Actrii proteins and use in treating post-capillary pulmonary hypertension
Patent Information
- Application Number
- MYPI2022006009
- Authority / Receiving Office
- MY · MY
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2021-03-10
- Filing Date
- 2021-04-27
- Publication Date
- 2026-08-18
- Estimated Expiration
- 2041-04-27
AI Technical Summary
There is a high unmet need for effective therapies to treat post-capillary pulmonary hypertension (PcPH), particularly for reducing its progression rate and severity, as current treatments are inadequate for WHO Group 2 and Group 5 PH, which are common causes of pulmonary hypertension and result in severe symptoms and adverse outcomes.
Administering a polypeptide with an amino acid sequence that is at least 70-100% identical to specific sequences of ActRII proteins, which can treat, prevent, or reduce the progression of PcPH by targeting smooth muscle and endothelial cell proliferation, angiogenesis, and other complications, thereby reducing mean pulmonary arterial pressure, pulmonary vascular resistance, and other hemodynamic parameters.
The method effectively reduces mean pulmonary arterial pressure, pulmonary vascular resistance, and other associated complications, improving cardiac and pulmonary function, and reducing fibrosis and hypertrophy, thereby improving the clinical outcomes for patients with post-capillary pulmonary hypertension.
Abstract
Description
[0001] ACTRII PROTEINS AND USE IN TREATING POST-CAPILLARY PULMONARY
[0002] HYPERTENSION
[0003] CROSS-REFERENCE TO RELATED APPLICATIONS
[0004] This application claims the benefit of priority from U.S. Provisional Application No. 63 / 016,942, filed on April 28, 2020 and from U.S. Provisional Application No. 63 / 159,253, filed on March 10, 2021. The foregoing applications are incorporated herein by reference.
[0005] BACKGROUND OF THE INVENTION
[0006] Pulmonary hypertension (PH) is a disease characterized by high blood pressure in lung vasculature, including pulmonary arteries, pulmonary veins, and pulmonary capillaries. In general, PH is defined as a mean pulmonary arterial pressure (mPAP) ³ 20 mm Hg at rest or ³30 mmHg with exercise [Hill et al., Respiratory Care 54(7):958-68 (2009)]. One of the main PH symptoms is difficulty in breathing or shortness of breath, and other symptoms include fatigue, dizziness, fainting, peripheral edema (swelling in foot, legs or ankles), bluish lips and skin, chest pain, angina pectoris, light-headedness during exercise, non-productive cough, racing pulse and palpitations. PH can be a severe disease causing heart failure, which is one of the most common causes of death in people who have pulmonary hypertension. Postoperative pulmonary hypertension may complicate many types of surgeries or procedures, and present a challenge associated with a high mortality.
[0007] PH may be grouped based on different manifestations of the disease sharing similarities in pathophysiologic mechanisms, clinical presentation, and therapeutic approaches [Simonneau et al., JACC 54(l):S44-54 (2009)]. Clinical classification of PH was first proposed in 1973, and a recent updated clinical classification was endorsed by the World Health Organization (WHO) in 2018. According to the updated PH clinical classification, there are five main groups of PH: pulmonary arterial hypertension (PAH), characterized by a pulmonary arterial wedge pressure (PAWP) £15 mm Hg; PH due to left heart disease (also known as pulmonary venous hypertension or congestive heart failure), characterized by a PAWP >15 mm Hg; PH due to lung diseases and / or hypoxia; PH due to pulmonary artery obstructions; and PH with unclear and / or multifactorial mechanisms [Simonneau (2019) Eur Respir J: 53: 1801913] PH due to left heart disease is further classified into PH due to heart failure with preserved left ventricular ejection fraction; PH due to heart failure with reduced left ventricular ejection fraction; valvular heart disease; and congenital / acquired cardiovascular conditions leading to post-capillary PH [Simonneau (2019) Eur Respir J: 53:1801913] Diagnosis of various types of PH typically requires a series of tests.
[0008] In general, PH treatment depends on the cause or classification of PH. Where PH is caused by a known medicine or medical condition, it is known as a secondary PH, and its treatment is usually directed at the underlying disease. Treatment of Group 2 pulmonary hypertension (e.g., venous hypertension) generally involves optimizing left ventricular function by administering diuretics, beta blockers, angiotensin receptor-neprilysin inhibitors (ARNI), and ACE inhibitors, cardiac resynchronization therapy, or repairing or replacing a mitral valve or aortic valve.
[0009] There is a high, unmet need for effective therapies for treating pulmonary hypertension. Accordingly, it is an object of the present disclosure to provide methods for treating, preventing, or reducing the progression rate and / or severity of PH, particularly treating, preventing or reducing the progression rate and / or severity of one or more PH-associated complications.
[0010] SUMMARY OF THE INVENTION
[0011] In some embodiments, the disclosure provides for a method of treating post-capillary pulmonary hypertension (PcPH), comprising administering to a patient in need thereof an effective amount of a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO: 1. In some embodiments, the disclosure provides for a method of treating, preventing, or reducing the progression rate and / or severity of one or more complications of post-capillary pulmonary hypertension (e.g., WHO Group 2 and / or Group 5 PH), comprising administering to a patient in need thereof an effective amount of a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO: 1. In some embodiments, the one or more complications of post- capillary pulmonary hypertension is selected from the group consisting of: smooth muscle and / or endothelial cell proliferation in the pulmonary artery, angiogenesis in the pulmonary artery, dyspnea, chest pain, pulmonary vascular remodeling, right ventricular hypertrophy, left ventricular hypertrophy, left atrium dilation, left ventricular fibrosis, right ventricular fibrosis, and pulmonary fibrosis. In some embodiments, the PcPH is isolated post-capillary pulmonary hypertension (IpcPH). In some embodiments, the PcPH is combined post- and pre-capillary PH (CpcPH).
[0012] In some embodiments, the patient has Group 2 pulmonary hypertension as recognized by the World Health Organization (WHO). In some embodiments, the patient has pulmonary hypertension due to heart failure with preserved left ventricular ejection fraction (LVEF). In some embodiments, the patient has pulmonary hypertension due to heart failure with reduced left ventricular ejection fraction (LVEF). In some embodiments, the patient has valvular heart disease. In some embodiments, the patient has congenital / acquired cardiovascular conditions leading to post-capillary PH. In some embodiments, the patient has Group 5 pulmonary hypertension as recognized by the WHO. In some embodiments, the patient has pulmonary hypertension with unclear and / or multifactorial mechanisms. In some embodiments, the valvular heart disease is aortic regurgitation. In some embodiments, the valvular heart disease is aortic stenosis. In some embodiments, the valvular heart disease is mitral valve regurgitation. In some embodiments, the valvular heart disease is mitral valve stenosis.
[0013] In some embodiments, the patient has a mean pulmonary arterial pressure (mPAP) selected from the group consisting of an mPAP of at least 20 mmHg; an mPAP of at least 25 mmHg; an mPAP of at least 30 mmHg; an mPAP of at least 35 mmHg; an mPAP of at least 40 mmHg; an mPAP of at least 45 mmHg; and an mPAP of at least 50 mmHg. In some embodiments, the method reduces mPAP in the patient. In some embodiments, the method reduces the mPAP in the patient by at least 10% (e.g. , 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method reduces the mPAP by at least 3 mmHg (e.g., at least 3, 5, 7, 10, 12, 15, 20, or 25 mm Hg) in the patient.
[0014] In some embodiments, the patient has a pulmonary arterial wedge pressure (PAWP) of greater than 15 mmHg. In some embodiments, the method decreases the PAWP in the patient. In some embodiments, the method reduces the PAWP in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the patient has a left ventricular end diastolic pressure (LVEDP) of greater than 15 mmHg. In some embodiments, the method decreases the LVEDP in the patient. In some embodiments, the method reduces the LVEDP in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%). In some embodiments, the patient has a diastolic pressure gradient (DPG) of less than 7 mmHg. In some embodiments, the patient has a DPG of at least 7 mmHg. In some embodiments, the method decreases the DPG in the patient. In some embodiments, the method reduces the DPG in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the patient has a transpulmonary pressure gradient (TPG) of less than or equal to 12 mm Hg. In some embodiments, the patient has a TPG of greater than 12 mm Hg. In some embodiments, the method decreases the TPG in the patient. In some embodiments, the method reduces the TPG in the patient by at least 10% (e.g. , 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the patient has a pulmonary vascular resistance (PVR) greater than or equal to 3 Wood Units. In some embodiments, the method decreases the PVR in the patient. In some embodiments, the method reduces the PVR in the patient by at least 10% (e.g. , 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%).
[0015] In some embodiments, the method prevents the progression of IpcPH to CpcPH. In some embodiments, the method reduces the development of a pre-capillary component of PH. In some embodiments, the patient has preserved left ventricular ejection fraction. In some embodiments, the preserved left ventricular ejection fraction is greater than 45%. In some embodiments, the patient has reduced left ventricular ejection fraction. In some embodiments, the reduced left ventricular fraction is less than 45%. In some embodiments, the preserved left ventricular fraction is measured using echocardiography. In some embodiments, the patient has diastolic dysfunction of the left ventricle. In some embodiments, the patient has systolic dysfunction of the left ventricle. In some embodiments, the method decreases right ventricular hypertrophy in the patient. In some embodiments, the method decreases right ventricular hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method decreases left ventricular hypertrophy in the patient. In some embodiments, the method decreases left ventricular hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method decreases smooth muscle hypertrophy in the patient. In some embodiments, the method decreases smooth muscle hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method decreases pulmonary arteriole muscularity in the patient. In some embodiments, the method decreases pulmonary arteriole muscularity in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%).
[0016] In some embodiments, the patient has a right ventricular systolic pressure (RVSP) of greater than 35 mmHg. In some embodiments, the method decreases the RVSP in the patient. In some embodiments, the method reduces the RVSP in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%). In some embodiments, the patient has left ventricular fibrosis. In some embodiments, the method decreases the left ventricular fibrosis in the patient. In some embodiments, the method reduces the left ventricular fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%). In some embodiments, the patient has right ventricular fibrosis. In some embodiments, the method decreases the right ventricular fibrosis in the patient. In some embodiments, the method reduces the right ventricular fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%). In some embodiments, the patient has pulmonary fibrosis. In some embodiments, the method decreases the pulmonary fibrosis in the patient. In some embodiments, the method reduces the pulmonary fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
[0017] In some embodiments, the patient has a comorbidity selected from the group consisting of systemic hypertension, diabetes mellitus, obesity, coronary artery disease (CAD), heart failure, and anemia. In some embodiments, the method further comprises administering to the patient an additional active agent and / or supportive therapy. In some embodiments, the additional active agent and / or supportive therapy is selected from the group consisting of: beta- blockers, angiotensin-converting enzyme inhibitors (ACE inhibitors), angiotensin receptor blockers (ARBs), neprilysin inhibitors, angiotensin receptor-neprilysin inhibitors (ARNI), mineralocorticoid receptor antagonists (MRA), hyperpolarization-activated cyclic nucleotide gated (HCN) channel blockers, diuretic agents, lipid-lowering medications, endothelin blockers, PDE5 inhibitors, prostacyclins, cardiac resynchronization therapy, valve replacement, valve repair, implantable cardioverter-defibrillator (ICD), or a left ventricular assist device (LVAD). In some embodiments, the additional active agent and / or supportive therapy is selected from the group consisting of: prostacyclin and derivatives thereof (e.g., epoprostenol, treprostinil, and iloprost); prostacyclin receptor agonists (e.g., selexipag); endothelin receptor antagonists (e.g., thelin, ambrisentan, macitentan, and bosentan); calcium channel blockers (e.g., amlodipine, diltiazem, and nifedipine; anticoagulants (e.g., warfarin); diuretics; oxygen therapy; atrial septostomy; pulmonary thromboendarterectomy; phosphodiesterase type 5 inhibitors (e.g., sildenafd and tadalafil); activators of soluble guanylate cyclase (e.g., cinaciguat and riociguat); ASK-1 inhibitors (e.g., CIIA; SCH79797; GS-4997; MSC2032964A; 3H-naphtho[l,2,3-de]quiniline-2,7-diones, NQDI-1; 2-thioxo- thiazolidines, 5-bromo-3-(4-oxo-2-thioxo-thiazolidine-5-ylidene)-l,3-dihydro-indol-2-one); NF-KB antagonists (e.g., dh404, CDDO-epoxide; 2.2-difluoropropionamide; C28 imidazole (CDDO-Im); 2-cyano-3,12-dioxoolean-l,9-dien-28-oic acid (CDDO); 3-Acetyloleanolic Acid; 3-Triflouroacetyloleanolic Acid; 28-Methyl-3-acetyloleanane; 28-Methyl-3- trifluoroacetyloleanane; 28-Methyloxyoleanolic Acid; SZC014; SCZ015; SZC017; PEGylated derivatives of oleanolic acid; 3-0-(beta-D-glucopyranosyl) oleanolic acid; 3-0-[beta-D- glucopyranosyl-(l— >3)-beta-D-glucopyranosyl] oleanolic acid; 3-0-[beta-D-glucopyranosyl- (1— >2)-beta-D-glucopyranosyl] oleanolic acid; 3-0-[beta-D-glucopyranosyl-(l— >3)-beta-D- glucopyranosyl] oleanolic acid 28-O-beta-D-glucopyranosyl ester; 3-0-[beta-D- glucopyranosyl-(l— >2)-beta-D-glucopyranosyl] oleanolic acid 28-O-beta-D-glucopyranosyl ester; 3-0-[a-L-rhamnopyranosyl-(l— >3)-beta-D-glucuronopyranosyl] oleanolic acid; 3-0- [alpha-L-rhamnopyranosyl-(l— >3)-beta-D-glucuronopyranosyl] oleanolic acid 28-O-beta-D- glucopyranosyl ester; 28-O -D-glucopyranosyl-oleanolic acid; 3-0- -D-glucopyranosyl (l 3)- -D-glucopyranosiduronic acid (CS1); oleanolic acid 3-O -D-glucopyranosyl (1 3)- b-D-glucopyranosiduronic acid (CS2); methyl 3,ll-dioxoolean-12-en-28-olate (DIOXOL); ZCVI4-2; Benzyl 3-dehydr-oxy-l,2,5-oxadiazolo[3',4':2,3]oleanolate); eplerenone, spironolactone, ivabradine, implantable cardioverter-defibrillator (ICD), a left ventricular assist device (LVAD), or lung and / or heart transplantation.
[0018] In some embodiments, the patient has elevated brain natriuretic peptide (BNP) levels as compared to a healthy patient. In some embodiments, the patient has a BNP level of at least 100 pg / mL (e.g., 100, 150, 200, 300, 400, 500, 1000, 3000, 5000, 10,000, 15,000, or 20,000 pg / mL). In some embodiments, the method decreases BNP levels in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method decreases BNP levels to normal levels (i.e., <100 pg / ml). In some embodiments, the method decreases NT-proBNP levels in the patient. In some embodiments, the method decreases NT-proBNP levels in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%). In some embodiments, the method decreases NT-proBNP levels in the patient by at least 30%. In some embodiments, the method decreases NT-proBNP levels to normal levels. In some embodiments, the normal level of NT-proBNP is <100 pg / ml. In some embodiments, the method increases exercise capacity of the patient. In some embodiments, the patient has a 6-minute walk distance from 150 to 400 meters. In some embodiments, the patient has a 6- minute walk distance from 150 to 550 meters. In some embodiments, the method increases the patient’s 6-minute walk distance. In some embodiments, the method increases the patient’s 6- minute walk distance by at least 10 meters (e.g., at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, or more than 400 meters). In some embodiments, the method reduces the patient’s Borg dyspnea index (BDI). In some embodiments, the method reduces the patient’s BDI by at least 0.5 index points (e.g., at least 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 index points).
