.4 301 0.435 (0.0848, n=3) 91.4 (3.63, n=3) 0.00267 93.7 302 0.268 98.6 0.00219 98.4 Χ-21852 -148FR / nnn / Lznz / e / YiAi 303 0.547 (0.0998, η=2) 74.3 (2.99, η=2) 0.0179 47.7 304 0.561 77.1 305 0.389 76.3 306 0.378 76.1 315 0.601 44.2 0 .0199 25.4 316 0.766 (0.0469, η=2) 56.7 (3.14, η=2) 0.00608 26.1 317 0.536 53.7 318 0.415 58.4 288 0.666 (0.104, η =3) 66.7 (4.09, η=3) 0.00674 (0.00278, η=3) 21.3 (1.94, η=3) 319 0.657 65.7 323 0.79 81, 9 324 0.475 84.5 289 0.404 (0.0247, η=3) 83.7 (3.81, η=3) 0.0124 (0.00151, η=3) 51.3 (6.05, η =3) 325 0.414 97.9 326 0.663 61.6 327 0.287 75.6 0.00379 41.6 328 0.481 66.3 329 0.343 83.6 0.00473 63.4 330 1.05 (0.275, η=2 ) 47.8 (1.16, η=2) >10.9 NA 331 0.375 (0.0274, η=4) 80.9 (2.54, η=4) 0.0128 44.3 332 0.453 ( 0.0479, η=4) 81.5 (4.65, η=4) 0.0171 45.6 333 0.442 (0.00535, η=2) 83.4 (0.439, η=2) 0.0548 58.2 334 0.432 70.2 >10.3 NA Χ-21852 -149- 335 0.285 89.3 0.00531 73 336 0.377 90.2 0.00778 82.5 290 0.466 (0.0664, η=9) 66.2 (3.12, η=9) 0.0238 (0.00530 , η=4) 20.0 (1.15, η=4) 337 0.322 59.5 0.0174 34.1 338 0.0189 47 339 0.326 (0.0357, η=3) 74.1 (7, 97, η=3) 0.0107 (0.00238, η=2) 44.0 (2.40, η=2) 340 0.450 (0.0182, η=5) 67.4 (5.12, η =5) 0.0107 (0.00711, η=4) 20.1 (2.31,η=4) 341 0.496 78.9 0.0188 21.9 342 0.414 77.2 0.035 20.7 343 0.522 74 .9 0.0455 41.4 344 0.423 85.8 0.0343 46 345 0.684 62 0.00308 (0.000666, η=2) 74.7 (2.86, η=2) 346 0.737 (0.201, η =3) 56.6 (3.94, η=3) 0.00325 (0.00105, η=3) 19.3 (0.767, η=3) 347 0.759 46.9 0.00542 (0.00152, η=2) 24.6 (2.81, η=2) 348 0.66 47.7 0.00346 (η=1 / 2) 19.8 349 0.464 (0.0290, η=4) 64.5 (1.68, η=4) 0.0151 (0.00111, η=2) 18.4 (0.337, η=2) 350 0.589 64.1 0.0108 21.8 351 0.563 66.5 0.0196 23.5 352 0.552 (0.0267, η=2) 63.5 (1.51, η=2) 0.00421 (η=1 / 2) 17.4 353 1.96 63.1 0.559 (0.108, η=2) 23.0 (0.408, η=2) 291 0.466 (0.0476, η=6) 65.0 (2.15, η=6) >10.0 (η-1 / 4) NA Χ-21852 -150- 354 0.967 53.3 0.255 (η=1 / 2) 22.7 355 1.76 50.6 0.363 18.3 356 >10.5 NA 357 0.118 18.2 358 0.414 (0.00356, η=2) 72 .3 (1.27, η=2) 0.00938 (0.00413, η=3) 21.4 (2.47, η=3) 359 0.496 69.7 0.0841 28.4 360 0.0395 25.8 361 0.269 (η=1 / 2) 20.2 362 >11.0 ND 363 0.943 69.6 0.135 22.1 364 >12.0 ND 292 0.429 (0.0190, η=4) 71.5 (3.33, η=4) 0.00774 (0.00199, η=4) 29.0 (3.96, η=4) 293 0.368 (0.0304, η=4) 70.6 (0.715, η=4) 0.00719 (0.00168, η=4) 29.5 (6.23, η=4) 365 0.464 (0.0178, η=3) 66.9 (1.35, η=3 ) 0.00703 (0.00233, η=4) 20.8 (1.78, η=4) 366 0.409 (0.0308, η=3) 67.6 (3.55, η=3) 0, 00557 (0.00363, η=2) 21.2 (0.163, η=2) 367 0.289 89.7 0.00666 (0.00118, η=2) 70.6 (8.61, η=2) 368 0.495 68.9 0.0479 (0.0205, η=2) 21.3 (4.03, η=2) 369 0.381 58.8 0.0414 (η=1 / 2) 19.9 370 0.428 63, 7 0.00990 (0.00149, η=2) 23.0 (0.470, η=2) 371 0.27 62.5 0.0142 (0.00333, η=2) 21.7 (0.711, η= 2) Χ-21852 -151- 372 0.379 69.1 0.00981 (0.00630, n=2) 32.9 (1.65, n=2) 373 0.336 65.6 0.00954 (0.00348, n=2) 22.9 ( 5.88, n=2) 374 0.345 67.1 0.0218 34.7 375 0.419 70.4 0.0114 24.2 376 0.326 72.6 0.0123 25.6 377 0.356 68.4 0.00532 16 .7 378 0.359 68.6 >10.2 NA 379 0.239 71 0.0181 31.9 380 0.188 66.8 0.0137 35 381 0.273 73.6 0.0155 25.8 Comparator Tirzepatide 0.442 (se=0.0311 , n=9( 62.9 (se=1,28, n=9) >10.5 (n=1 / 5) NA Example hGLPIR B-Arrestin 2 Rei EC50 uM (SEM, n) hGLPIR B-Arrestin 2% Superior (SEM, n) 0.00274 (0.000359, n=42) 104 (3.45, n=42) 1 0.005 105 2 0.00882 (0.00269, n=2) 96.1 (0.742, n=2) 3 4 0.00480 (0.000138, n=2) 92.4 (14.0, n=2) 266 0.016 17.1 267 0.00901 16.5 Χ-21852 -152FR / nnn / Lznz / e / YiAi 272 >12.0 NA 300 0.0054 38.4 301 0.00267 93.7 302 0.00219 98.4 303 0.0179 47.7 315 ​​0.0199 25.4 316 0.00608 26.1 288 0 .00674 (0.00278, η=3) 21.3 (1.94, η=3) 289 0.0124 (0.00151, η=3) 51.3 (6.05, η=3) 327 0 .00379 41.6 329 0.00473 63.4 330 >10.9 ND 331 0.0128 44.3 332 0.0171 45.6 333 0.0548 58.2 334 >10.3 ND 335 0.00531 73 336 0.00778 82.5 290 0.0238 (0.00530, η=4) 20.0 (1.15, η=4) 337 0.0174 34.1 338 0.0189 47 339 0.0107 (0 .00238, η=2) 44.0 (2.40, η=2) 340 0.0107 (0.00711, η=4) 