[0019] In some embodiments, the patient has decreased renal function. In some embodiments, the method further improves renal function. In some embodiments, the patient has Functional Class II or Class III pulmonary hypertension in accordance with the World Health Organization’s functional classification system for pulmonary hypertension. In some embodiments, the patient has Functional Class I, Class II, Class III, or Class IV pulmonary hypertension as recognized by the World Health Organization. In some embodiments, the method prevents or delays pulmonary hypertension Functional Class progression (e.g., prevents or delays progression from Functional Class I to Class II, Class II to Class III, or Class III to Class IV pulmonary hypertension as recognized by the World Health Organization). In some embodiments, the method promotes or increases pulmonary hypertension Functional Class regression (e.g., promotes or increases regression from Class IV to Class III, Class III to Class II, or Class II to Class I pulmonary hypertension as recognized by the World Health Organization). In some embodiments, the patient has Functional Class II or Class III pulmonary hypertension in accordance with the New York Heart Association’s functional classification system for pulmonary hypertension. In some embodiments, the patient has Functional Class I, Class II, Class III, or Class IV pulmonary hypertension as recognized by the New York Heart Association. In some embodiments, the method prevents or delays pulmonary hypertension Functional Class progression (e.g., prevents or delays progression from Functional Class I to Class II, Class II to Class III, or Class III to Class IV pulmonary hypertension as recognized by the New York Heart Association). In some embodiments, the method promotes or increases pulmonary hypertension Functional Class regression (e.g., promotes or increases regression from Class IV to Class III, Class III to Class II, or Class II to Class I pulmonary hypertension as recognized by the New York Heart Association). In some embodiments, the method delays clinical worsening of PcPH. In some embodiments, the method delays clinical worsening of PcPH in accordance with the World Health Organization’s functional classification system for pulmonary hypertension. In some embodiments, the method delays clinical worsening of PcPH in accordance with the New York Heart Association’s functional classification system for pulmonary hypertension. In some embodiments, the method reduces the risk of hospitalization for one or more complications associated with PcPH. In some embodiments, the patient has a hemoglobin level from >8 and <15 g / dl.
[0020] In some embodiments, the patient has been treated with one or more vasodilators. In some embodiments, the patient has been treated with one or more agents selected from the group consisting of: phosphodiesterase type 5 inhibitors, soluble guanylate cyclase stimulators, prostacyclin receptor agonist, and endothelin receptor antagonists. In some embodiments, the one or more agents is selected from the group consisting of: bosentan, sildenafil, beraprost, macitentan, selexipag, epoprostenol, treprostinil, iloprost, ambrisentan, and tadalafil. In some embodiments, the method further comprises administration of one or more vasodilators. In some embodiments, the method further comprises administration of one or more agents selected from the group consisting of: phosphodiesterase type 5 inhibitors, soluble guanylate cyclase stimulators, prostacyclin receptor agonist, and endothelin receptor antagonists. In some embodiments, the one or more agents is selected from the group consisting of: bosentan, sildenafil, beraprost, macitentan, selexipag, epoprostenol, treprostinil, iloprost, ambrisentan, and tadalafil.
[0021] In some embodiments, the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence SEQ ID NO: 2. In some embodiments, the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3. In some embodiments, the ActRII polypeptide is a fusion protein further comprising an Fc domain of an immunoglobulin. In some embodiments, the Fc domain of the immunoglobulin is an Fc domain of an IgGl immunoglobulin. In some embodiments, the Fc fusion protein further comprises a linker domain positioned between the ActRII polypeptide domain and the Fc domain of the immunoglobulin. In some embodiments, the linker domain is selected from the group consisting of: TGGG (SEQ ID NO: 20), TGGGG (SEQ ID NO: 18), SGGGG (SEQ ID NO: 22), GGGGS (SEQ ID NO: 22), GGG (SEQ ID NO: 16), GGGG (SEQ ID NO: 17), and SGGG (SEQ ID NO: 21). In some embodiments, the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23. In some embodiments, the polypeptide comprises an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30- 110 of SEQ ID NO: 1, wherein the polypeptide binds to activing and / or GDF11. In some embodiments, the polypeptide comprises an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1, wherein the polypeptide binds to activing and / or GDF11. In some embodiments, the polypeptide is lyophilized. In some embodiments, the polypeptide is soluble. In some embodiments, the polypeptide is administered using subcutaneous injection. In some embodiments, the polypeptide is administered every 4 weeks. In some embodiments, the polypeptide is part of a homodimer protein complex. In some embodiments, the polypeptide is glycosylated. In some embodiments, the polypeptide has a glycosylation pattern obtainable by expression in a Chinese hamster ovary cell. In some embodiments, the ActRII polypeptide binds to one or more ligands selected from the group consisting of: activin A, activin B, and GDF11. In some embodiments, the ActRII polypeptide further binds to one or more ligands selected from the group consisting of: BMP 10, GDF8, and BMP6.
[0022] In certain aspects, the disclosure relates to a kit comprising a lyophilized polypeptide and an injection device, wherein the polypeptide is an ActRII polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide consisting of the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
[0023] In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide consisting of the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 2. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 2. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO: 2. In some embodiments, the polypeptide is a polypeptide comprising the amino acid sequence of SEQ ID NO: 2. In some embodiments, the polypeptide is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 2. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 3. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 3. In some embodiments, the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO: 3. In some embodiments, the polypeptide is a polypeptide comprising the amino acid sequence of SEQ ID NO: 3. In some embodiments, the polypeptide is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 3.
[0024] In some embodiments, the polypeptide is a fusion protein further comprising an Fc domain of an immunoglobulin. In some embodiments, the immunoglobulin is an Fc domain of an IgGl immunoglobulin. In some embodiments, the fusion protein further comprises a linker domain positioned between the polypeptide domain and the Fc domain of the immunoglobulin. In some embodiments, the linker domain is selected from the group consisting of: TGGG (SEQ ID NO: 20), TGGGG (SEQ ID NO: 18), SGGGG (SEQ ID NO:
[0025] 19), GGGGS (SEQ ID NO: 22), GGG (SEQ ID NO: 16), GGGG (SEQ ID NO: 17), and SGGG (SEQ ID NO: 21). In some embodiments, the linker domain comprises TGGG (SEQ ID NO:
[0026] 20). In some embodiments, the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23. In some embodiments, the ActRII polypeptide comprises the amino acid sequence of SEQ ID NO: 23. In some embodiments, the ActRII polypeptide consists of the amino acid sequence of SEQ ID NO: 23. In some embodiments, the polypeptide is part of a homodimer protein complex. In some embodiments, the polypeptide is glycosylated. In some embodiments, the polypeptide binds to one or more ligands selected from the group consisting of: activin A, activin B, and GDF 11. In some embodiments, the polypeptide further binds to one or more ligands selected from the group consisting of: BMP10, GDF8, and BMP6. In some embodiments, the polypeptide binds to activin and / or GDF11.
[0027] In some embodiments, the kit comprises one or more vials containing the lyophilized polypeptide. In some embodiments, the injection device comprises a pre-fdled syringe. In some embodiments, the injection device comprises a pump apparatus. In some embodiments, the pump apparatus comprises an electromechanical pumping assembly. In some embodiments, the pump apparatus is a wearable pump apparatus. In some embodiments, the pre-fdled syringe comprises a reconstitution solution. In some embodiments, the reconstitution solution comprises a pharmaceutically acceptable carrier and / or excipient. In some embodiments, the pharmaceutically acceptable carrier is selected from saline solution, purified water, or sterile water for injection. In some embodiments, the pharmaceutically acceptable excipient is selected from a buffering agent [e.g., citric acid (monohydrate) and / or trisodium citrate (dehydrate)], a surfactant (e.g., polysorbate 80), a stabilizer (e.g., sucrose), and a lyoprotectant (e.g., sucrose). In some embodiments, the injection device comprises a vial adapter. In some embodiments, the vial adapter is capable of attaching to a vial. In some embodiments, the vial adapter is capable of attaching to a pre-fdled syringe. In some embodiments, the pre-fdled syringe and the vial are attached to opposite ends of the vial adapter. In some embodiments, the reconstitution solution is transferred from the pre-fdled syringe to the vial. In some embodiments, the lyophilized polypeptide is reconstituted into a sterile injectable solution. In some embodiments, the lyophilized polypeptide is reconstituted into a sterile injectable solution prior to use. In some embodiments, the sterile injectable solution is sterile water for injection.
[0028] In some embodiments, the sterile injectable solution is administered parenterally. In some embodiments, the injection device is used to administer the sterile injectable solution parenterally. In some embodiments, the sterile injectable solution is administered via subcutaneous injection. In some embodiments, the sterile injectable solution is administered via intradermal injection. In some embodiments, the sterile injectable solution is administered via intramuscular injection. In some embodiments, the sterile injectable solution is administered via intravenous injection. In some embodiments, the sterile injectable solution is self-administered. In some embodiments, the sterile injectable solution comprises a therapeutically effective dose. In some embodiments, the therapeutically effective dose comprises a weight based dose. In some embodiments, the lyophilized polypeptide is administered every 4 weeks.
[0029] In some embodiments, the kit is used to treat post-capillary pulmonary hypertension (PcPH). In some embodiments, the PcPH is isolated post-capillary pulmonary hypertension (IpcPH). In some embodiments, the PcPH is combined post- and pre-capillary PH (CpcPH). In some embodiments, the patient has Group 2 pulmonary hypertension as recognized by the WHO. In some embodiments, the patient has pulmonary hypertension due to heart failure with preserved left ventricular ejection fraction (LVEF). In some embodiments, the patient has pulmonary hypertension due to heart failure with reduced left ventricular ejection fraction (LVEF). In some embodiments, the patient has valvular heart disease. In some embodiments, the patient has congenital / acquired cardiovascular conditions leading to post-capillary PH. In some embodiments, the patient has Group 5 pulmonary hypertension as recognized by the WHO. In some embodiments, the patient has pulmonary hypertension with unclear and / or multifactorial mechanisms. In some embodiments, the shelf life of the lyophilized polypeptide is at least 1, 1.5, 2, 2.5, or 3 years. In some embodiments, the lyophilized polypeptide is reconstituted. In some embodiments, the reconstituted polypeptide has a shelf life of at least 2 hrs, 3 hrs, or 4 hrs.
[0030] BRIEF DESCRIPTION OF THE DRAWINGS
[0031] The file of this patent contains at least one drawing / photograph executed in color. Copies of this patent with color drawing(s) / photograph(s) will be provided by the Office upon request and payment of the necessary fee.
[0032] Figure 1 shows an alignment of extracellular domains of human ActRIIB (SEQ ID NO: 31) and human ActRIIA (SEQ ID NO: 2) with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures, to directly contact ligand indicated with boxes.
[0033] Figure 2 shows a multiple sequence alignment of various vertebrate ActRIIA proteins and human ActRIIA (SEQ ID NOs: 6-10 and 36-38).
[0034] Figure 3 shows multiple sequence alignment of Fc domains from human IgG isotypes using Clustal 2.1. Hinge regions are indicated by dotted underline. Double underline indicates examples of positions engineered in IgGl Fc (SEQ ID NO: 32) to promote asymmetric chain pairing and the corresponding positions with respect to other isotypes IgG2 (SEQ ID NO: 33), IgG3 (SEQ ID NO: 34) and IgG4 (SEQ ID NO: 35).
[0035] Figures 4A and 4B show the purification of ActRIIA-hFc expressed in CHO cells. The protein purifies as a single, well-defined peak as visualized by sizing column (Figure 4A) and Coomassie stained SDS-PAGE (Figure 4B) (left lane: molecular weight standards; right lane: ActRIIA-hFc).
[0036] Figures 5A and 5B show the binding of ActRIIA-hFc to activin (Figure 5A) and GDF- 11 (Figure 5B), as measured by Biacore™ assay.
[0037] Figure 6 shows a schematic image of a linearized version of cardiopulmonary circulation and the regions associated with various types of PH. The difference between pre capillary pulmonary hypertension, isolated post-capillary pulmonary hypertension, and combined post- and pre-capillary pulmonary hypertension are based on pulmonary hemodynamic parameters and the involvement of various regions of the cardiopulmonary system (pre and / or post capillary regions). Abbreviations are as follows: VC - vena cava; RA - right atrium; RV - right ventricle; PA - pulmonary artery; PC - pulmonary capillaries; PV - pulmonary ventricles; LA - left atrium; LV - left ventricle; AO -Aorta. See, e.g., Aras MA, et al. Curr Cardiol Rep. 2019;21(7):62 and Galie N. et al. Eur Heart J. 2018;39(15): 1265-1268.
[0038] Figure 7 shows a schematic image of a linearized version of cardiopulmonary circulation and the hemodynamic parameters associated with pre-capillary PH. Abbreviations are as follows: VC - vena cava; RA - right atrium; RV - right ventricle; PA - pulmonary artery; PC - pulmonary capillaries; PV - pulmonary ventricles; LA - left atrium; LV - left ventricle; AO -Aorta; mPAP - mean pulmonary arterial pressure; PAWP - pulmonary arterial wedge pressure; PVR - pulmonary vascular resistance. Id.
[0039] Figure 8 shows a schematic image of a linearized version of cardiopulmonary circulation and the hemodynamic parameters associated with isolated post-capillary PH (IpcPH). Abbreviations are as follows: VC - vena cava; RA - right atrium; RV - right ventricle; PA - pulmonary artery; PC - pulmonary capillaries; PV - pulmonary ventricles; LA - left atrium; LV - left ventricle; AO -Aorta; mPAP - mean pulmonary arterial pressure; PAWP - pulmonary arterial wedge pressure; PVR - pulmonary vascular resistance. Id.
[0040] Figure 9 shows a schematic image of a linearized version of cardiopulmonary circulation and the hemodynamic parameters associated with combined post- and pre-capillary PH (CpcPH). Abbreviations are as follows: VC - vena cava; RA - right atrium; RV - right ventricle; PA - pulmonary artery; PC - pulmonary capillaries; PV - pulmonary ventricles; LA - left atrium; LV - left ventricle; AO -Aorta; mPAP - mean pulmonary arterial pressure; PAWP - pulmonary arterial wedge pressure; PVR - pulmonary vascular resistance. Id.
[0041] Figures 10-14 shows the therapeutic effect of ActRIIA-mFc in a TAC-PH model based on endpoints for left ventricle function. Twenty-six C57 / B6 male mice (lOwks old) underwent TAC pulmonary hypertension surgery (TAC-PH) and ten age-matched animals underwent a mock surgical procedure (Sham) at day 0. Two weeks after the surgery, TAC-PH mice were randomized into two groups i) fourteen mice were injected subcutaneously with vehicle control (phosphate buffered saline (PBS)), twice weekly for 4 weeks starting from day 14 after surgery, “TAC-PH / PBS”; and a ii) twelve mice were injected subcutaneously with ActRIIA- mFc at a dose of lOmg / kg twice weekly for 4 weeks starting from day 14 after TAC surgery, “TAC-PH / ActRIIA-mFc”. Figures 10-14 show endpoints for left ventricle function, including changes in cardiac hypertrophy heart weight / body weight (HW / BW) (Figure 10), LV function parameters fractional shorting (Figure 11) and LV ejection fraction (Figure 12); and LV diastolic function parameters E / E’ [Ratio of mitrial inflow velocity (E) to mitrial annular velocity (E’)] (Figure 13) and isovolumetric relaxation time (IVRT) (Figure 14). Relative to “TAC-PH / PBS” treated mice, “TAC-PH / ActRIIA-mFc” treated mice demonstrated a significant effect of ActRIIA-mFc in reducing cardiac hypertrophy and improving cardiac function. Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “Sham” and sample “TAC-PH / PBS”. Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC-PH / ActRIIA-mFc”. Statistical significance (p value) is depicted as @ p<0.05, @@p<0.01, @@@p<0.001, and @@@@p<0.0001 for comparison between sample “TAC-PH / PBS” and sample “TAC-PH / ActRIIA-mFc”.
[0042] Figures 15-18 show the therapeutic effect of ActRIIA-mFc in a TAC-PH model based on endpoints for right ventricle function. Twenty-six C57 / B6 male mice (lOwks old) underwent TAC pulmonary hypertension surgery (TAC-PH) and ten age-matched animals underwent a mock surgical procedure (Sham) at day 0. Two weeks after the surgery, TAC-PH mice were randomized into two groups i) fourteen mice were injected subcutaneously with vehicle control (phosphate buffered saline (PBS)), twice weekly for 4 weeks starting from day 14 after surgery, “TAC-PH / PBS”; and a ii) twelve mice were injected subcutaneously with ActRIIA-mFc at a dose of lOmg / kg twice weekly for 4 weeks starting from day 14 after TAC surgery, “TAC-PH / ActRIIA-mFc”. Figures 15-18 show endpoints for right ventricle function, including RV remodeling parameter right ventricular free wall thickness (RVFWT) (Figure 15), RV remodeling and function parameter tricuspid annular plane systolic excursion (TAPSE) (Figure 16), and RV function parameters RV stroke work (Figure 17) and RV contractility (dP / dT) (Figure 18). Relative to “TAC-PH / PBS” treated mice, “TAC- PH / ActRIIA-mFc” treated mice demonstrated a significant effect of ActRIIA-mFc in improving right heart remodeling and function. Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “Sham” and sample “TAC-PH / PBS”. Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC- PH / ActRIIA-mFc”. Statistical significance (p value) is depicted as @ p<0.05, @@p<0.01, @@@p<0.001, and @@@@p<0.0001 for comparison between sample “TAC-PH / PBS” and sample “TAC-PH / ActRIIA-mFc”.
[0043] Figures 19 and 20 show the therapeutic effect of ActRIIA-mFc in a TAC-PH model based on endpoints for lung remodeling. Twenty-six C57 / B6 male mice (lOwks old) underwent TAC pulmonary hypertension surgery (TAC-PH) and ten age-matched animals underwent a mock surgical procedure (Sham) at day 0. Two weeks after the surgery, TAC-PH mice were randomized into two groups i) fourteen mice were injected subcutaneously with vehicle control (phosphate buffered saline (PBS)), twice weekly for 4 weeks starting from day 14 after surgery, “TAC -PH / PBS”; and a ii) twelve mice were injected subcutaneously with ActRIIA-mFc at a dose of lOmg / kg twice weekly for 4 weeks starting from day 14 after TAC surgery, “TAC-PH / ActRIIA-mFc”. Figures 19 and 20 show endpoints for lung remodeling, including ratio of lung weight to tibia length (LW / TL) (Figure 19) and lung fibrosis percentage (Figure 20). Relative to “TAC-PH / PBS” treated mice, “TAC-PH / ActRIIA-mFc” treated mice demonstrated a significant effect of ActRIIA-mFc in reducing pulmonary remodeling and fibrosis. Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “Sham” and sample “TAC-PH / PBS”. Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC-PH / ActRIIA-mFc”. Statistical significance (p value) is depicted as @ p<0.05, @@p<0.01, @@@p<0.001, and @@@@p<0.0001 for comparison between sample “TAC-PH / PBS” and sample “TAC-PH / ActRIIA-mFc”.
[0044] Figure 21 shows components of a kit comprising a lyophilized polypeptide and an injection device. A vial (1) holds lyophilized polypeptide, reconstituted sterile injectable solution, or sterile injectable solution. A prefilled syringe (2) containing a reconstitution solution is used to reconstitute lyophilized polypeptide from (1) into a sterile injectable solution. A vial adapter (3) couples the vial (1) to the pre-filled syringe (2) via attachment to the vial at one end, and attachment to the pre-filled syringe at an opposite end. A syringe (4) and needle (5) are provided for administration of sterile injectable solution. Swab wipes (6) are provided for sterilization of individual kit components.
[0045] Figures 22-25 show that treatment with an ActRIIA-mFc fusion protein improves diastolic dysfunction in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). The experimental strategy used to test the preventative effects of ActRIIA-mFc in the rat model of HEpEF is shown in Figure 22. Figures 23-25 show endpoints for left ventricular function, including the left ventricular ejection fraction (Figure 23); LV diastolic function parameters E / E’ [Ratio of mitrial inflow velocity (E) to mitrial annular velocity (E’)j (Figure 24); and isovolumetric relaxation time (IVRT) (Figure 25). Statistical significance (p value) is depicted as * p<0.05, **p<0.01, and ***p<0.00L Figures 26-28 show that treatment with an ActRIIA-mFc fusion protein reduces left heart remodeling in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). Figures 26-28 show endpoints for left heart remodeling, including changes in ratio of heart weight to tibia length (HW / TL) (Figure 26); interventricular septal dimension at diastole (IVSd) (Figure 27); and left ventricular mass (LVM) (Figure 28). Statistical significance (p value) is depicted as * p<0.05, **p<0.01, and ***p<0.001.
[0046] Figures 29-31 show that treatment with an ActRIIA-mFc fusion protein reduces right ventricular systolic pressure (RVSP) and improves right ventricular function in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). Figures 29-31 show endpoints for right ventricular function, including changes in right ventricular free wall thickness (Figure 29); pulmonary artery acceleration time (PAAT) (Figure 30); and right ventricular systolic pressure (RVSP) (Figure 31). Statistical significance (p value) is depicted as * p<0.05 and **p<0.01.
[0047] Figures 32-34 show that treatment with an ActRIIA-mFc fusion protein significantly reduced the fibrosis in LV, RV and lung in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). Figures 32-34 show a reduction in fibrosis, including changes in left ventricular fibrosis (Figure 32); right ventricular fibrosis (Figure 33); and lung fibrosis (Figure 34). Statistical significance (p value) is depicted as * p<0.05 and **p<0.01.
[0048] Figures 35-38 show that treatment with an ActRIIA-mFc fusion protein significantly improves hyperglycemia and glucose intolerance in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). Figures 35-38 show endpoints for hyperglycemia and glucose intolerance, including changes in body weight (Figure 35); fasting glucose (Figure 36); blood glucose (Figure 37); and glucose / creatine ratio (Figure 38). Statistical significance (p value) is depicted as * p<0.05, **p<0.01, and ***p<0.001.
[0049] Figures 39-43 show that treatment with an ActRIIA-mFc fusion protein inhibits cardiac remodeling and improves LV function in a mouse model of PH due to heart failure with reduced LVEF (also referred to as HErEF) group 2 (subgroup 2.1) pulmonary hypertension (PH) and valvular heart disease (subgroup 2.3). The experimental strategy used to test the preventative effects of ActRIIA-mFc in the rat model of HErEF is shown in Figure 39. Figures 40-43 show endpoints for left ventricle function, including changes in cardiac hypertrophy heart weight / tibia length (HW / TL) (Figure 41), LV function parameters such as LV ejection fraction (Figure 40), LV diastolic function parameters E / E’ [Ratio of mitral inflow velocity (E) to mitral annular velocity (E’)] (Figure 42) and isovolumetric relaxation time (IVRT) (Figure 43). Relative to “TAC PBS” treated mice, “TAC ActRIIA-mFc” treated mice demonstrated a significant effect of ActRIIA-mFc in inhibiting cardiac remodeling and improving LV function. Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “TAC PBS” and sample “TAC ActRIIA-mFc”. Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC PBS.”
[0050] Figures 44-46 show the therapeutic effect of ActRIIA-mFc in a TAC-PH model based on endpoints for right ventricle function. Figures 44-46 show endpoints for right ventricle function including right ventricular systolic pressure (RV SP) (Figure 44), right ventricular free wall thickness (RVFWT) (Figure 45), and pulmonary artery acceleration time (PAAT) (Figure 46). Relative to “TAC PBS” treated mice, “TAC ActRIIA-mFc” mice treated with either 3 mpk and 10 mpk demonstrated a significant effect of ActRIIA-mFc in reducing RVSP and improving RV function. Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “TAC PBS” and sample “TAC ActRIIA-mFc.” Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC PBS.”
[0051] Figures 47-49 show the therapeutic effect of ActRIIA-mFc in a TAC-PH model based on endpoints for fibrosis in the left ventricle (LV), right ventricle (RV), and lung. Figures 47- 49 show endpoints for fibrosis in the left ventricle (LV) (Figure 47), right ventricle (RV) (Figure 48), and lung (Figure 49). Relative to “TAC PBS” treated mice, “TAC ActRIIA- mFc” mice treated with either 3 mpk or 10 mpk demonstrated a significant effect of ActRIIA- mFc in reducing fibrosis in the LV (Figure 47), RV (Figure 48), and lung (Figure 49). Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and ****p<0.0001 for comparison between “TAC PBS” and sample “TAC ActRIIA-mFc.” Statistical significance (p value) is depicted as # p<0.05, ##p<0.01, ###p<0.001, and ####p<0.0001 for comparison between “Sham” and sample “TAC PBS.”
[0052] Figures 50-55 show that treatment with an ActRIIA-mFc fusion protein reduces right ventricular systolic pressure (RVSP) and improves cardiopulmonary function in a rat model of left ventricular diastolic dysfunction (also referred to as HEpEF) group 2 (subgroup 2.2) pulmonary hypertension (PH). The experimental strategy used to test the preventative effects of an ActRIIA-mFc fusion protein in the rat model of HEpEF is shown in Figure 50. Figures 51-55 show endpoints for right ventricular function, including changes in pulmonary artery acceleration time (PAAT) (Figure 51); right ventricular systolic pressure (RVSP) (Figure 52); right ventricular wall thickness (RVWT) (Figure 53); tricuspid annular plane systolic excursion (TAPSE) (Figure 54); and Fulton index, calculated as the ratio of right ventricular weight (RV) to weight of the combined left ventricle and septum (LV+S) (Figure 55). Statistical significance (p value) is depicted as * p<0.05, **p<0.01, ***p<0.001, and
[0053] ****p<0.0001.
[0054] DETAILED DESCRIPTION 1. Overview
[0055] The present disclosure relates to compositions and methods of treating post-capillary pulmonary hypertension (e.g., WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide as described herein. In certain embodiments, the present disclosure provides methods of treating or preventing post capillary pulmonary hypertension (PcPH) in an individual in need thereof through administering to the individual a therapeutically effective amount of an ActRII polypeptide as described herein. In certain embodiments, the present disclosure provides methods of treating or preventing combined post- and pre-capillary PH in an individual in need thereof through administering to the individual a therapeutically effective amount of an ActRII polypeptide as described herein.
[0056] Pulmonary hypertension due to left heart disease (PH-LHD) (also known as WHO Group 2 PH) is a complex pathophenotype that, when present, may result in an increased susceptibility to adverse events and a worse clinical outcome. Among those patients with PH- LHD, two phenotypes have been described: 1) a group of isolated post-capillary (IpcPH) or “passive” PH in which elevated pulmonary pressures are reversible and in proportion to increases in left atrial pressure, and 2) a group with “pre-capillary” component [combined post capillary and pre-capillary PH (CpcPH)] whose pulmonary hypertension is worse than can be fully explained by passive elevation secondary to elevated left atrial pressure. This latter group, CpcPH, may have comorbid pulmonary vascular remodeling and therefore may demonstrate persistent PH after interventions to lower left sided fdling pressures. PH-LHD is sometimes defined as patients having a pulmonary capillary wedge pressure (PCWP) >15 mmHg and a mean pulmonary artery pressure (mPAP) >25 mmHg (or a mean pulmonary artery pressure (mPAP) >20 mmHg under updated guidelines). PH-LHD occurs as a consequence of the backward transmission of high left sided filling pressures, mainly driven by LV diastolic function, directly to the post-capillary pulmonary vessels and, thereby, to the rest of the pulmonary circulation. In some embodiments, PH-LHD is driven by both systolic and diastolic dysfunction. PH-LHD may be associated with or caused by PH due to heart failure with preserved left ventricle ejection fraction (LVEF) [also known as HFpEF], PH due to heart failure with reduced FVEF (also known as HFrEF), valvular heart disease, or congenital / acquired cardiovascular conditions leading to post-capillary PH. Compared with PAH, patients with PH-FHD are often older, female, with a higher prevalence of cardiovascular co-morbidities and most, if not all, of the features of metabolic syndrome.
[0057] For WHO Group 2 (PH-FHD) and Group 5 PH patients, there are no approved specific therapies available beyond treatment of the underlying disease. Most PH-FHD therapies target the underlying condition (e.g., repair of valvular heart disease) rather than specifically treating PH. The lack of specific therapies is particularly problematic because PH-FHD is the most common cause of PH in western countries and its presence commonly results in adverse course of the disease. Specifically, the presence of PH-FHD can result in more severe symptoms in FHD, worse exercise tolerance, and a negative impact on outcome. Accordingly, there is a high unmet need for new treatments for post-capillary pulmonary hypertension (e.g., WHO Group 2 and / or Group 5 PH) and these treatments would have the potential to positively affect large numbers of patients.
[0058] The terms used in this specification generally have their ordinary meanings in the art, within the context of this disclosure and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification to provide additional guidance to the practitioner in describing the compositions and methods of the disclosure and how to make and use them. The scope or meaning of any use of a term will be apparent from the specific context in which it is used.
[0059] The term “sequence similarity,” in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin. "Percent (%) sequence identity" with respect to a reference polypeptide (or nucleotide) sequence is defined as the percentage of amino acid residues (or nucleic acids) in a candidate sequence that are identical to the amino acid residues (or nucleic acids) in the reference polypeptide (nucleotide) sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid (nucleic acid) sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
[0060] “Agonize”, in all its grammatical forms, refers to the process of activating a protein and / or gene (e.g., by activating or amplifying that protein’s gene expression or by inducing an inactive protein to enter an active state) or increasing a protein’s and / or gene’s activity.
[0061] “Antagonize”, in all its grammatical forms, refers to the process of inhibiting a protein and / or gene (e.g., by inhibiting or decreasing that protein’s gene expression or by inducing an active protein to enter an inactive state) or decreasing a protein’s and / or gene’s activity.
[0062] The terms "about" and "approximately" as used in connection with a numerical value throughout the specification and the claims denotes an interval of accuracy, familiar and acceptable to a person skilled in the art. In general, such interval of accuracy is ± 10%. Alternatively, and particularly in biological systems, the terms "about" and "approximately" may mean values that are within an order of magnitude, preferably < 5 -fold and more preferably < 2-fold of a given value. Numeric ranges disclosed herein are inclusive of the numbers defining the ranges.
[0063] The terms "a" and "an" include plural referents unless the context in which the term is used clearly dictates otherwise. The terms "a" (or "an"), as well as the terms "one or more," and "at least one" can be used interchangeably herein. Furthermore, "and / or" where used herein is to be taken as specific disclosure of each of the two or more specified features or components with or without the other. Thus, the term “and / or" as used in a phrase such as "A and / or B" herein is intended to include "A and B," "A or B," "A" (alone), and "B" (alone). Likewise, the term "and / or" as used in a phrase such as "A, B, and / or C" is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0064] Throughout this specification, the word “comprise” or variations such as “comprises” or “comprising” will be understood to imply the inclusion of a stated integer or groups of integers but not the exclusion of any other integer or group of integers.
[0065] 2. ActRII Polypeptides
[0066] In certain aspects, the disclosure relates to ActRII polypeptides and uses thereof (e.g., of treating, preventing, or reducing the progression rate and / or severity of post-capillary pulmonary hypertension (PcPH) or one or more complications of PcPH). As used herein, the term “ActRII” refers to the family of type II activin receptors. This family includes activin receptor type IIA (ActRIIA) and activin receptor type IIB (ActRIIB).
[0067] In certain embodiments, the present disclosure relates to ActRII polypeptides having an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence as set forth in anyone of SEQ ID NOs: 1, 2, 3, 23, 27, 30, and 41. In other embodiments, the present disclosure relates to ActRII polypeptides having an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence as set forth in anyone of SEQ ID NOs: 31, 39, and 40. As used herein, the term “ActRII” refers to a family of activin receptor type IIA (ActRIIA) proteins, a family of activin receptor type IIB (ActRIIB) proteins, or combinations and / or variants thereof. The ActRII polypeptides can be derived from any species and include variants derived from such ActRII proteins by mutagenesis or other modification. Reference to ActRII herein is understood to be a reference to any one of the currently identified forms. Members of the ActRII family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine / threonine kinase activity.
[0068] The term ActRII polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRII family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity. Examples of such variant ActRII polypeptides are provided throughout the present disclosure as well as in International Patent Application Publication Nos. WO 2006 / 012627, WO 2007 / 062188, WO 2008 / 097541, WO 2010 / 151426, and WO 2011 / 020045, which are incorporated herein by reference in their entirety. Numbering of amino acids for all ActRII-related polypeptides described herein is based on the numbering of the human ActRII precursor protein sequence provided below (SEQ ID NO: 1), unless specifically designated otherwise.