20.1 (2.31, η=4) 341 0.0188 21, 9 342 0.035 20.7 Χ-21852 -153- 343 0.0455 41.4 344 0.0343 46 345 0.00308 (0.000666, η=2) 74.7 (2.86, η=2) 346 0.00325 (0.00105, η=3) 19.3 (0.767, η=3) 347 0.00542 (0.00152, η=2) 24.6 (2.81, η=2) 348 0.00346 (η=1 / 2) 19.8 349 0.0151 (0.00111, η=2) 18.4 (0.337, η=2) 350 0.0108 21.8 351 0.0196 23.5 352 0.00421 (η=1 / 2) 17.4 353 0.559 (0.108, η=2) 23.0 (0.408, η=2) 291 >10.0 (η=1 / 4) NA 354 0.255 (η=1 / 2) 22.7 355 0.363 18.3 356 >10.5 NA 357 0.118 18.2 358 0.00938 (0.00413, η=3) 21.4 (2.47, η=3) 359 0.0841 28.4 360 0.0395 25.8 361 0.269 (η=1 / 2) 20.2 362 >11.0 NA Χ-21852 -154FR / nnn / Lznz / e / YiAi 363 0.135 22.1 364 >12.0 NA 292 0.00774 (0.00199, η=4) 29.0 (3.96, η=4) 293 0.00719 (0.00168, η=4) 29 .5 (6.23, η=4) 365 0.00703 (0.00233, η=4) 20.8 (1.78, η=4) 366 0.00557 (0.00363, η=2) 21 .2 (0.163, η=2) 367 0.00666 (0.00118, η=2) 70.6 (8.61, η=2) 368 0.0479 (0.0205, η=2) 21.3 (4.03, η=2) 369 0.0414 (η=1 / 2) 19.9 370 0.00990 (0.00149, η=2) 23.0 (0.470, η=2) 371 0.0142 (0.00333, η=2) 21.7 (0.711, η=2) 372 0.00981 (0.00630, η=2) 32.9 (1.65, η=2) 373 0.00954 (0 .00348, η=2) 22.9 (5.88, η=2) 374 0.0218 34.7 375 0.0114 24.2 376 0.0123 25.6 377 0.00532 16.7 378 >10 .2 NA 379 0.0181 31.9 380 0.0137 35 381 0.0155 25.8 Χ-21852 -155FR / nnn / Lznz / e / YiAi Composition for oral administration A peptide is dissolved in Tris buffer (pH 8.0, 50 mM). A permeation enhancer (PE) is prepared as follows: CIO is dissolved in Tris buffer (pH 8.0, 50 mM), LC, DPC, C12 maltoside, and rhamnolipid are each dissolved in phosphate-buffered saline ( PBS) (IX, pH 7.2). A solution of peptide, PE, and protease inhibitor are mixed to achieve a final peptide concentration of 300 uM, 100 mM PE (5% w / v rhamnolipid) and 1% (v / v) for the protease inhibitor. . A peptide is incubated at 37°C in 1% (v / v) rat small intestine fluid or 50% (v / v) pig small intestine fluid with and without a peptidase inhibitor. At 10 different time points, samples are taken, followed by quenching with 1% TFA in 50% ACN / water to stop enzyme activity. Intact peptide at different time points is analyzed by high performance liquid chromatography (HPLC) equipped with an ultraviolet (UV) detector or LC-MS / MS and normalized for the amount of peptide prior to mixing with the enzyme solution. A study using a peptide from Example 2 and a peptide from Example 4 is reported in Table 15. Table 15 % intact peptide Recombinant protease inhibitor (concentration) Small intestinal fluid 0 min 15 min 30 min 60 min rSBTI (5 mg / mL) + peptide (Example 4) 50% v / v pig 100.00 96.96 96.28 88.57 Peptide Example 4 (without PI; control) 50% v / v pig 100.00 72.52 41.44 18.98 rSBTI (5 mg / ml) + Peptide Example 2 50% v / v pig 100.00 103.02 112.69 87.33 Peptide Example 2 (no PI; control) 50% v / v pig 100.00 2.42 1.90 3.09 rSBTCI (0.5 mg / ml) + Peptide Example 2 50% v / v pig 100.00 131.71 126.53 123.70 Χ-21852 -156pR / nnn / Lznz / e / YiAi The results in Table 15 support that an oral formulation composition for a peptide of Example 4 can be prepared by using a PE and without Pl. Oral formulation composition Table 16 provides examples of formulation compositions for a peptide of this invention. The peptide formulation compositions of this invention are not limited in any way by the examples provided. Table 16 Formulation Formulation composition Concentration 1 Peptide (Example 1; or Example 4 or Example 3) 2.4 mg / ml 250 mM CIO SBTI 75 mg / ml 2 Peptide (Example 1) 2.4 mg / ml 500 mM LC Citric acid 500 mM 3 Peptide (Example 1) 2.4 mg / m NaTDC 250 mM SBTI 75 mg / ml 4 Peptide (Example 1, Example 2 or Example 4) 2.4 mg / ml CIO 250 mM SBTI 12 mg / ml 5 Peptide (Example 1 or Example 2) 2.4 mg / ml CIO 125 mM SBTI 12 mg / ml 6 Peptide (Example 1) 2.4 mg / ml CIO 125 mM SBTI 24 mg / ml 7 Peptide (Example 4) 2.4 mg / ml CIO 250 mM SFTI 12 mg / ml The effect of formulation composition on peptide exposure is assessed in rats via