[0069] The canonical human ActRII precursor protein sequence is as follows:
[0070] 1 MGAAAKLAFA VFLISCSSGA ILGRSETQEC LFFNANWEKD RTgQTGVEPC 51 YGDKDKRRHC FATWK^ISGS IEIVKQGCWL DDINCYDRTD CVEKKDSPEV 101 YFCCCEGNMC NEKFSYFPEM EVTQPTSNPV TPKPPYYNIL LYSLVPLMLI 151 AGIVICAFWV YRHHKMAYPP VLVPTQDPGP PPPSPLLGLK PLQLLEVKAR 201 GRFGCVWKAQ LLNEYVAVKI FPIQDKQSWQ NEYEVYSLPG MKHENILQFI 251 GAEKRGTSVD VDLWLITAFH EKGSLSDFLK ANVVSWNELC HIAETMARGL 301 AYLHEDIPGL KDGHKPAISH RDIKSKNVLL KNNLTACIAD FGLALKFEAG 351 KSAGDTHGQV GTRRYMAPEV LEGAINFQRD AFLRIDMYAM GLVLWELASR 401 CTAADGPVDE YMLPFEEEIG QHPSLEDMQE VVVHKKKRPV LRDYWQKHAG 451 MAMLCETIEE CWDHDAEARL SAGCVGERIT QMQRLTNIIT TEDIVTVVTM 501 VTNVDFPPKE SSL (SEQ ID NO: 1)
[0071] The signal peptide is indicated by a single underline: the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated by a double underline.
[0072] A processed (mature) extracellular human ActRII polypeptide sequence is as follows:
[0073] ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDD INCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP (SEQ ID NO: 2) The C-terminal “tail” of the extracellular domain is indicated by single underline.
[0074] The sequence with the “tail” deleted (a D15 sequence) is as follows:
[0075] ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDD INCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM (SEQ ID NO: 3)
[0076] The nucleic acid sequence encoding human ActRII precursor protein is shown below (SEQ ID NO: 4), as follows nucleotides 159-1700 of Genbank Reference Sequence NM_001616.4. The signal sequence is underlined.
[0077] 1 ATGGGAGCTG CTGCAAAGTT GGCGTTTGCC GTCTTTCTTA TCTCCTGTTC 51 TTCAGGTGCT ATACTTGGTA GATCAGAAAC TCAGGAGTGT CTTTTCTTTA 101 ATGCTAATTG GGAAAAAGAC AGAACCAATC AAACTGGTGT TGAACCGTGT 151 TATGGTGACA AAGATAAACG GCGGCATTGT TTTGCTACCT GGAAGAATAT 201 TTCTGGTTCC ATTGAAATAG TGAAACAAGG TTGTTGGCTG GATGATATCA 251 ACTGCTATGA CAGGACTGAT TGTGTAGAAA AAAAAGACAG CCCTGAAGTA 301 TATTTTTGTT GCTGTGAGGG CAATATGTGT AATGAAAAGT TTTCTTATTT 351 TCCGGAGATG GAAGTCACAC AGCCCACTTC AAATCCAGTT ACACCTAAGC 401 CACCCTATTA CAACATCCTG CTCTATTCCT TGGTGCCACT TATGTTAATT 451 GCGGGGATTG TCATTTGTGC ATTTTGGGTG TACAGGCATC ACAAGATGGC 501 CTACCCTCCT GTACTTGTTC CAACTCAAGA CCCAGGACCA CCCCCACCTT 551 CTCCATTACT AGGTTTGAAA CCACTGCAGT TATTAGAAGT GAAAGCAAGG 601 GGAAGATTTG GTTGTGTCTG GAAAGCCCAG TTGCTTAACG AATATGTGGC 651 TGTCAAAATA TTTCCAATAC AGGACAAACA GTCATGGCAA AATGAATACG 701 AAGTCTACAG TTTGCCTGGA ATGAAGCATG AGAACATATT ACAGTTCATT 751 GGTGCAGAAA AACGAGGCAC CAGTGTTGAT GTGGATCTTT GGCTGATCAC 801 AGCATTTCAT GAAAAGGGTT CACTATCAGA CTTTCTTAAG GCTAATGTGG 851 TCTCTTGGAA TGAACTGTGT CATATTGCAG AAACCATGGC TAGAGGATTG 901 GCATATTTAC ATGAGGATAT ACCTGGCCTA AAAGATGGCC ACAAACCTGC 951 CATATCTCAC AGGGACATCA AAAGTAAAAA TGTGCTGTTG AAAAACAACC 1001 TGACAGCTTG CATTGCTGAC TTTGGGTTGG CCTTAAAATT TGAGGCTGGC 1051 AAGTCTGCAG GCGATACCCA TGGACAGGTT GGTACCCGGA GGTACATGGC 1101 TCCAGAGGTA TTAGAGGGTG CTATAAACTT CCAAAGGGAT GCATTTTTGA 1151 GGATAGATAT GTATGCCATG GGATTAGTCC TATGGGAACT GGCTTCTCGC 1201 TGTACTGCTG CAGATGGACC TGTAGATGAA TACATGTTGC CATTTGAGGA 1251 GGAAATTGGC CAGCATCCAT CTCTTGAAGA CATGCAGGAA GTTGTTGTGC 1301 ATAAAAAAAA GAGGCCTGTT TTAAGAGATT ATTGGCAGAA ACATGCTGGA 1351 ATGGCAATGC TCTGTGAAAC CATTGAAGAA TGTTGGGATC ACGACGCAGA
[0078] 1401 AGCCAGGTTA TCAGCTGGAT GTGTAGGTGA AAGAATTACC CAGATGCAGA 1451 GACTAACAAA TATTATTACC ACAGAGGACA TTGTAACAGT GGTCACAATG 1501 GTGACAAATG TTGACTTTCC TCCCAAAGAA TCTAGTCTA (SEQ ID NO:
[0079] 4)
[0080] The nucleic acid sequence encoding processed soluble (extracellular) human ActRII polypeptide is as follows:
[0081] 1 ATACTTGGTA GATCAGAAAC TCAGGAGTGT CTTTTCTTTA ATGCTAATTG 51 GGAAAAAGAC AGAACCAATC AAACTGGTGT TGAACCGTGT TATGGTGACA 101 AAGATAAACG GCGGCATTGT TTTGCTACCT GGAAGAATAT TTCTGGTTCC 151 ATTGAAATAG TGAAACAAGG TTGTTGGCTG GATGATATCA ACTGCTATGA 201 CAGGACTGAT TGTGTAGAAA AAAAAGACAG CCCTGAAGTA TATTTTTGTT 251 GCTGTGAGGG CAATATGTGT AATGAAAAGT TTTCTTATTT TCCGGAGATG 301 GAAGTCACAC AGCCCACTTC AAATCCAGTT ACACCTAAGC CACCC (SEQ ID NO: 5)
[0082] ActRII is well-conserved among vertebrates, with large stretches of the extracellular domain completely conserved. For example, Figure 2 depicts a multi-sequence alignment of a human ActRII extracellular domain compared to various ActRII orthologs. Many of the ligands that bind to ActRII are also highly conserved. Accordingly, from these alignments, it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ActRII -ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ActRII-ligand binding activities. Therefore, an active, human ActRII variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRII, or may include a residue that is similar to that in the human or other vertebrate sequences.
[0083] An alignment of the amino acid sequences of human ActRIIA extracellular domain and human ActRIIB extracellular domain are illustrated in Figure 1. This alignment indicates amino acid residues within both receptors that are believed to directly contact ActRII ligands. For example, the composite ActRII structures indicated that the ActRIIA -ligand binding pocket is defined, in part, by residues F31, N33, N35, K38 through T41, E47, Y50, K53 through K55, R57, H58, F60, T62, K74, W78 through N83, Y85, R87, E92, and K94 through F101. At these positions, it is expected that conservative mutations will be tolerated.
[0084] Without meaning to be limiting, the following examples illustrate this approach to defining an active ActRII variant. As illustrated in Figure 2, F13 in the human extracellular domain is Y in Ovis aries (SEQ ID NO: 7), Gallus gallus (SEQ ID NO: 10), Bos Taurus (SEQ ID NO: 36), Tyto alba (SEQ ID NO: 37), and Myotis davidii (SEQ ID NO: 38) ActRII, indicating that aromatic residues are tolerated at this position, including F, W, and Y. Q24 in the human extracellular domain is R in Bos Taurus ActRII, indicating that charged residues will be tolerated at this position, including D, R, K, H, and E. S95 in the human extracellular domain is F in Gallus gallus and Tyto alba ActRII, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y, and probably hydrophobic residue such as L, I, or F. E52 in the human extracellular domain is D in Ovis aries ActRII, indicating that acidic residues are tolerated at this position, including D and E. P29 in the human extracellular domain is relatively poorly conserved, appearing as S in Ovis aries ActRII and L in Myotis davidii ActRII, thus essentially any amino acid should be tolerated at this position.
[0085] Moreover, as discussed above, ActRII proteins have been characterized in the art in terms of structural / functional characteristics, particularly with respect to ligand binding [Attisano et al. (1992) Cell 68(1):97-108; Greenwald et al. (1999) Nature Structural Biology 6(1): 18-22; Allendorph et al. (2006) PNAS 103(20: 7643-7648; Thompson et al. (2003) The EMBO loumal 22(7): 1555-1566; as well as U.S. Patent Nos: 7,709,605, 7,612,041, and 7,842,663] For example, a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomeric receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586:1860-1870] In addition to the teachings herein, these references provide amply guidance for how to generate ActRII variants that retain one or more desired activities (e.g., ligand binding activity).
[0086] For example, a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomeric receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860- 1870] Accordingly, the core ligand-binding domains of human ActRII, as demarcated by the outermost of these conserved cysteines, corresponds to positions 30-110 of SEQ ID NO: 1 (ActRII precursor). Therefore, the structurally less-ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29 residues at the N-terminus and by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues at the C-terminus without necessarily altering ligand binding. Exemplary ActRII extracellular domains truncations include SEQ ID NOs: 2 and 3.
[0087] Accordingly, a general formula for an active portion (e.g., ligand binding) of ActRII is a polypeptide that comprises, consists essentially of, or consists of amino acids 30-110 of SEQ ID NO: 1. Therefore ActRII polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRII beginning at a residue corresponding to any one of amino acids 21-30 (e.g. , beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30) of SEQ ID NO: 1 and ending at a position corresponding to any one amino acids 110-135 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127,
[0088] 128, 129, 130, 131, 132, 133, 134, or 135) of SEQ IDNO: 1. Other examples include constructs that begin at a position selected from 21-30 (e.g., beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30), 22-30 (e.g., beginning at any one of amino acids 22, 23, 24, 25, 26, 27, 28, 29, or 30), 23-30 (e.g., beginning at any one of amino acids 23, 24, 25, 26, 27, 28, 29, or 30), 24-30 (e.g., beginning at any one of amino acids 24, 25, 26, 27, 28, 29, or 30) ofSEQ IDNO: 1, and end at a position selected from 111-135 (e.g., ending at any one of amino acids 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128,
[0089] 129, 130, 131, 132, 133, 134 or 135), 112-135 (e.g., ending at any one of amino acids 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134 or 135), 113-135 (e.g., ending at any one of amino acids 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134 or 135), 120- 135 (e.g., ending at any one of amino acids 120, 121, 122, 123, 124, 125, 126, 127, 128, 129,
[0090] 130, 131, 132, 133, 134 or 135), 130-135 (e.g., ending at any one of amino acids 130, 131, 132, 133, 134 or 135), 111-134 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 111-133 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, or 133), 111-132 ( e.g ., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, or 132), or 111-131 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, or 131) of SEQ ID NO: 1. Variants within these ranges are also contemplated, particularly those comprising, consisting essentially of, or consisting of an amino acid sequence that has at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the corresponding portion of SEQ ID NO: 1. Thus, in some embodiments, an ActRII polypeptide may comprise, consists essentially of, or consist of a polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-110 of SEQ IDNO: 1. Optionally, ActRII polypeptides comprise apolypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-110 of SEQ ID NO: 1, and comprising no more than 1, 2, 5, 10 or 15 conservative amino acid changes in the ligand- binding pocket.
[0091] In certain embodiments, the disclosure relates to an ActRII polypeptide, which includes fragments, functional variants, and modified forms thereof as well as uses thereof (e.g., treating, preventing, or reducing the post-capillary pulmonary hypertension). Preferably, ActRII polypeptides are soluble (e.g., an extracellular domain of ActRII). In some embodiments, ActRII polypeptides inhibit (e.g., Smad signaling) of one or more GDF / BMP ligands [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP 15] In some embodiments, ActRII polypeptides bind to one or more GDF / BMP ligands [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP15] In some embodiments, ActRII polypeptide of the disclosure comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRII beginning at a residue corresponding to amino acids 21-30 (e.g., beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30) of SEQ ID NO: 1 and ending at a position corresponding to any one amino acids 110-135 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134 or 135) of SEQ ID NO: 1. In some embodiments, ActRII polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 30-110 of SEQ ID NO: 1. In certain embodiments, ActRII polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 21-135 of SEQ ID NO: 1. In some embodiments, ActRII polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 23, 27, 30, and 41.
[0092] In some embodiments, ActRII polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23. In some alternative embodiments, the ActRII polypeptide (e.g., SEQ ID NO: 23) may lack the C-terminal lysine. In some embodiments, the ActRII polypeptide lacking the C-terminal lysine is SEQ ID NO: 41. In some embodiments, the ActRII polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 41. In some embodiments, a patient is administered an ActRII polypeptide comprising, consisting, or consisting essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23. In some embodiments, a patient is administered an ActRII polypeptide comprising, consisting, or consisting essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 41. In some embodiments, a patient is administered a combination of SEQ ID NO: 23 and SEQ ID NO: 41.
[0093] In certain aspects, the present disclosure relates to ActRII polypeptides. In some embodiments, ActRII traps of the present disclosure are variant ActRII polypeptides (e.g., ActRIIA polypeptides, ActRIIB polypeptides, or combinations thereof) that comprise one or more mutations (e.g., amino acid additions, deletions, substitutions, and combinations thereof) in the extracellular domain (also referred to as the ligand-binding domain) of an ActRII polypeptide (e.g. , a “wild-type” or unmodified ActRII polypeptide) such that the variant ActRII polypeptide has one or more altered ligand-binding activities than the corresponding wild-type ActRII polypeptide. In preferred embodiments, variant ActRII polypeptides of the present disclosure retain at least one similar activity as a corresponding wild-type ActRII polypeptide. For example, preferable ActRII polypeptides bind to and inhibit (e.g. antagonize) the function of GDF11 and / or GDF8. In some embodiments, ActRII polypeptides of the present disclosure further bind to and inhibit one or more of ligand of the GDF / BMP [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP15] Accordingly, the present disclosure provides ActRII polypeptides that have an altered binding specificity for one or more ActRII ligands.
[0094] To illustrate, one or more mutations may be selected that increase the selectivity of the altered ligand-binding domain for GDF11 and / or GDF8 over one or more ActRII-binding ligands such as activins (activin A or activin B), particularly activin A. Optionally, the altered ligand-binding domain has a ratio of Kdfor activin binding to Kdfor GDF 11 and / or GDF8 binding that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the ratio for the wild-type ligand-binding domain. Optionally, the altered ligand-binding domain has a ratio of IC50 for inhibiting activin to IC50 for inhibiting GDF 11 and / or GDF8 that is at least 2- , 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the wild-type ligand-binding domain. Optionally, the altered ligand-binding domain inhibits GDF11 and / or GDF 8 with an IC50 at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-times less than the IC50 for inhibiting activin.
[0095] In certain embodiments, the present disclosure contemplates specific mutations of an ActRII polypeptide so as to alter the glycosylation of the polypeptide. Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N- linked glycosylation sites. Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine -X-serine (where “X” is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes. The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the polypeptide (for O-linked glycosylation sites). A variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and / or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence. Another means of increasing the number of carbohydrate moieties on a polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide. Depending on the coupling mode used, the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on a polypeptide may be accomplished chemically and / or enzymatically. Chemical deglycosylation may involve, for example, exposure of a polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact. Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. [Meth. Enzymol. (1987) 138:350] The sequence of a polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect, and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide. In general, polypeptides of the present disclosure for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
[0096] The present disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ActRII polypeptide as well as truncation mutants. Pools of combinatorial mutants are especially useful for identifying functionally active (e.g., GDF / BMP ligand binding) ActRII sequences. The purpose of screening such combinatorial libraries may be to generate, for example, polypeptides variants, which have altered properties, such as altered pharmacokinetic or altered ligand binding. A variety of screening assays are provided below, and such assays may be used to evaluate variants. For example, ActRII variants may be screened for ability to bind to one or more GDF / BMP ligands [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP15], to prevent binding of a GDF / BMP ligand to an ActRII polypeptide, as well as heteromultimers thereof, and / or to interfere with signaling caused by an GDF / BMP ligand.
[0097] The activity of ActRII polypeptides or variants thereof may also be tested in a cell- based or in vivo assay. For example, the effect of an ActRII polypeptide on the expression of genes involved in PcPH pathogenesis may be assessed. This may, as needed, be performed in the presence of one or more recombinant ligand proteins [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP15], and cells may be transfected so as to produce an ActRII polypeptide, and optionally, an GDF / BMP ligand. Fikewise, an ActRII polypeptide may be administered to a mouse or other animal and effects on PcPH pathogenesis may be assessed using art-recognized methods. Similarly, the activity of an ActRII polypeptide or variant thereof may be tested in blood cell precursor cells for any effect on growth of these cells, for example, by the assays as described herein and those of common knowledge in the art. A SMAD-responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
[0098] Combinatorial-derived variants can be generated which have increased selectivity or generally increased potency relative to a reference ActRII polypeptide. Such variants, when expressed from recombinant DNA constructs, can be used in gene therapy protocols. Likewise, mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified ActRII polypeptide. For example, the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction, or otherwise inactivation, of an unmodified polypeptide. Such variants, and the genes which encode them, can be utilized to alter polypeptide complex levels by modulating the half-life of the polypeptide. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant polypeptide complex levels within the cell. In an Fc fusion protein, mutations may be made in the linker (if any) and / or the Fc portion to alter the half-life of the ActRII polypeptide.
[0099] A combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRII polypeptide sequences. For instance, a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRII encoding nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
[0100] There are many ways by which the library of potential homologs can be generated from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression. The synthesis of degenerate oligonucleotides is well known in the art [Narang, SA (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; and Ike et al. (1983) Nucleic Acid Res. 11:477] Such techniques have been employed in the directed evolution of other proteins [Scott et al., (1990) Science 249:386-390; Roberts et al. (1992) PNAS USA 89:2429-2433; Devlin et al. (1990) Science 249: 404-406; Cwirla et al, (1990) PNAS USA 87: 6378-6382; as well as U.S. Patent Nos: 5,223,409, 5,198,346, and 5,096,815]
[0101] Alternatively, other forms of mutagenesis can be utilized to generate a combinatorial library. For example, ActRII polypeptides of the disclosure can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis [Ruf et al. (1994) Biochemistry 33:1565-1572; Wang et al. (1994) J. Biol. Chem. 269:3095-3099; Balint et al. (1993) Gene 137: 109-118; Grodberg et al. (1993) Eur. J. Biochem. 218:597-601; Nagashima et al. (1993) J. Biol. Chem. 268:2888-2892; Uowman et al. (1991) Biochemistry 30:10832- 10838; and Cunningham etal. (1989) Science 244:1081-1085], by linker scanning mutagenesis [Gustin et al. (1993) Virology 193:653-660; and Brown et al. (1992) Mol. Cell Biol. 12:2644- 2652; McKnight et al. (1982) Science 232:316], by saturation mutagenesis [Meyers et al, (1986) Science 232:613]; by PCR mutagenesis [Ueung et al. (1989) Method Cell Mol Biol 1: 11-19]; or by random mutagenesis, including chemical mutagenesis [Miller et al. (1992) A Short Course in Bacterial Genetics, CSHU Press, Cold Spring Harbor, NY; and Greener et al. (1994) Strategies in Mol Biol 7:32-34] Uinker scanning mutagenesis, particularly in a combinatorial setting, is an attractive method for identifying truncated (bioactive) forms of ActRII polypeptides.
[0102] A wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRII polypeptides. The most widely used techniques for screening large gene libraries typically comprise cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected. Preferred assays include ligand [ e.g ., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP 10, and / or BMP 15] binding assays and / or ligand-mediated cell signaling assays.
[0103] As will be recognized by one of skill in the art, most of the described mutations, variants or modifications described herein may be made at the nucleic acid level or, in some cases, by post-translational modification or chemical synthesis. Such techniques are well known in the art and some of which are described herein. In part, the present disclosure identifies functionally active portions (fragments) and variants of ActRII polypeptides that can be used as guidance for generating and using other variant ActRII polypeptides within the scope of the disclosure provided herein.
[0104] In certain embodiments, functionally active fragments of ActRII polypeptides of the present disclosure can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRII polypeptide. In addition, fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRII receptors and / or one or more ligands [e.g., GDF11, GDF8, activin A, activin B, GDF3, BMP4, BMP6, BMP10, and / or BMP 15]
[0105] In certain embodiments, ActRII polypeptides of the present disclosure may further comprise post-translational modifications in addition to any that are naturally present in the ActRII polypeptide. Such modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation. As a result, the ActRII polypeptide may contain non-amino acid elements, such as polyethylene glycols, lipids, polysaccharide or monosaccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a ligand trap polypeptide may be tested as described herein for other ActRII variants. When a polypeptide of the disclosure is produced in cells by cleaving a nascent form of the polypeptide, post-translational processing may also be important for correct folding and / or function of the protein. Different cells (e.g., CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293) have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRII polypeptides.
[0106] In certain aspects, ActRII polypeptides of the present disclosure include fusion proteins having at least a portion (domain) of an ActRII polypeptide and one or more heterologous portions (domains). Well-known examples of such fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S-transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy-chain constant region (Fc), maltose binding protein (MBP), or human serum albumin. A fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography. For the purpose of affinity purification, relevant matrices for affinity chromatography, such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used. Many of such matrices are available in “kit” form, such as the Pharmacia GST purification system and the QIAexpress™ system (Qiagen) useful with ( H I Sr,) fusion partners. As another example, a fusion domain may be selected so as to facilitate detection of the ActRII polypeptide. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as “epitope tags,” which are usually short peptide sequences for which a specific antibody is available. Well-known epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c- myc tags. In some cases, the fusion domains have a protease cleavage site, such as for Factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function) including, for example constant domains from immunoglobulins (e.g., Fc domains).
[0107] In certain aspects, ActRII polypeptides of the present disclosure contain one or more modifications that are capable of “stabilizing” the polypeptides. By “stabilizing” is meant anything that increases the in vitro half-life, serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect of the agent. For example, such modifications enhance the shelf-life of the polypeptides, enhance circulatory half-life of the polypeptides, and / or reduce proteolytic degradation of the polypeptides. Such stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRII polypeptide domain and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to a polypeptide of the disclosure), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure). As used herein, the term “stabilizer domain” not only refers to a fusion domain (e.g., an immunoglobulin Fc domain) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous moiety, such as polyethylene glycol. In certain preferred embodiments, an ActRII polypeptide is fused with a heterologous domain that stabilizes the polypeptide (a “stabilizer” domain), preferably a heterologous domain that increases stability of the polypeptide in vivo. Fusions with a constant domain of an immunoglobulin (e.g., a Fc domain) are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties.
[0108] An example of a native amino acid sequence that may be used for the Fc portion of human IgGl (GIFc) is shown below (SEQ ID NO: 11). Dotted underline indicates the hinge region, and solid underline indicates positions with naturally occurring variants. In part, the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 11. Naturally occurring variants in GIFc would include E134D and M136L according to the numbering system used in SEQ ID NO: 11 (see Uniprot P01857).
[0109] 1 THTCPPCPAP ELLGGPSVFL FPPKPKDTLM ISRTPEVTCV VVDVSHEDPE
[0110] 51 VKFNWYVDGV EVHNAKTKPR EEQYNSTYRV VSVLTVLHQD WLNGKEYKCK
[0111] 101 VSNKALPAPI EKTISKAKGQ PREPQVYTLP PSREEMTKNQ VSLTCLVKGF
[0112] 151 YPSDIAVEWE SNGQPENNYK TTPPVLDSDG SFFLYSKLTV DKSRWQQGNV
[0113] 201 FSCSVMHEAL HNHYTQKSLS LSPGK (SEQ ID NO: 11 )
[0114] Optionally, the IgGl Fc domain has one or more mutations at residues such as Asp- 265, lysine 322, and Asn-434. In certain cases, the mutant IgGl Fc domain having one or more of these mutations (e.g., Asp-265 mutation) has reduced ability of binding to the Fey receptor relative to a wild-type Fc domain. In other cases, the mutant Fc domain having one or more of these mutations (e.g., Asn-434 mutation) has increased ability of binding to the MHC class I- related Fc-receptor (FcRN) relative to a wild-type IgGl Fc domain.
[0115] An example of a native amino acid sequence that may be used for the Fc portion of human IgG2 (G2Fc) is shown below (SEQ ID NO: 12). Dotted underline indicates the hinge region and double underline indicates positions where there are data base conflicts in the sequence (according to UniProt P01859). In part, the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 12.
[0116] 1 VECPPCPAPP VAGPSVFLFP PKPKDTLMIS RTPEVTCVVV DVSHEDPEVQ
[0117] 51 FNWYVDGVEV HNAKTKPREE QFNSTFRVVS VLTVVHQDWL NGKEYKCKVS
[0118] 101 NKGLPAPIEK TISKTKGQPR EPQVYTLPPS REEMTKNQVS LTCLVKGFYP
[0119] 151 SDI^VEWESN GQPENNYKTT PPMLDSDGSF FLYSKLTVDK SRWQQGNVFS 201 CSVMHEALHN HYTQKSLSLS PGK (SEQ ID NO: 12)
[0120] Two examples of amino acid sequences that may be used for the Fc portion of human IgG3 (G3Fc) are shown below. The hinge region in G3Fc can be up to four times as long as in other Fc chains and contains three identical 15 -residue segments preceded by a similar 17- residue segment. The first G3Fc sequence shown below (SEQ ID NO: 13) contains a short hinge region consisting of a single 15-residue segment, whereas the second G3Fc sequence (SEQ ID NO: 14) contains a full-length hinge region. In each case, dotted underline indicates the hinge region, and solid underline indicates positions with naturally occurring variants according to UniProt P01859. In part, the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NOs: 13 and 14.
[0121] 1 EPKSCDTPPP CPRCPAPELL GGPSVFLFPP KPKDTLMISR TPEVTCVVVD
[0122] 51 VSHEDPEVQF KWYVDGVEVH NAKTKPREEQ YNSTFRVVSV LTVLHQDWLN
[0123] 101 GKEYKCKVSN KALPAPIEKT ISKTKGQPRE PQVYTLPPSR EEMTKNQVSL
[0124] 151 TCLVKGFYPS DIAVEWESSG QPENNYNTTP PMLDSDGSFF LYSKLTVDKS
[0125] 201 RWQQGNIFSC SVMHEALHNR FTQKSLSLSP GK (SEQ ID NO: 13)
[0126] 1 ELKTPLGDTT HTCPRCPEPK SCDTPPPCPR CPEPKSCDTP PPCPRCPEPK
[0127] 51 SCDTPPPCPR CPAPELLGGP SVFLFPPKPK DTLMISRTPE VTCVVVDVSH
[0128] 101 EDPEVQFKWY VDGVEVHNAK TKPREEQYNS TFRVVSVLTV LHQDWLNGKE
[0129] 151 YKCKVSNKAL PAPIEKTISK TKGQPREPQV YTLPPSREEM TKNQVSLTCL
[0130] 201 VKGFYPSDIA VEWESSGQPE NNYNTTPPML DSDGSFFLYS KLTVDKSRWQ
[0131] 251 QGNIFSCSVM HEALHNRFTQ KSLSLSPGK (SEQ ID NO: 14)
[0132] Naturally occurring variants in G3Fc (for example, see Uniprot P01860) include E68Q, P76L, E79Q, Y81F, D97N, N100D, T124A, S169N, S169del, F221Y when converted to the numbering system used in SEQ ID NO: 13, and the present disclosure provides fusion proteins comprising G3Fc domains containing one or more of these variations. In addition, the human immunoglobulin IgG3 gene ( IGHG3 ) shows a structural polymorphism characterized by different hinge lengths [see Uniprot P01859] Specifically, variant WIS is lacking most of the V region and all of the CHI region. It has an extra interchain disulfide bond at position 7 in addition to the 11 normally present in the hinge region. Variant ZUC lacks most of the V region, all of the CHI region, and part of the hinge. Variant OMM may represent an allelic form or another gamma chain subclass. The present disclosure provides additional fusion proteins comprising G3Fc domains containing one or more of these variants.
[0133] An example of a native amino acid sequence that may be used for the Fc portion of human IgG4 (G4Fc) is shown below (SEQ ID NO: 15). Dotted underline indicates the hinge region. In part, the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 15.
[0134] 1 ESKYGPPCPS CPAPEFLGGP SVFLFPPKPK DTLMISRTPE VTCVVVDVSQ
[0135] 51 EDPEVQFNWY VDGVEVHNAK TKPREEQFNS TYRVVSVLTV LHQDWLNGKE 101 YKCKVSNKGL PSSIEKTISK AKGQPREPQV YTLPPSQEEM TKNQVSLTCL
[0136] 151 VKGFYPSDIA VEWESNGQPE NNYKTTPPVL DSDGSFFLYS RLTVDKSRWQ
[0137] 201 EGNVFSCSVM HEALHNHYTQ KSLSLSLGK (SEQ ID NO: 15)
[0138] A variety of engineered mutations in the Fc domain are presented herein with respect to the GIFc sequence (SEQ ID NO: 11), and analogous mutations in G2Fc, G3Fc, and G4Fc can be derived from their alignment with GIFc in Figure 4. Due to unequal hinge lengths, analogous Fc positions based on isotype alignment (Figure 4) possess different amino acid numbers in SEQ ID NOs: 11, 12, 13, 14, and 15. It can also be appreciated that a given amino acid position in an immunoglobulin sequence consisting of hinge, CH2, and CH3 regions (e.g., SEQ ID NOs: 11, 12, 13, 14, and 15) will be identified by a different number than the same position when numbering encompasses the entire IgGl heavy-chain constant domain (consisting of the CHI, hinge, CH2, and CH3 regions) as in the Uniprot database. For example, correspondence between selected CH3 positions in a human GIFc sequence (SEQ ID NO: 11), the human IgGl heavy chain constant domain (Uniprot P01857), and the human IgGl heavy chain is as follows.
[0139]
[0140] Various methods are known in the art that increase desired pairing of Fc-containing fusion polypeptide chains in a single cell line to produce a preferred asymmetric fusion protein at acceptable yields [Klein et al (2012) mAbs 4:653-663; and Spiess et al (2015) Molecular Immunology 67(2A): 95-106] Methods to obtain desired pairing of Fc-containing chains include, but are not limited to, charge-based pairing (electrostatic steering), “knobs-into-holes” steric pairing, SEEDbody pairing, and leucine zipper-based pairing [Ridgway et al (1996) Protein Eng 9:617-621; Merchant et al (1998) Nat Biotech 16:677-681; Davis et al (2010) Protein Eng Des Sel 23:195-202; Gunasekaran et al (2010); 285:19637-19646; Wranik et al (2012) J Biol Chem 287:43331-43339; US5932448; WO 1993 / 011162; WO 2009 / 089004, and WO 2011 / 034605]
[0141] It is understood that different elements of the fusion proteins (e.g., immunoglobulin Fc fusion proteins) may be arranged in any manner that is consistent with desired functionality. For example, an ActRII polypeptide domain may be placed C-terminal to a heterologous domain, or alternatively, a heterologous domain may be placed C-terminal to an ActRII polypeptide domain. The ActRII polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
[0142] For example, an ActRII receptor fusion protein may comprise an amino acid sequence as set forth in the formula A-B-C. The B portion corresponds to an ActRII polypeptide domain. The A and C portions may be independently zero, one, or more than one amino acid, and both the A and C portions when present are heterologous to B. The A and / or C portions may be attached to the B portion via a linker sequence. A linker may be rich in glycine (e.g., 2-10, 2- 5, 2-4, 2-3 glycine residues) or glycine and proline residues and may, for example, contain a single sequence of threonine / serine and glycines or repeating sequences of threonine / serine and / or glycines, e.g., GGG (SEQ ID NO: 16), GGGG (SEQ ID NO: 17), TGGGG (SEQ ID NO: 18), SGGGG (SEQ ID NO: 19), TGGG (SEQ ID NO: 20), SGGG (SEQ ID NO: 21), or GGGGS (SEQ ID NO: 22) singlets, or repeats. In certain embodiments, an ActRII fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader (signal) sequence, B consists of an ActRII polypeptide domain, and C is a polypeptide portion that enhances one or more of in vivo stability, in vivo half-life, uptake / administration, tissue localization or distribution, formation of protein complexes, and / or purification. In certain embodiments, an ActRII fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a TPA leader sequence, B consists of an ActRII receptor polypeptide domain, and C is an immunoglobulin Fc domain. Preferred fusion proteins comprise the amino acid sequence set forth in any one of SEQ ID NOs: 23, 27, 30, and 41.