intrajejunal (U) administration using liquid formulations. To prepare liquid formulations for U administration to a rat, a FR / nnn / Lznz / e / YiAi Χ-21852 -157peptide, CIO or NaTDC and SBTI in 50 mM Tris buffer, pH 8.0 and mix to achieve the desired final concentration. For the LC / citric acid formulation, the LC and citric acid are dissolved in water and mixed with a peptide dissolved in Tris buffer. The formulation compositions provided in Table 16 can be administered as an oral composition. enteric capsules An enteric capsule composition may be desired for certain peptides of this invention and may be prepared using methods, for example, as set forth in Table 17. Enteric compositions may be prepared by mixing ingredients and filling the mixture into enteric capsules. An enteric composition of Table 17 is prepared by adding half the indicated amount of sodium decanoate to a mortar. SBTI (for Examples 382-385) or SFTI (for Examples 386 and 387), and a peptide (peptides from Examples 1-4), as shown in Table 17. Add the remaining half of the sodium decanoate . A mixture is gently mixed by using a mortar and trowel. If desired, further mixing by use of a mortar and pestle provides a homogeneous mix. A capsule can be manually filled by individually weighing the required amount of mix, filling into capsules, and securely closing the capsule caps to the capsule bodies. The single capsule dissolution test is completed using known methods. A peptide of this invention can be formulated as an enteral oral composition. Χ21852 -158- Peptide Component Enteric Example 382 Enteric Example 383 Enteric Example 384 Enteric Example 385 Enteric Example 386 Enteric Example 387 Example 2 12.50 12.50 Example 4 12.50 12.50 Example 1 12.50 Example 3 12.50 Sodium Decanoate ( CIO) 250.00 250.00 250.00 250.00 250.00 250.00 SBTI 62.50 62.50 62.50 62.50 SFTI 62.50 62.50 Total capsule fill weight 325.00 325.00 325.00 325.00 325.00 325.00 Capsule size Size 00 Size 00 Size 00 Size 00 Size 00 Size 00 Table 17: Individual enteric capsule composition for the formulation FR / nnn / Lznz / e / YiAi PR / nnn / Lznz / e / YiAi Χ21852 -159Amino acid sequences SEQ ID NO:1 GIP (human) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ SEQ ID NO:2 GLP-1 (7-3 6)(Human) HAEGTFTS D VS S YLEGQA AKEFIAWLVKGR-NH2 SEQ ID NO:3 R1X1 X2X3GT X6TSD Χίο X11 X12 X13 XuD X16X17AX19 X2o X21 X22X23 X24 X25 X26 X27 X28 X29 X30X31 SEQ ID NO:4 PX32 X33 X34-R2 SEQ ID NO:5 PX32X33X34X35X36X37X38X39-R2 SEQ ID NO:6 PX32 X33 X34 X35X36 X37 X38 X39 X40-R2 SEQ ID NO:7 K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)q-CO2H] X32X33 X34-R2 SEQ ID NO:8 K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)q-CO2H] X32X33 X34 X35X36 X37 X38 X39-R2(SEQ ID NO:9) K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)q-CO2H] X32X33 X34 X35X36 X37 X38 X39 X40-R2pR / nnn / Lznz / e / YiAi Χ21852 -160(SEQ ID NO: 10) Example 1 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LDEK((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(y-Glu)CO-(CH2)i8- CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 SEQ ID NO: 11 Example 2 Y-Aib-EGT-aMeF(2F)-TSDYSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxyJacetyl)2-(y-Glu)-CO-(CH2) i6-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2 SEQ ID NO: 12 Example 3 Y-Aib-EGT-aMcF(2F)-TSDYSI-aMcL-LD-Orn-K((2-[2-(2-amino-ctoxy)-ctoxy]-acctil)2-(yGlu)-CO-(CH2 )i8-CO2H)AQ-Aib-EFI-(D-Glu)-YLIEGGPSSGAPPPS-NH2(SEQ ID NO: 13) Example 4 Y-Aib-EGT-aMeF(2F)-TSD-4Pal-SI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu) -CO-(CH2)i6-CO2H)AQ-Aib-EFI-(D-Glu)-aMeY-LIEGGPSSGAPPPS-NH2 SEQ ID NO: 14 Example 5 Y-Aib-EGT-aMeF(2F)-TSDVSI-aMeL-LD-Orn-K((2-[2-(2-amino-ethoxy)-ethoxy]-acetll)2-(yGlu)-CO-(CH2 )i6-CO2H)AQ-Aib-EFI-(D-Glu)-aMeY-LIEGGPSSGAPPPS-NH2 SEQ ID NO:297 PSSG-R2 SEQ ID NO:298 PSSGAPPPS-R2 Χ21852 -161FR / nnn / Lznz / e / YiAi SEQ ID NO:299 PSSG SEQ ID N0:300 PSSG-NH2 SEQ ID NO:301 PSSGAPPPS SEQ ID NO:302 PSSGAPPPS-NH2