[0143] In preferred embodiments, ActRII polypeptides to be used in accordance with the methods described herein are isolated polypeptides. As used herein, an isolated protein or polypeptide is one which has been separated from a component of its natural environment. In some embodiments, a polypeptide of the disclosure is purified to greater than 95%, 96%, 97%, 98%, or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC). Methods for assessment of purity are well known in the art [see, e.g., Flatman el al., (2007) I. Chromatogr. B 848:79-87] In some embodiments, ActRII polypeptides to be used in accordance with the methods described herein are recombinant polypeptides.
[0144] ActRII polypeptides of the disclosure can be produced by a variety of art-known techniques. For example, polypeptides of the disclosure can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman and Company, New York (1992). In addition, automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396; Milligen / Biosearch 9600). Alternatively, the polypeptides of the disclosure, including fragments or variants thereof, may be recombinantly produced using various expression systems [e.g., E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus] as is well known in the art. In a further embodiment, the modified or unmodified polypeptides of the disclosure may be produced by digestion of recombinantly produced full-length ActRII polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE). Computer analysis (using commercially available software, e.g., MacVector, Omega, PCGene, Molecular Simulation, Inc.) can be used to identify proteolytic cleavage sites. Alternatively, such polypeptides may be produced from recombinantly generated full-length ActRII polypeptides using chemical cleavage (e.g., cyanogen bromide, hydroxylamine, etc.).
[0145] 3. Nucleic Acids Encoding ActRII Polypeptides
[0146] In certain embodiments, the present disclosure provides isolated and / or recombinant nucleic acids encoding ActRII polypeptides (including fragments, functional variants, and fusion proteins thereof).
[0147] As used herein, isolated nucleic acid(s) refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0148] In certain embodiments, nucleic acids encoding ActRII polypeptides of the disclosure are understood to include nucleic acids that are variants of any one of SEQ ID NOs: 4, 5, or 28. Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions, or deletions including allelic variants, and therefore, will include coding sequence that differ from the nucleotide sequence designated in any one of SEQ ID NOs: 4, 5, or 28.
[0149] In certain embodiments, ActRII polypeptides of the disclosure are encoded by isolated and / or recombinant nucleic acid sequences that are at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 4, 5, or 28. One of ordinary skill in the art will appreciate that nucleic acid sequences that are at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequences complementary to SEQ ID NOs: 4, 5, or 28, and variants thereof, are also within the scope of the present disclosure. In further embodiments, the nucleic acid sequences of the disclosure can be isolated, recombinant, and / or fused with a heterologous nucleotide sequence, or in a DNA library.
[0150] In other embodiments, nucleic acids of the present disclosure also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 4, 5, or 28, complement sequences of SEQ ID NOs: 4, 5, or 28, or fragments thereof. As discussed above, one of ordinary skill in the art will understand readily that appropriate stringency conditions which promote DNA hybridization can be varied. One of ordinary skill in the art will understand readily that appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride / sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C. For example, the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C. In addition, the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed. In one embodiment, the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
[0151] Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 4, 5, or 28 to degeneracy in the genetic code are also within the scope of the disclosure. For example, a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in “silent” mutations which do not affect the amino acid sequence of the protein. However, it is expected that DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells. One skilled in the art will appreciate that these variations in one or more nucleotides (up to about 3-5% of the nucleotides) of the nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
[0152] In certain embodiments, the recombinant nucleic acids of the present disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct. Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art and can be used in a variety of host cells. Typically, one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure. The promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter. An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome. In some embodiments, the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and can vary with the host cell used.
[0153] In certain aspects, the subject nucleic acid disclosed herein is provided in an expression vector comprising a nucleotide sequence encoding an ActRII polypeptide and operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of the ActRII polypeptide. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology. Methods in Enzymology, Academic Press, San Diego, CA (1990). For instance, any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRII polypeptide. Such useful expression control sequences, include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof. It should be understood that the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and / or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
[0154] A recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both. Expression vehicles for production of a recombinant ActRII polypeptide include plasmids and other vectors. For instance, suitable vectors include plasmids of the following types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
[0155] Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells. The pcDNAI / amp, pcDNAI / neo, pRc / CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells. Some of these vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells. Alternatively, derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein- Barr virus (pHEBo, pREP -derived and p205) can be used for transient expression of proteins in eukaryotic cells. Examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems. The various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures, e.g., Molecular Cloning A Laboratory Manual, 3rd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press, 2001). In some instances, it may be desirable to express the recombinant polypeptides by the use of a baculovirus expression system. Examples of such baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac -derived vectors (such as the B-gal containing pBlueBac III).
[0156] In a preferred embodiment, a vector will be designed for production of the subject ActRII polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise.). As will be apparent, the subject gene constructs can be used to cause expression of the subject ActRII polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
[0157] This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence for one or more of the subject ActRII polypeptides. The host cell may be any prokaryotic or eukaryotic cell. For example, an ActRII polypeptide of the disclosure may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line] . Other suitable host cells are known to those skilled in the art.
[0158] Accordingly, the present disclosure further pertains to methods of producing the subject ActRII polypeptides. For example, a host cell transfected with an expression vector encoding an ActRII polypeptide can be cultured under appropriate conditions to allow expression of the ActRII polypeptide to occur. The polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptide. Alternatively, the ActRII polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated. A cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art. The subject polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel fdtration chromatography, ultrafdtration, electrophoresis, immunoaffmity purification with antibodies specific for particular epitopes of the ActRII polypeptides, and affinity purification with an agent that binds to a domain fused to the ActRII polypeptide (e.g., a protein A column may be used to purify an ActRII-Fc fusion proteins). In some embodiments, the ActRII polypeptide is a fusion protein containing a domain which facilitates its purification.
[0159] In some embodiments, purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography. The purification could be completed with viral filtration and buffer exchange. An ActRII protein may be purified to a purity of >90%, >95%, >96%, >98%, or >99% as determined by size exclusion chromatography and >90%, >95%, >96%, >98%, or >99% as determined by SDS PAGE. The target level of purity should be one that is sufficient to achieve desirable results in mammalian systems, particularly non-human primates, rodents (mice), and humans.
[0160] In another embodiment, a fusion gene coding for a purification leader sequence, such as a poly-(His) / enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRII polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni2+metal resin. The purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRII polypeptide. See, e.g., Hochuli etal. (1987) J. Chromatography 41 1 : 177: and lanknecht el al. (1991) PNAS USA 88:8972. Techniques for making fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence. See, e.g., Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992.
[0161] 4. Methods of Use
[0162] In part, the present disclosure relates to methods of treating post-capillary pulmonary hypertension (PcPH) (e.g., WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide as described herein. In some embodiments, the PcPH is combined post- and pre-capillary PH. In certain embodiments, the present disclosure provides methods of treating or preventing post-capillary pulmonary hypertension (PcPH) in an individual in need thereof through administering to the individual a therapeutically effective amount of an ActRII polypeptide as described herein. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans. The terms "subject," an "individual," or a "patient" are interchangeable throughout the specification and and refer to either a human or a non-human animal. These terms include mammals, such as humans, non-human primates, laboratory animals, livestock animals (including bovines, porcines, camels, etc.), companion animals (e.g., canines, felines, other domesticated animals, etc.) and rodents (e.g., mice and rats). In particular embodiments, the patient, subject or individual is a human.
[0163] The terms "treatment", "treating", “alleviating” and the like are used herein to generally mean obtaining a desired pharmacologic and / or physiologic effect, and may also be used to refer to improving, alleviating, and / or decreasing the severity of one or more clinical complication of a condition being treated (e.g., WHO Group 2 and / or Group 5 PH). The effect may be prophylactic in terms of completely or partially delaying the onset or recurrence of a disease, condition, or complications thereof, and / or may be therapeutic in terms of a partial or complete cure for a disease or condition and / or adverse effect attributable to the disease or condition. "Treatment" as used herein covers any treatment of a disease or condition of a mammal, particularly a human. As used herein, a therapeutic that “prevents” a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in a treated sample relative to an untreated control sample, or delays the onset of the disease or condition, relative to an untreated control sample.
[0164] In general, treatment or prevention of a disease or condition as described in the present disclosure (e.g., WHO Group 2 and / or Group 5 PH) is achieved by administering one or more ActRII polypeptides of the present disclosure in an "effective amount". An effective amount of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A "therapeutically effective amount" of an agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the agent to elicit a desired response in the individual. A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result.
[0165] In certain aspects, the disclosure contemplates the use of an ActRII polypeptide, in combination with one or more additional active agents or other supportive therapy for treating or preventing a disease or condition (e.g. , WHO Group 2 and / or Group 5 PH). As used herein, “in combination with”, “combinations of’, “combined with”, or “conjoint” administration refers to any form of administration such that additional active agents or supportive therapies (e.g., second, third, fourth, etc.) are still effective in the body (e.g., multiple compounds are simultaneously effective in the patient for some period of time, which may include synergistic effects of those compounds). Effectiveness may not correlate to measurable concentration of the agent in blood, serum, or plasma. For example, the different therapeutic compounds can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially, and on different schedules. Thus, a subject who receives such treatment can benefit from a combined effect of different active agents or therapies. One or more ActRII polypeptides of the disclosure can be administered concurrently with, prior to, or subsequent to, one or more other additional agents or supportive therapies, such as those disclosed herein. In general, each active agent or therapy will be administered at a dose and / or on a time schedule determined for that particular agent. The particular combination to employ in a regimen will take into account compatibility of the ActRII polypeptide of the present disclosure with the additional active agent or therapy and / or the desired effect.
[0166] WHO Classification Outline
[0167] A pulmonary hypertension condition treated by methods describe herein, can comprise any one or more of the conditions recognized according to the World Health Organization (WHO). See, e.g., Simonneau (2019) Eur Respir J: 53: 1801913.
[0168] Table 1: Clinical Classification of Pulmonary Hypertension
[0169] 1Left ventricular ejection fraction
[0170] The clinical purpose of the classification of PH is to categorize clinical conditions associated with PH into five groups according to their pathophysiological mechanisms, clinical presentation, hemodynamic characteristics, and treatment strategy. This clinical classification may be updated when new data are available on the above features or when additional clinical entities are considered.
[0171] Pulmonary hypertension (PH) has been previously classified as primary or secondary PH. The term primary pulmonary hypertension has now been replaced by idiopathic PAH or familial PAH depending on the absence or presence of genetic information; the term secondary pulmonary hypertension has been abandoned.
[0172] As used herein, the term “pulmonary hemodynamic parameter” refers to any parameter used to describe or evaluate the blood flow through the heart and pulmonary vasculature. Examples of pulmonary hemodynamic parameters include, but are not limited to, mean pulmonary artery pressure (mPAP), diastolic pulmonary artery pressure (dPAP) [also known as pulmonary artery diastolic pressure (PADP)], systolic pulmonary artery pressure (sPAP) [also known as pulmonary artery systolic pressure (PASP)], mean right atrial pressure (mRAP), pulmonary capillary wedge pressure (PCWP) [also known as pulmonary artery wedge pressure (PAWP)], left ventricular end-diastolic pressure (LVEDP), diastolic pressure gradient (DPG) [also known as diastolic pressure difference (DPD)], left atrial pressure (LAP), transpulmonary gradient (TPG), pulmonary vascular resistance (PVR) and cardiac output (CO).
[0173] Many of the pulmonary hemodynamic parameters described above are interrelated. For example, PCWP is often used as a more convenient, less invasive approximation of LAP.
[0174] As another example, PVR is related to mPAP, PCWP and CO according to the following equation:
[0175] PVR=(mPAP-PCWP) / CO [Woods Units]
[0176] The PVR measures the resistance to flow imposed by the pulmonary vasculature without the influence of the left-sided filling pressure. PVR can also be measured according to the following equations:
[0177] PVR = TPG x 80 / CO [unit: dynes-sec-cm5] OR PVR = (mPAP - PCWP)c80 / CO [unit: dynes-sec-cm5]
[0178] In some embodiments, the total PVR can be measured using the following equation:
[0179] TPR= mPAP / CO
[0180] According to some embodiments, a pre-capillary pulmonary arterial contribution to PH may be reflected by an elevated PVR. In some embodiments, the normal PVR is 20-130 dynes- sec-cm5or 0.5-1.1 Wood units. According to some embodiments, an elevated PVR may refer to a PVR above 2 Wood units, above 2.5 Wood units, above 3 Wood units or above 3.5 Wood units. As yet another example, TPG is the difference between mPAP and left atrial pressure (PLA; commonly estimated by pulmonary capillary wedge pressure: PCWP) as shown by the following equation: TPG=mPAP-PCWP
[0181] The TPG is influenced by all the determinants of mPAP, including flow, resistance and left heart filling pressure. A pre-capillary pulmonary arterial contribution to PH may be reflected by an increased trans-pulmonary gradient (TPG). According to some embodiments, an increased TPG may refer to an mPAP-PCWP that exceeds 12-15 mmHg.
[0182] DPG (defined as diastolic PAP - mean PAWP) appears to best approach the characteristics required to determine pulmonary vascular disease. In some embodiments, the DPG is synonymous with diastolic pressure difference (DPD). In normal subjects, DPG generally lies in the 1-3 mmHg range, and in patients evaluated for cardiac disease (excluding shunts), DPG remains <5 mmHg in most cases.
[0183] As a further example, mPAP is related to dPAP and sPAP according to the following equation: mPAP=(¾)dPAP+(½)sPAP
[0184] Furthermore, dPAP and sPAP can be used to calculate the pulse pressure (mmHg) using the following equation: pulse pressure=sPAP-dPAP
[0185] Pulse pressure can be used to calculate the pulmonary artery compliance using the following equation: pulmonary artery compliance (ml.mmHg1) = stroke volume / pulse pressure.In some embodiments, the pulmonary hemodynamic parameters are measured directly, such as during a right heart catheterization. In other embodiments, the pulmonary hemodynamic parameters are estimated and / or evaluated through other techniques such as magnetic resonance imaging (MRI) or echocardiography.
[0186] Exemplary pulmonary hemodynamic parameters include mPAP, PAWP, TPG, DPG, and PVR. The one or more pulmonary hemodynamic parameters may be measured by any appropriate procedures, such as by utilizing a right heart catheterization or echocardiography. Various hemodynamic types of PH are shown in Table 2 together with their corresponding clinical classification (Table 1). Table 2. Hemodynamic Types of Pulmonary Hypertension (PH)
[0187] The types of PH and the difference between pre-capillary pulmonary hypertension and post-capillary pulmonary hypertension are based on pulmonary hemodynamic parameters. As used herein, the term “pre-capillary pulmonary hypertension” includes WHO clinical Groups 1, 3, 4, and 5. In general, pre-capillary pulmonary hypertension is characterized using the pulmonary hemodynamic parameters shown in Table 2 (i.e., an mPAP >20 mmHg or in some embodiments an mPAP >25 mmHg). As used herein, the term “post-capillary pulmonary hypertension” (PcPH) includes both isolated post-capillary pulmonary hypertension (IpcPH) and combined pre- and post-capillary pulmonary hypertension (CpcPH), both within WHO clinical Groups 2 and 5. In some embodiments, IpcPH is characterized using the pulmonary hemodynamic parameters shown in Table 2 (i.e., one or more of the following pulmonary hemodynamic parameters: mPAP >20 mmHg, PAWP >15 mmHg, PVR <3 Wood units, and / or DPG <7 mmHg). In some embodiments, CpcPH is characterized using the pulmonary hemodynamic parameters shown in Table 2 (i.e., one or more of the following pulmonary hemodynamic parameters: mPAP >20 mmHg, PAWP >15 mmHg, PVR >3 Wood units, and / or DPG >7 mmHg). In some embodiments, CpcPH is characterized as comprising one or more of the following hemodynamic parameters: mPAP > 25mmHg; PAWP > 15 mmHg; and PVR > 3 WU.
[0188] The clinical classification or hemodynamic types of PH described herein and the associated diagnostic parameters may be updated or varied based on the availability of new or existing sources of data or when additional clinical entities are considered.
[0189] Characteristics of PH
[0190] The diagnosis of PH, including WHO PH class and functional group, can be determined based on symptoms and physical examination using a review of a comprehensive set of parameters to determine if the hemodynamic and other criteria are met. Some of the criteria which may considered include the patient’s clinical presentation (e.g., shortness of breath, fatigue, weakness, angina, syncope, dry-couch, exercise-induced nausea and vomiting), electrocardiogram (ECG) results, chest radiograph results, pulmonary function tests, arterial blood gases, echocardiography results, ventilation / perfusion lung scan results, high-resolution computed tomography results, contrast-enhanced computed tomography results, pulmonary angiography results, cardiac magnetic resonance imaging, blood tests (e.g., biomarkers such as BNP or NT-proBNP), immunology, abdominal ultrasound scan, right heart catherization (RHC), vasoreactivity, and genetic testing. See. e.g., Galie N., et al Euro Heart J. (2016) 37, 67-119.
[0191] In some embodiments, a biomarker may be used to determine the diagnosis of PH. For instance, in some embodiments, the biomarker is a marker of vascular dysfunction (e.g., asymmetric dimethylarginine (ADMA), endothelin-1, angiopoeitins, or von Willebrand factor). In some embodiments, the biomarker is a marker of inflammation (C-reactive protein, interleukin 6, chemokines). In some embodiments, the biomarker is a marker of myocardial stress (e.g., (atrial natriuretic peptide, brain natriuretic peptide (BNP) / NT-proBNP, or troponins). In some embodiments, the biomarker is a marker of low CO and / or tissue hypoxia (e.g., pC02, uric acid, growth differentiation factor 15 (GDF15), or osteopontin). In some embodiments, the biomarker is a marker of secondary organ damage (e.g., creatinine or bilirubin). See, e.g., Galie N., et al Euro Heart J. (2016) 37, 67-119.
[0192] Group 1 PH
[0193] Pulmonary arterial hypertension (WHO Group 1 PH) is a serious, progressive and life- threatening disease of the pulmonary vasculature, characterized by profound vasoconstriction and an abnormal proliferation of smooth muscle cells in the walls of the pulmonary arteries. Severe constriction of the blood vessels in the lungs leads to very high pulmonary arterial pressures. These high pressures make it difficult for the heart to pump blood through the lungs to be oxygenated. Patients with PAH suffer from extreme shortness of breath as the heart struggles to pump against these high pressures. Patients with PAH typically develop significant increases in PVR and sustained elevations in mPAP, which ultimately lead to right ventricular failure and death. Patients diagnosed with PAH have a poor prognosis and equally compromised quality of life, with a mean life expectancy of 2 to 5 years from the time of diagnosis if untreated.
[0194] A variety of factors contribute to the pathogenesis of pulmonary hypertension including proliferation of pulmonary cells which can contribute to vascular remodeling (i.e., hyperplasia). For example, pulmonary vascular remodeling occurs primarily by proliferation of arterial endothelial cells and smooth muscle cells of patients with pulmonary hypertension. Overexpression of various cytokines is believed to promote pulmonary hypertension.
[0195] Further, it has been found that pulmonary hypertension may rise from the hyperproliferation of pulmonary arterial smooth cells and pulmonary endothelial cells. Still further, advanced PAH may be characterized by muscularization of distal pulmonary arterioles, concentric intimal thickening, and obstruction of the vascular lumen by proliferating endothelial cells. Pietra et al., J. Am. Coll. Cardiol., 43:255-325 (2004).
[0196] PAH can be diagnosed based on a mean pulmonary artery pressure of above 25 mmHg (or above 20 mmHg under updated guidelines) at rest, with a normal pulmonary artery capillary wedge pressure. PAH can lead to shortness of breath, dizziness, fainting, and other symptoms, all of which are exacerbated by exertion. PAH can be a severe disease with a markedly decreased exercise tolerance and heart failure. Two major types of PAH include idiopathic PAH (e.g., PAH in which no predisposing factor is identified) and heritable PAH (e.g., PAH associated with a mutation in BMPR2, ALK1, ENG, SMAD9, CAV1, KCNK3, or EIF2AK4). In 70% of familial PAH cases, mutations are located in the BMPR2 gene. Risk factors for the development of PAH include family history of PAH, drug and toxin use (e.g., methamphetamine or cocaine use), infection (e.g., HIV infection or schistosomiasis), cirrhosis of the liver, congenital heart abnormalities, portal hypertension, pulmonary veno-occlusive disease, pulmonary capillary hemangiomatosis, or connective tissue / autoimmune disorders (e.g., scleroderma or lupus). PAH may be associated with long term responders to calcium channel blockers, overt features of venous / capillaries (PVOD / PCH) involvement, and persistent PH of the newborn syndrome.
[0197] Group 2 PH
[0198] Pulmonary hypertension due to left heart disease (PH-LHD) (WHO Group 2 PH) is a complex pathophenotype that, when present, may result in an increased susceptibility to adverse events and worse clinical outcome. PH-LHD is sometimes defined as patients having a pulmonary capillary wedge pressure (PCWP) >15 mmHg and a mean pulmonary artery pressure (mPAP) >25 mmHg (or a mean pulmonary artery pressure (mPAP) >20 mmHg under updated guidelines). PH-LHD occurs as a consequence of the backward transmission of high left sided filling pressures, mainly driven by LV diastolic function, directly to the post-capillary pulmonary vessels and, thereby, to the rest of the pulmonary circulation. PH-LHD may be associated with or caused by PH due to heart failure with preserved left ventricle ejection fraction (LVEF) [also known as HFpEF], PH due to heart failure with reduced LVEF (also known as HFrEF), valvular heart disease (VHD), or congenital / acquired cardiovascular conditions leading to post-capillary PH. Compared with PAH, patients with PH-LHD are often older, female, with a higher prevalence of cardiovascular co-morbidities and most, if not all, of the features of metabolic syndrome.
[0199] Valvular heart disease (VHD) associated with pulmonary hypertension may result from multiple mechanisms such as an increase in PVR, pulmonary blood flow, or pulmonary venous pressure. The chronic rise in PAP frequently leads to RV pressure overload and subsequent RV failure. Clinical signs and symptoms of left-sided VHD with PH are orthopnea and paroxysmal nocturnal dyspnea. In advanced stages of diseases, signs of RV failure including peripheral edema, ascites, and syncope are frequently observed. There are four valvular heart disease subtypes which include mitral valve stenosis, mitral valve regurgitation, aortic stenosis, and aortic regurgitation.
[0200] Mitral valve stenosis occurs when the heart's mitral valve is narrowed due to the valve becoming stiff or scarred, or the valve flaps partially joining together. This results in the valve not opening as widely as it should, which causes poor blood flow and may result in blood backing up into the lungs. Left untreated, mitral valve stenosis can lead to serious heart complications. Common causes of mitral valve stenosis include rheumatic heart disease, radiation, and mitral annulus calcification. Typical interventions for mitral stenosis include balloon vavuloplasty, commisurrotomy, and surgical valve replacement.
[0201] Mitral valve regurgitation (also called mitral insufficiency) occurs when the flaps (leaflets) of the mitral valve do not close tightly, allowing blood to flow backward in the heart. As a result, blood can't move through the heart or to the rest of the body as efficiently, resulting in fatigue or shortness of breath. Additionally, the reduced flow increases pressure in the left atrium and lung vasculature. In moderate to severe cases, surgery may be recommended to either repair or replace the damaged valve. Left untreated, severe mitral valve regurgitation can cause heart failure or serious heart rhythm problems. Common causes of mitral valve regurgitation include degenerative mitral disease such as mitral valve prolapse and mitral annulus calcification. Typical interventions for mitral valve regurgitation include transcatheter mitral valve repair, surgical repair, or replacement.
[0202] In aortic stenosis, the aortic valve does not open fully. This decreases blood flow from the heart. As the aortic valve becomes more narrow, the pressure increases inside the left heart ventricle. This causes the left heart ventricle to become thicker, which decreases blood flow and can lead to chest pain. As the pressure continues to rise, blood may back up into the lungs causing dyspnea. Severe forms of aortic stenosis prevent enough blood from reaching the brain and rest of the body. Common causes of aortic stenosis include calcification of the aortic valve or the presence of a bicuspid aortic valve. Typical interventions include transcatheter aortic valve replacement (percutaneous valve replacement) and surgical valve replacement.
[0203] Aortic regurgitation (also known as aortic insufficiency) occurs when the aortic valve is unable to fully close. The valve leaks, resulting in reduced blood flow. As a result, the heart has to work harder to make up for the reduced blood flow, and over time it will weaken. Because of this, the amount of blood that flows from the heart to the rest of the body is reduced. Common causes of aortic regurgitation include aortic root dilatation and presence of a bicuspid aortic valve.
[0204] Among those patients with PH-LHD, two phenotypes have been described: 1) a group of isolated post-capillary (IpcPH) or “passive” PH in which elevated pulmonary pressures are reversible and in proportion to increases in left atrial pressure, and 2) a group with an added “pre-capillary” component [combined post-capillary and pre-capillary PH (CpcPH)]. This latter group, CpcPH, may have comorbid pulmonary vascular remodeling and therefore may demonstrate persistent PH after interventions to lower left sided filling pressures.
[0205] In some embodiments, a combination of mPAP, PAWP, PVR, or DPG may be used to define the different subtypes of PH-LHD, i.e., IpcPH and CpcPH (see. e.g.. Table 2). In some embodiments, patients with CpcPH are characterized as having a TPG >12-15 mmHg and a PVR >2.5-3 Wood units (WU). In some embodiments, CpcPH is distinguished from IpcPH using the DPG. In some embodiments, a patient with CpcPH has a DPG >7 mmHg. In some embodiments, a patient with IpcPH has a DPG <7 mmHg.
[0206] In some embodiments, a combination of DPG and PVR may be used to define the different types of PH-LHD. For instance, in some embodiments, IpcPH patients have a DPG <7 mmHg and / or a PVR of <3 WU. In some embodiments, CpcPH patients have a DPG >7 mmHg and / or a PVR >3 WU.
[0207] The clinical classification or hematological classification described herein and the associated diagnostic parameters may be updated when new data are available or when additional clinical entities are considered. For instance, at the 5thWorld Symposium on Pulmonary Hypertension (WSPH), a new terminology was adopted to distinguish IpcPH from CpcPH, based on the diastolic pressure difference / gradient (DPG) between the dPAP and PAWP. However, this definition was found to be too restrictive and exposed to interpretation, leading to controversies about whether the DPG would or would not predict outcome in patients with group 2 PH. Accordingly, at the 6thWSPH, pulmonary vascular resistance (PVR) was subsequently reintroduced to better reflect the impact of the right ventricle on patient outcome. See, e.g., Vachiery J.L., et al. Eur Respir J 2019 Jan 24;53(1).
[0208] Therapies for treating PH-LHD primarily include treatment of the underlying condition (i.e.. COPD, sleep apnea syndrome, CTEPH) prior to considering specific measures to treat the PH itself. Some therapies include repair of valvular heart disease (if indicated). Non-specific vasodilators such as nitrates and hydralazine may also be used. In some embodiments, an LV assist device (LVAD) may be used to lower pulmonary pressure. The lack of specific therapies is particularly problematic because PH-LHD is the most common cause of PH in western countries and its presence commonly results in adverse course of the disease. Specifically, the presence of PH-LHD can result in more severe symptoms in LHD, worse exercise tolerance, and a negative impact on outcome.
[0209] Group 3 PH
[0210] Pulmonary hypertension due to lung disease and / or hypoxia (WHO Group 3 PH) refers to a form of pulmonary hypertension that is due to lung disease or chronic hypoxia. This form of PH is also known as “hypoxic PH” or “hypoxic pulmonary hypertension.” Hypoxic PH may be associated with or caused by chronic obstructive pulmonary disease (e.g., emphysema), interstitial lung disease, sleep-disordered breathing (e.g., sleep apnea), lung disease (e.g., pulmonary fibrosis), alveolar hypoventilation disorders, chronic exposure to high altitude, or developmental abnormalities.
[0211] Group 4 PH
[0212] Pulmonary hypertension due to pulmonary artery obstructions (WHO Group 4 PH) is a form of pulmonary hypertension that is related to chronic arterial obstruction (e.g. , blood clots). There may be multiple pathophysiological mechanisms driving development of PH in Group 4 including chronic thromboembolic PH, sarcoma (high or intermediate grade) or angiosarcoma, other malignant tumors (e.g. , renal carcinoma, uterine carcinoma, germ cell tumors of the testis, or other tumors), non-malignant tumors (e.g. , uterine leiomyoma), arteritis without connective tissue disease, congenital pulmonary artery stenosis, or parasites (e.g., hydatidosis).
[0213] Various pulmonary hemodynamic parameters are associated with Group 4 PH. For instance, in patients with PH due to pulmonary artery obstructions, those with severe PH (>40 mmHg) often have a marked increase in PVR (around 10 WU); more often these patients may have a mild PH (mPAP 20-30 mmHg), associated with lower PVR but remaining generally >3 WU. See, e.g., Simonneau (2019) Eur Respir J: 53: 1801913. In these different chronic lung diseases, even a modest elevation in mPAP (20-29 mmHg) can be associated with a poor prognosis. Furthermore, in chronic thromboembolism, patients may have severe pre-capillary PH with a mPAP of about 47 mmHg and a mean PVR of about 8.9 WU. Id. In this setting, even in patients with mild elevation of mPAP (20-24 mmHg), PVR is generally >3 WU. Group 5 PH
[0214] Pulmonary hypertension with unclear and / or multifactorial mechanisms (WHO Group 5 PH) is a group which contains less-studied forms of PH in comparison with the other groups. However, many of the PH forms currently in group 5 represent a significant part of the PH burden. The diseases within Group 5 PH are characterized by having no identified predominant mechanism driving the development of PH. There may be multiple pathophysiological mechanisms driving development of PH, including hematological disorders (e.g., chronic hemolytic anemia or myeloproliferative disorders), systemic and metabolic disorders (e.g., Pulmonary Langerhans cell histiocytosis, Gaucher disease, glycogen storage disease, neurofibromatosis, or sarcoidosis), others (e.g., chronic renal failure with or without hemodialysis or fibrosing mediastinitis), or complex congenital heart disease.
[0215] Measurements of PH
[0216] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of post-capillary pulmonary hypertension in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to treating PcPH patients that have IpcPH. In some embodiments, the method relates to treating PcPH patients that have CpcPH. In some embodiments, the method relates to treating PcPH patients that have pulmonary hypertension due to left heart disease (PH-LHD). In some embodiments, the method relates to treating PcPH patients that have Group 2 PH as classified by the WHO. In some embodiments, the method relates to treating PcPH patients that have pulmonary hypertension due to heart failure with preserved LVEF (HFpEF). In some embodiments, the method relates to treating PcPH patients that have pulmonary hypertension due to heart failure with reduced FVEF (HFrEF). In some embodiments, the method relates to treating PcPH patients that have valvular heart disease. In some embodiments, the valvular heart disease is aortic regurgitation. In some embodiments, the valvular heart disease is aortic stenosis. In some embodiments, the valvular heart disease is mitral valve disease. In some embodiments, the valvular heart disease is mitral valve regurgitation. In some embodiments, the valvular heart disease is mitral valve stenosis. In some embodiments, the method relates to treating CpcPH patients who have PH due to valvular heart disease. In some embodiments, the method relates to treating IpcPH patients who have PH due to valvular heart disease. In some embodiments, the method relates to treating PcPH patients that have congenital / acquired cardiovascular conditions leading to post-capillary PH. In some embodiments, the method relates to treating PcPH patients that have pulmonary hypertension with unclear and / or multifactorial mechanisms. In some embodiments, the method relates to treating PcPH patients that have Group 5 PH as classified by the WHO.