Claims

CLAIMS 1. A compound of the formula: R1X1X2X3GTX6TSDX10X11X12X13X14DX16X17AX19X20X21X22X23X24X25X26X27X28X29X30X31 (SEQ ID NO:3) wherein: Ri is a modification of the N-terminal amino group wherein the modification is selected from the group consisting of Ac and absent; Xi is selected from the group consisting of Y, H, D-Tyr, F, desH and desY; X2 is selected from the group consisting of Aib, aMeP, A, P and D-Ala; or Xi and X2 combine to form desH-[NHCO]-Aib; X3 is selected from the group consisting of E, N, Aad and cTA; Xó is selected from the group consisting of F, aMeF and aMeF(2F); X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, E, aMeF, aMeF(2F), I, aMeY, Q, D-His, D-Tyr, cTA and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X11 is selected from the group consisting of S, aMeS, and D-Ser; X12 is selected from the group consisting of I, S, D-Ile and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H;X13 is selected from the group consisting of Nle, Aib, L, aMeL and K(2-[2-(2-amino-ethoxy)ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X14 is selected from the group consisting of L and K, wherein K is conjugated with a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated with said K through a linker; X16 is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK, R and K(2-[2-(2-amino-ethoxy)ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X17 is selected from the group consisting of K, Q, I, and an amino acid conjugated with a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated with said amino acid through a linker; X19 is selected from the group consisting of Q, A, and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)qCO2H; X2o is selected from the group consisting of Aib, Q, H, R, K, aMeK, and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(y-Glu)-CO-(CH2)qCC>2H;FR / nnn / Lznz / e / YiAi Χ21852 -163Χ21 is selected from the group consisting of H, Aad, D, Aib, T, A, E, I and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-CO(2CH2)q; X22 is selected from the group consisting of F and aMeF; X23 is selected from the group consisting of I, L, A, G, F, Η, E, V and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H; X24 is selected from the group consisting of S, Aad, D-Glu, E, Aib, Η, V, A, Q, D, P and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H; X25 is selected from the group consisting of Y and aMeY; X26 is selected from the group consisting of L, aMeL and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H; X27 is selected from the group consisting of L, I and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(Y-Glu)-CO-(CH2)qCO2H; X28 is selected from the group consisting of E, A, S, D-Glu and K(2-[2-(2-amino-ethoxy)ctoxi]-acctyl)2-(Y-Glu)-CO-(CH2)qCO2H;X29 is selected from the group consisting of Aib, G, A and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H; X30 is selected from the group consisting of C, G, G-R2 and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H; X31 is absent from the group consisting of PX32X33X34-R2 (SEQ ID NO:4), PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), PX32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:6), K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)q-CO2H] X32X33X34-R2 (SEQ ID NO:7), K[(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO(CH2)q-CO2H] X32X33X34X35X36X37X38X39-R2 (SEQ ID NO:8), and K[(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)q-CO2H] X32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:9); en donde: X32 es S o K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X33 is S o K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2HJ; X34 is selected from the group consisting of G, C and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H];X35 is A or K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X36 is P or K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X37 is P or K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; pR / nnn / Lznz / e / YiAi Χ21852 -164Χ38 is P or K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X39 is selected from the group consisting of C, S and K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; X40 is selected from the group consisting of C and K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)qCO2H]; q is selected from the group consisting of 14, 15, 16, 17, 18, 19 and 20; and R2 is a modification of the C-terminal group, wherein the modification is NH2 or absent; or a pharmaceutically acceptable salt thereof; wherein if X30 is G-R2, then X31 is absent;wherein no more than one of X12, X13, X14, X17, X19, X20, X21, X23, X24, X26, X27, X28, X29, X30, X31, X32, X33, X34, X35, X36, X37, X38, X39, and X40 may be a fatty acid-containing substituent; and wherein no more than one of X30, X34, X39, and X40 may be C; and where if one of X30, X34, X39, and X40 is C, then none of Chio, X12, X13, X14, X16, X17, X19, X20, X21, X23, X24, X26, X27, X28, X29, X30, X31, X32, X33, X34, X35, X36, X37, X38, X39, and X40 is a substituent containing a fatty acid.

2. A compound, or a pharmaceutically acceptable salt thereof, according to claim 1, wherein Xi and X2 do not combine to form desH-ψ[NHCO]-Aib.

3. A compound, or a pharmaceutically acceptable salt thereof, according to claim 1 or claim 2, wherein X· ? is an amino acid conjugated with a Ci6-C22 fatty acid.

4. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 3, wherein: Xi is Y; X2 is Aib; X3 is E; Xio is selected from the group consisting of A, L, H, 3Pal, 4Pal, V and Y; Xn is S; X12 is I; X14 is L; X16 is selected from the group consisting of K, E, Orn, Dab and Dap; FR / nnn / Lznz / e / YiAi X21852 -165Xi7 is K conjugated with a fatty acid Ció-C22, wherein said fatty acid is conjugated to K via a linker; X19 is Q; X20 is Aib; X21 is selected from the group consisting of H, Aad, D, Aib, T, A and E; X22 is F; X23 is I; X24 is selected from the group consisting of S, Aad, D-Glu and E; X26 is L; X27 is selected from the group consisting of L and I; and X28 is selected from the group consisting of E and A.

5. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 4, wherein: X30 is G and X31 is PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), wherein X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P and X39 is S (SEQ ID NO:298).

6. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1, 2 or 5, wherein Xn is K.

7. A compound, or a pharmaceutically acceptable salt thereof, according to claim 6 wherein the linker comprises one to two amino acids.

8. A compound, or a pharmaceutically acceptable salt thereof, according to claim 7, wherein the linker comprises one to two (2-[2-(2-aminoethoxy)ethoxy]acetyl) residues.

9. A compound, or a pharmaceutically acceptable salt thereof, according to claim 8, wherein the linker comprises one or two amino acids independently selected from the group consisting of Glu and γ-Glu.

10. A compound, or a pharmaceutically acceptable salt thereof, according to claim 9 wherein the linker has the following formula: {(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)a-(y-Glu)b, wherein a is 1 or 2; yb is 1 or 2.

11. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 10, wherein X17 is K(2-[2-(2-aminoethoxy)ethoxy]acetyl)a-(y-Glu)b-CO-(CH2)q-CO2H, wherein: a is 1 or 2; b is 1 or 2; yq is selected from the group consisting of 14 to 20. FR / nnn / Lznz / e / YiAi X21852 -166- 12. A compound, or a pharmaceutically acceptable salt thereof, according to claim 11, wherein a is 1.

13. A compound, or a pharmaceutically acceptable salt thereof, according to claim 11, wherein a is 2.

14. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 11 to 13, wherein b is 1.

15. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 11 to 13, wherein b is 2.

16. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 11 to 15, wherein q is 18.

17. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 11 to 15, wherein q is 16.

18. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 11, wherein X17 is K(2-[2-(2-amino-ctoxy)-ctoxy]acetyl)2-(y-Glu)-CO-(CH2)q-CO2H.

19. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 18, wherein X27 is I.

20. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 18, wherein X27 is L.

21. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 19, wherein: Ri is absent; Xi is Y; X2 is Aib; X3 is E; Xó is aMeF(2F); Xio is selected from the group consisting of Y, 4-PaI and V; X11 is S; X12 is I; X13 is selected from the group consisting of L, Aib and aMeL; X14 is L; X16 is selected from the group consisting of E, K and Orn; X21852 -167pR / nnn / Lznz / e / Yi / u X17 is K; X19 is Q; X20 is Aib; X21 is selected from the group consisting of E, A and T; X22 is F; X23 is i; X24 is D-Glu; X26 is L; X27 is I; X28 is E; X29 is G; X30 is G; and X31 is PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), where X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P and X39 is S (SEQ ID NO:298).

22. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 21, wherein X25 is Y.

23. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 22, wherein X13 is aMeL.

24. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 23, wherein Xió is Orn.

25. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 23, wherein Xió is E.

26. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 25, wherein X10 is Y.

27. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 25, wherein Xw is V.

28. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 25, wherein X10 is 4Pal.

29. A compound, or a pharmaceutically acceptable salt thereof, according to claim 11, wherein X13 is aMeL; a is 2; b is 1; q is 16; and X25 is Y.

30. A compound, or a pharmaceutically acceptable salt thereof, according to claim 11, wherein X13 is aMeL; a is 2; b is 1; q is 18; and X25 is Y. FR / nnn / Lznz / e / YiAi Χ21852 -168- 31. A compound, or a pharmaceutically acceptable salt thereof, according to claim 11, wherein X13 is aMeL; a is 2; b is 1; q is 14; and X25 is Y.

32. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 24, wherein X10 is Y; and Xi6 is Orn.

33. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 23, wherein X10 is Y; and Xi6 is E.

34. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 23, wherein X10 is 4Pal; and Xie is Orn.

35. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 23, wherein X10 is V; and Xie is Orn.

36. A compound according to claim 1, wherein the compound is selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, or a pharmaceutically acceptable salt thereof.

37. A compound according to claim 36, wherein the compound is SEQ ID NO:13, or a pharmaceutically acceptable salt thereof.

38. A compound according to claim 36, wherein the compound is SEQ ID NO:11 or a pharmaceutically acceptable salt thereof.

39. A compound, or a pharmaceutically acceptable salt thereof, according to claim 1 wherein: X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, aMeF, aMeF(2F), I, aMeY, Q, D-His, E, D-Tyr; X12 is selected from the group consisting of I, D-Ile and S; X13 is selected from the group consisting of Nle, Aib, L and aMeL; X14 is L; X16 is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK and R; X17 is selected from the group consisting of K, Q and I; X19 is selected from the group consisting of Q and A; X20 is selected from the group consisting of Aib, Q, H, R, K and aMeK; X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E and I; Χ21852 -169FR / nnn / Lznz / e / YiAi X23 is selected from the group consisting of I, L, A, G, F, Η, E and V; X24 is selected from the group consisting of S, Aad, D-Glu, E, Aib, Η, V, A, Q, D and P; X26 is selected from the group consisting of L and aMeL; X27 is selected from the group consisting of L and I;X28 is selected from the group consisting of E, A, S and D-Glu; and X29 is selected from the group consisting of Aib, G and A.; 40. A compound, or a pharmaceutically acceptable salt thereof, according to claim 39, wherein: Xi is Y; X2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V and Y; X11 is S; X12 is I; X16 is selected from the group consisting of K, E, Orn, Dab and Dap; X19 is Q; X20 is selected from the group consisting of Aib and K; X21 is selected from the group consisting of H, Aad, D, Aib, T, A and E; X22 is F; X23 is I; X24 is selected from the group consisting of S, Aad, D-Glu and E; X26 is L; and X28 is selected from the group consisting of E and A.

41. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 39 or 40, wherein one of X30, X34 and X39 is C.

42. A compound, or a pharmaceutically acceptable salt thereof, according to claim 41, wherein the compound is modified by the use of time extension technology.

43. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 39 to 42, wherein q is 18. FR / nnn / Lznz / e / YiAi Χ21852 -170- 44. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 39 to 42, wherein q is 16.

45. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 39 to 44, wherein X27 is L.

46. ​​A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 39 to 45, wherein X31 is PX32X33X34X35X36X37X38X39R2.

47. A compound, or a pharmaceutically acceptable salt thereof, in accordance with any one of claims 39 to 45 wherein X31 is absent.

48. A compound, or a pharmaceutically acceptable salt thereof, according to claim 47, wherein R2 is NH2 49. A compound, or a pharmaceutically acceptable salt thereof, according to claim 1 wherein: X14 is L; X17 is selected from the group consisting of K, Q and I; X30 is selected from the group consisting of G-R2 and G; and Q is selected from the group consisting of 16, 18 and 20; wherein if X30 is G, then X31 is selected from the group consisting of: PX32X33X34-R2 (SEQ ID NO:4), wherein: X32 is S, X33 is S, X34 is G and R2 is absent (SEQ ID NO:299) or X32 is S, X33 is S, X34 is G and R2 is NH2 (SEQ ID NO:300); and PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), where: X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, X39 is S and R2 is absent (SEQ ID NO:301) or X32 is S, X33 is S, X34 is G, X35 is A, X36 is P, X37 is P, X38 is P, X39 is S and R2 is NH2 (SEQ ID NO:302); and where one of Χίο, X12, X13, X14, Xie, X19, X20, X21, X23, X24, X26, 50. A compound, or a pharmaceutically acceptable salt thereof, according to claim 49 wherein: pR / nnn / Lznz / e / YiAi X21852 -171Xi is Y; X2 is Aib; X3 is E; X10 is selected from the group consisting of A, L, H, 3Pal, 4Pal, V, Y, E, cTA and K(2-[2(2-amino-ethoxy)-ethoxy]acetyl)2-yGlu-CO-(CH2)qCO2H; X11 is S; X12 is selected from the group consisting of I, D-Ile and K(2-[2-(2-amino-ethoxy)-ethoxy]acetyl)2-yGlu-CO-(CH2)qCO2H; X14 is selected from the group consisting of L and K(2-[2-(2-amino-ethoxy)-ethoxy]-acetyl)2(y-Glu)-CO-(CH2)qCO2H; X16 is selected from the group consisting of K, E, Om, Dab, Dap and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2-yGlu-CO-(CH2)qCO2H; X17 is selected from the group consisting of K and I; X19 is selected from the group consisting of Q and K(2-[2-(2-amino-ctoxy)-ctoxy]-actyl)2yGlu-CO-(CH2)qCO2H; X2o is selected from the group consisting of Aib and K(2-[2-(2-aminoethoxy)-ethoxy]-acetyl)2yGlu-CO-(CH2)qCO2H;X21 is selected from the group consisting of H, Aad, D, Aib, T, A, E and K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2-yGIu-CO-(CH2)qCO2H; X22 is F; X23 is I; X24 is selected from the group consisting of S, Aad, D-Glu, E and K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2-(y-Glu)-CO-(CH2)qCO2H; X26 is selected from the group consisting of L and K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2(y-Glu)-CO-(CH2)qCO2H; X2v is selected from the group consisting of L and I; X2g se selecciona del grupo que consiste en E, A y K(2-[2-(2-amino- etoxi)-etoxi]-acetil)2(y-Glu)-CO-(CH2)qCO2H; X30 is G; and FR / nnn / Lznz / e / YiAi Χ21852 -172Χ33 is S; X34 is G; X35 is A, X36 is P; X37 is P; X38 is P; and X39 is S.; 51. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 49 to 50, wherein X20 is K(2-[2-(2-amino-ethoxy)ethoxy]-acetyl)2-(Y-Glu)-CO-(CH2)qCO2H.

52. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 49 to 51, wherein PX32X33X34X35X36X37X38X39-R2 is selected from the group consisting of PSSGAPPPS (SEQ ID NO:301) and PSSGAPPPSNH2 (SEQ ID NO:302).

53. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 49 to 52, wherein q is 18.

54. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 49 to 52, wherein q is 16.

55. A compound, or a pharmaceutically acceptable salt thereof, according to claim 1 wherein: Xi is selected from the group consisting of Y, F, D-Tyr and desY, X is F; and X13 is selected from the group consisting of Aib, L and aMeL 56. A pharmaceutically acceptable compound, or salt, according to claim 55, wherein Ri is absent; X2 is Aib; X3 is E; Xio is Y; X11 is S; Xi2 is I; X14 is L; X16 is selected from the group consisting of K, E, Orn, Dab, Dap, S, T, H, Aib, aMeK and R; X17 is an amino acid conjugated to a C16-C22 fatty acid, wherein said fatty acid is optionally conjugated to said amino acid via a linker; X19 is Q; X20 is selected from the group consisting of Aib, Q, H and K; X21 is selected from the group consisting of H, D, T, A and E; X22 is F; X23 is I; X24 is selected from the group consisting of D-Glu and E; X26 is L; X27 is I; X28 is selected from the group consisting of E, A, S and D-Glu; X29 is selected from the group consisting of Aib, G and A; X30 is selected from the group consisting of C, G and G-R2;X31 is either absent or selected from the group consisting of PX32X33X34-R2 (SEQ ID NO:4), PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5), and PX32X33X34X35X36X37X38X39X40-R2 (SEQ ID NO:6); wherein: X32 is S; X33 is S; X34 is selected from the group consisting of G and C; X35 is A; X36 is P; X37 is P; X38 is P; X39 is selected from the group consisting of C and S; and X40 is C.; 57. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 56, wherein X17 is K(2-[2-(2-aminoethoxy)ethoxy]acetyl)2-(Y-Glu)-CO-(CH2)q-CO2H. FR / nnn / Lznz / e / YiAi X21852 -174- 58. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 57, wherein PX32X33X34X35X36X37X38X39-R2 is selected from the group consisting of PSSGAPPPS (SEQ ID NQ:301) and PSSGAPPPSNH2 (SEQ ID NQ:302).

59. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 58, wherein X28 is A; X29 is G; X30 is G; X31 is PX32X33X34X35X36X37X38X39-R2 (SEQ ID NO:5) X34 is G; and X39 is S.

60. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 59, wherein Xi is selected from the group consisting of Y and D-Tyr; and X13 is aMeL.

61. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 60, wherein q is 16.

62. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 55 to 60, wherein q is 18.

63. A compound, or a pharmaceutically acceptable derivative thereof, according to claim 1, wherein the compound is selected from the group consisting of SEQ ID NO:303, SEQ ID NO:304, SEQ ID NO:305, SEQ ID NO:3()6, SEQ ID NO:307, SEQ ID NO:308 and SEQ ID NO:

392.

64. A compound, or a pharmaceutically acceptable salt thereof, according to claim 63, wherein the compound is SEQ ID NO:

305.

65. A compound, or a pharmaceutically acceptable salt thereof, according to claim 63, wherein the compound is SEQ ID NO:

307.

66. A compound, or a pharmaceutically acceptable salt thereof, according to claim 63, wherein the compound is SEQ ID NO:

308.

67. A compound, or a pharmaceutically acceptable salt thereof, according to claim 63, wherein the compound is SEQ ID NO:

392. X21852 FR / nnn / Lznz / e / YiAi -175- 68. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 67, wherein the compound is a partial agonist on the GLP-1R.

69. A compound, or a pharmaceutically acceptable salt thereof, according to claim 68, wherein the compound stimulates GLP-1R-induced activation of Gas in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay in the HEK293 cell membrane with GLP-1R and GIPR.

70. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claim 68 or 69, wherein the compound is a partial agonist on the GLP-1R with respect to the P-arrestin-2 recruitment assay.

71. A method for treating a selected condition from the group consisting of type 2 diabetes mellitus, obesity, NAFLD, non-alcoholic steatohepatitis, dyslipidemia, and metabolic syndrome, comprising administering to a patient in need an effective amount of a compound or a pharmaceutically acceptable product thereof, in accordance with any one of claims 1 to 70.

72. A method for the treatment of obesity, comprising administering to a patient in need, an effective amount of a compound, or a pharmaceutically acceptable salt thereof, in accordance with any one of claims 1 to 70.

73. A method for providing therapeutic weight loss, comprising administering to a subject in need, an effective amount of a compound, or a pharmaceutically acceptable salt thereof, in accordance with any one of claims 1 to 70.

74. A method for the treatment of type 2 diabetes mellitus comprising administering to a subject in need, an effective amount of the compound, or a pharmaceutically acceptable salt thereof, in accordance with any one of claims 1 to 70.

75. A pharmaceutical composition comprising the compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70 and at least one pharmaceutically acceptable carrier, diluent or excipient.

76. A pharmaceutical composition according to claim 75, wherein the composition is administered as a subcutaneous injection. FR / nnn / Lznz / e / YiAi Χ21852 -176- 77. A pharmaceutical composition according to claim 75, wherein the composition is administered orally.

78. A pharmaceutical composition according to claim 77, wherein the composition comprises a permeation enhancer and at least one pharmaceutically acceptable carrier, diluent or excipient.

79. A pharmaceutical composition according to claim 78, wherein the permeation enhancer is selected from the group consisting of sodium decanoate (CIO), sodium taurodeoxylate (NaTDC), lauroylcamtin (LC), dodecyl maltoside (“C12” maltoside), dodecylphosphatidylcholine (“DPC”), sodium taurodeoxylate (“NaTDC”) and a rhamnolipid.

80. A pharmaceutical composition according to claim 79, wherein the permeation enhancer is selected from the group consisting of CIO and LC.

81. A pharmaceutical composition according to claim 80, wherein the permeation enhancer is CIO.

82. A pharmaceutical composition according to any one of claims 77 to 81, wherein the composition comprises a permeation enhancer and a protease inhibitor, and at least one pharmaceutically acceptable carrier, diluent or excipient.

83. A pharmaceutical composition according to claim 82, wherein the protease inhibitor is selected from the group consisting of soybean trypsin inhibitor (SBTI), soybean trypsin-chymotrypsin inhibitor (SBTCI), sunflower trypsin inhibitor (SFTI), leupeptin, citric acid, ethylenediaminetetraacetic acid (“EDTA”), sodium glycocholate, and benzenesulfonyl fluoride 4-(2-aminoethyl)chloride hydrochloride (“AEBSF”).

84. A pharmaceutical composition according to claim 83, wherein the protease inhibitor is selected from the group consisting of SBTI, SBTICI and SFTI.

85. A pharmaceutical composition according to claim 84, wherein the protease inhibitor is SBTI.

86. A pharmaceutical composition according to any one of claims 77 to 85, wherein the composition is a monolithic formulation.

87. A pharmaceutical composition according to any one of claims 77 to 85, wherein the composition is a multiparticle formulation. X21852 -177FR / nnn / Lznz / e / YiAi 88. A pharmaceutical composition according to any one of claims 77 to 85, wherein the composition is a capsule or tablet.

89. A pharmaceutical composition according to claim 86, wherein the composition is a tablet or an enteric capsule.

90. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70, for use as a medicament.

91. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70, for use in the treatment of a selected disease from the group consisting of type 2 diabetes mellitus, obesity, NAFLD, NASH, dyslipidemia, and metabolic syndrome.

92. A compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70, for use in the treatment of type 2 diabetes mellitus.

93. The use of a compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70, in the manufacture of a medicament for the treatment of a selected condition from the group consisting of type 2 diabetes mellitus, obesity, NAFLD, NASH, dyslipidemia, and metabolic syndrome.

94. The use of a compound, or a pharmaceutically acceptable salt thereof, according to any one of claims 1 to 70, in the manufacture of a medicament for the treatment of type 2 diabetes mellitus.

95. A method for the treatment of diabetes comprising administering an effective amount of a compound that exhibits partial agonism of 75% or less in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the membrane of HEK293 cells with GLP-1R, and an effective amount of a compound that is a GIP agonist.

96. A method according to claim 95, wherein diabetes is type 9 diabetes.

97. A method according to any one of claim 95 or 96, wherein a compound exhibiting partial agonism in the guanosine 5'-(gammatio)triphosphate-[j5S] (GTPyS) binding assay on the membrane of HEK293 cells with GLP-1R is co-administered with a compound having GIP agonist activity.

98. A method according to any one of claims 95 to 97, wherein a compound exhibiting partial agonism in the guanosine 5'-(gamma- pR / nnn / Lznz / e / Yi / u X21852 -178thio)triphosphate-[35S] (GTPyS) binding assay on the membrane of HEK293 cells with GLP-1R is co-administered with a compound exhibiting 35% or less in the CHO cell GLP β-Arrestin recruitment assay.

99. A method according to any one of claims 95 to 98, wherein a compound exhibiting partial agonism in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the membrane of HEK293 cells with GLP-1R is administered as an active agent within one week before or after a compound having GIP agonist activity.

100. A method according to any one of claims 95 to 98, wherein 10 a compound exhibiting partial agonism in the guanosine 5'-(gamma-thio)triphosphate-[35S] (GTPyS) binding assay on the membrane of HEK293 cells with GLP-1R is administered as an active agent within one week before or after a compound having GIP agonism and exhibiting 35% or less in the CHO cell GLP β-Arrcstin recruitment assay.