[0217] In some embodiments, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of pulmonary hypertension in combinations of certain patient populations. Each of the patient populations described herein can be combined and reorganized accordingly. For instance, in some embodiments, the method relates to treating CpcPH patients who have PH due to heart failure with preserved LVEF (HFpEF). In some embodiments, the method relates to treating CpcPH patients who have PH due to heart failure with reduced LVEF (HFrEF). In some embodiments, the method relates to treating CpcPH patients who have PH due to valvular heart disease. In some embodiments, the method relates to treating IpcPH patients who have PH due to heart failure with preserved LVEF (HFpEF). In some embodiments, the method relates to treating IpcPH patients who have PH due to heart failure with reduced LVEF (HFrEF). In some embodiments, the method relates to treating IpcPH patients who have PH due to valvular heart disease.
[0218] In some embodiments, the method relates to pulmonary hypertension patients that have pulmonary hypertension with unclear and / or multifactorial mechanisms. In some embodiments, the method relates to patients that have a hematological disorder (e.g., chronic hemolytic anemia and myeloproliferative disorders). In some embodiments, the method relates to patients that have a systemic and / or metabolic disorder (e.g., pulmonary langerhans cell histiocytosis, Gaucher disease, glycogen storage disease, neurofibromatosis, and sarcoidosis). In some embodiments, the method relates to pulmonary hypertension patients that have other disorders with unclear and / or multifactorial mechanisms (e.g., chronic renal failure with or without hemodialysis or fibrosing mediastinitis). In some embodiments, the method relates to patients that have complex congenital heart disease. mPAP
[0219] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has resting mean pulmonary arterial pressure (mPAP) of at least 20 mmHg (e.g., 20, 25, 30, 35, 40, 45, or 50 mmHg). As used herein, the terms “mean pulmonary arterial pressure” and mean pulmonary artery pressure are used interchangeably. In some embodiments, the method relates to patients having a resting mPAP of at least 20 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 25 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 30 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 35 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 40 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 45 mmHg. In some embodiments, the method relates to patients having a resting mPAP of at least 50 mmHg.
[0220] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving the pulmonary arterial pressure in the patient. In some embodiments, the improvement in pulmonary arterial pressure is a reduction in the mean pulmonary arterial pressure (mPAP). In some embodiments, the method relates to reducing mPAP. In some embodiments, the method relates to reducing the patient’s mPAP by at least 1 mmHg. In some embodiments, the method relates to reducing the patient’s mPAP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s mPAP by at least 3 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 5 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 7 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 10 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 12 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 15 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 20 mmHg. In certain embodiments, the method relates to reducing the patient’s mPAP by at least 25 mmHg.
[0221] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s mPAP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s mPAP by at least 1%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least 5%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least 10%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0222] 15%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0223] 20%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0224] 25%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0225] 30%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0226] 35%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0227] 40%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0228] 45%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0229] 50%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0230] 55%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0231] 60%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0232] 65%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0233] 70%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0234] 75%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0235] 80%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0236] 85%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0237] 90%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0238] 95%. In some embodiments, the method relates to decreasing the patient’s mPAP by at least
[0239] 100%. m RAP
[0240] In some patients, increased pulmonary vascular resistance to blood flow leads to increased right atrial pressure (RAP) and right heart failure. Patients with right heart failure typically have an increased ratio of RAP and pulmonary artery wedge pressure (PAWP). In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g. , treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has resting mean right atrial pressure (mRAP) of at least 5 mmHg (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 18, 20, 21, 22, 23, 24, or 25 mmHg). In some embodiments, the method relates to a patient having a resting mRAP of at least 5 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 6 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 7 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 8 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 9 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 10 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 11 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 12 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 13 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 14 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 15 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 16 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 17 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 18 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 19 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 20 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 21 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 22 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 23 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 24 mmHg. In some embodiments, the method relates to a patient having a resting mRAP of at least 25 mmHg.
[0241] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving the mean right atrial pressure in the patient. In some embodiments, the improvement in the mean right atrial pressure (mRAP) is a reduction in the mRAP. In some embodiments, the method relates to reducing mRAP. In some embodiments, the method relates to reducing the patient’s mRAP by at least 1 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 3 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 4 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 5 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 6 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 7 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 8 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 9 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 10 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 11 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 12 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 13 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 14 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 15 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 16 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 17 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 18 mmHg. In some embodiments, the method relates to reducing the patient’s mRAP by at least 19 mmHg. In certain embodiments, the method relates to reducing the patient’s mRAP by at least 20 mmHg.
[0242] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s mRAP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s mRAP by at least 1%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least 5%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least 10%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0243] 15%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0244] 20%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0245] 25%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0246] 30%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0247] 35%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0248] 40%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0249] 45%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0250] 50%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0251] 55%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0252] 60%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0253] 65%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0254] 70%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0255] 75%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0256] 80%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0257] 85%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0258] 90%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0259] 95%. In some embodiments, the method relates to decreasing the patient’s mRAP by at least
[0260] 100%.
[0261] PVR
[0262] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a pulmonary vascular resistance (PVR) of at least 2.5 Woods Units (e.g., 2.5, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, or 20 Woods Units). In some embodiments, the method relates to patients having a PVR of at least 2.5 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 3 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 4 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 5 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 6 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 7 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 8 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 9 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 10 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 12 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 14 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 16 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 18 Woods Units. In some embodiments, the method relates to patients having a PVR of at least 20 Woods Units.
[0263] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s PVR. In some embodiments, the reduction in the patient’s PVR is a result of a decrease in the patient’s mean pulmonary arterial pressure (mPAP). In some embodiments, the method relates to reducing the patient’s PVR by at least 0.5 Wood Units. In some embodiments, the method relates to reducing the patient’s PVR by at least 1 Wood Units. In some embodiments, the method relates to reducing the patient’ s PVR by at least 2 Wood Units . In some embodiments, the method relates to reducing the patient’s PVR by at least 4 Wood Units. In some embodiments, the method relates to reducing the patient’s PVR by at least 6 Wood Units. In some embodiments, the method relates to reducing the patient’s PVR by at least 8 Wood Units. In some embodiments, the method relates to reducing the patient’s PVR by at least 10 Wood Units.
[0264] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s PVR. In some embodiments, the reduction in the patient’s PVR is a result of a decrease in the patient’s mean pulmonary arterial pressure (mPAP). In some embodiments, the method relates to decreasing the patient’s PVR by least 1% (e.g., 1%, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s PVR by at least 1%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 5%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 10%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 15%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 20%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 25%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 30%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 35%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 40%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 45%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 50%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 55%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 60%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 65%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 70%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 75%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 80%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 85%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 90%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 95%. In some embodiments, the method relates to decreasing the patient’s PVR by at least 100%.
[0265] PAWP
[0266] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has pulmonary arterial wedge pressure (PAWP) of at least 12 mmHg (e.g, 12, 15, 20, 25, 30, 35, 40, 45, or 50 mmHg). In some embodiments, the method relates to patients having a PAWP of at least 15 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 20 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 25 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 30 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 35 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 40 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 45 mmHg. In some embodiments, the method relates to patients having a PAWP of at least 50 mmHg. In some embodiments, the method relates to patients having a PCWP between 15 to 30 mmHg.
[0267] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s PAWP by at least 1 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 4 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 6 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 10 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 15 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 20 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 25 mmHg. In some embodiments, the method relates to reducing the patient’s PAWP by at least 30 mmHg.
[0268] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s PAWP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s PAWP by at least 1%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least 5%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least 10%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0269] 15%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0270] 20%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0271] 25%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0272] 30%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0273] 35%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0274] 40%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0275] 45%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0276] 50%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0277] 55%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0278] 60%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0279] 65%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0280] 70%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0281] 75%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0282] 80%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0283] 85%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0284] 90%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0285] 95%. In some embodiments, the method relates to decreasing the patient’s PAWP by at least
[0286] 100%.
[0287] LVEDP
[0288] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has left ventricular end diastolic pressure (LVEDP) of at least 12 mmHg (e.g., 12, 15, 20, 25, 30, 35, 40, 45, or 50 mmHg). In some embodiments, the method relates to patients having a LVEDP of at least 15 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 20 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 25 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 30 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 35 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 40 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 45 mmHg. In some embodiments, the method relates to patients having a LVEDP of at least 50 mmHg.
[0289] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s LVEDP by at least 1 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 4 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 6 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 10 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 15 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 20 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 25 mmHg. In some embodiments, the method relates to reducing the patient’s LVEDP by at least 30 mmHg.
[0290] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s LVEDP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 1%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 5%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 10%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 15%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 20%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 25%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 30%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 35%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 40%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 45%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 50%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 55%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 60%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 65%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 70%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 75%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 80%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 85%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 90%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 95%. In some embodiments, the method relates to decreasing the patient’s LVEDP by at least 100%.
[0291] DPG
[0292] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has resting diastolic pressure gradient (DPG) of at least 5 mmHg (e.g., 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, or 45 mmHg). In some embodiments, the method relates to patients having a DPG of at least 5 mmHg. In some embodiments, the method relates to patients having a DPG of at least 6 mmHg. In some embodiments, the method relates to patients having a DPG of at least 7 mmHg. In some embodiments, the method relates to patients having a DPG of at least 8 mmHg. In some embodiments, the method relates to patients having a DPG of at least 9 mmHg. In some embodiments, the method relates to patients having a DPG of at least 10 mmHg. In some embodiments, the method relates to patients having a DPG of at least 15 mmHg. In some embodiments, the method relates to patients having a DPG of at least 20 mmHg. In some embodiments, the method relates to patients having a DPG of at least 25 mmHg. In some embodiments, the method relates to patients having a DPG of at least 30 mmHg. In some embodiments, the method relates to patients having a DPG of at least 35 mmHg. In some embodiments, the method relates to patients having a DPG of at least 40 mmHg. In some embodiments, the method relates to patients having a DPG of at least 45 mmHg.
[0293] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s DPG by at least
[0294] 1 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least
[0295] 2 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least
[0296] 4 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least
[0297] 6 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least
[0298] 10 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least 15 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least 20 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least 25 mmHg. In some embodiments, the method relates to reducing the patient’s DPG by at least 30 mmHg.
[0299] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s DPG by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s DPG by at least 1%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 5%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 10%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 15%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 20%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 25%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 30%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 35%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 40%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 45%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 50%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 55%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 60%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 65%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 70%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 75%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 80%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 85%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 90%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 95%. In some embodiments, the method relates to decreasing the patient’s DPG by at least 100%.
[0300] TPG
[0301] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a transpulmonary gradient (TPG) of at least 10 mmHg (e.g., 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, or 50 mmHg). In some embodiments, the method relates to patients having a TPG of at least 10 mmHg. In some embodiments, the method relates to patients having a TPG of at least 11 mmHg. In some embodiments, the method relates to patients having a TPG of at least 12 mmHg. In some embodiments, the method relates to patients having a TPG of at least 13 mmHg. In some embodiments, the method relates to patients having a TPG of at least 14 mmHg. In some embodiments, the method relates to patients having a TPG of at least 15 mmHg. In some embodiments, the method relates to patients having a TPG of at least 20 mmHg. In some embodiments, the method relates to patients having a TPG of at least 25 mmHg. In some embodiments, the method relates to patients having a TPG of at least 30 mmHg. In some embodiments, the method relates to patients having a TPG of at least 35 mmHg. In some embodiments, the method relates to patients having a TPG of at least 40 mmHg. In some embodiments, the method relates to patients having a TPG of at least 45 mmHg. In some embodiments, the method relates to patients having a TPG of at least 50 mmHg.
[0302] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s TPG by at least
[0303] 1 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least
[0304] 2 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 4 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 6 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 10 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 15 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 20 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 25 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 30 mmHg. In some embodiments, the method relates to reducing the patient’s TPG by at least 40 mmHg.
[0305] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s TPG by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s TPG by at least 1%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 5%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 10%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 15%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 20%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 25%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 30%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 35%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 40%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 45%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 50%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 55%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 60%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 65%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 70%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 75%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 80%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 85%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 90%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 95%. In some embodiments, the method relates to decreasing the patient’s TPG by at least 100%.
[0306] BNP
[0307] Both BNP and NT-proBNP are markers of atrial and ventricular distension due to increased intracardiac pressure. The New York Heart Association (NYHA) developed a 4-stage functional classification system for congestive heart failure (CHF) based on the severity of symptoms. Studies have demonstrated that the measured concentrations of circulating BNP and NT-proBNP increase with the severity of CHF based on the NYHA classification. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g. , treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a brain natriuretic peptide (BNP) level of at least 100 pg / mL (e.g., 100, 150, 200, 300, 400, 500, 600, 700, 800, 900 1000, 3000, 5000, 10,000, 15,000, or 20,000 pg / mL). In some embodiments, the method relates to patient’s having a BNP level of at least 100 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 150 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 200 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 300 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 400 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 500 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 600 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 700 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 800 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 900 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 1000 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 5000 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 10,000 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 15,000 pg / mL. In some embodiments, the method relates to patient’s having a BNP level of at least 20,000 pg / mL. In some embodiments, the method relates to treatment of a patient who has elevated BNP levels as compared to a healthy patient.
[0308] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s BNP levels by at least 10 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 50 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 100 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 200 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 300 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 400 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 500 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 600 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 700 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 800 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 900 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 1000 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels by at least 5000 pg / mL. In some embodiments, the method relates to reducing the patient’s BNP levels to normal levels. In some embodiments, normal levels correspond to levels of <100 pg / mL.
[0309] In some embodiments, the method relates to reducing the patient’s BNP by at least 5% (e.g., 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to reducing the patient’s BNP by at least 5%. In some embodiments, the method relates to reducing the patient’s BNP by at least 10%. In some embodiments, the method relates to reducing the patient’s BNP by at least 15%. In some embodiments, the method relates to reducing the patient’s BNP by at least 20%. In some embodiments, the method relates to reducing the patient’s BNP by at least 25%. In some embodiments, the method relates to reducing the patient’s BNP by at least 30%. In some embodiments, the method relates to reducing the patient’s BNP by at least 35%. In some embodiments, the method relates to reducing the patient’s BNP by at least 40%. In some embodiments, the method relates to reducing the patient’s BNP by at least 45%. In some embodiments, the method relates to reducing the patient’s BNP by at least 50%. In some embodiments, the method relates to reducing the patient’s BNP by at least 55%. In some embodiments, the method relates to reducing the patient’s BNP by at least 60%. In some embodiments, the method relates to reducing the patient’s BNP by at least 65%. In some embodiments, the method relates to reducing the patient’s BNP by at least 70%. In some embodiments, the method relates to reducing the patient’s BNP by at least 75%. In some embodiments, the method relates to reducing the patient’s BNP by at least 80%. In some embodiments, the method relates to reducing the patient’s BNP by at least 85%. In some embodiments, the method relates to reducing the patient’s BNP by at least 90%. In some embodiments, the method relates to reducing the patient’s BNP by at least 95%. In some embodiments, the method relates to reducing the patient’s BNP by at least 100%.
[0310] NT-proBNP
[0311] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a NT- proBNP level of at least 100 pg / mL (e.g, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 3000, 5000, 10,000, 15,000, 20,000, 25,000, or 30,000 pg / mL). In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 100 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 150 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 200 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 300 pg / mL. In some embodiments, the method relates to patient’s having a NT- proBNP level of at least 400 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 500 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 600 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 700 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 800 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 900 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 1000 pg / mL. In some embodiments, the method relates to patient’s having a NT- proBNP level of at least 5000 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 10,000 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 15,000 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 20,000 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 25,000 pg / mL. In some embodiments, the method relates to patient’s having a NT-proBNP level of at least 30,000 pg / mL. In some embodiments, the method relates to treatment of a patient who has elevated NT-proBNP levels as compared to a healthy patient.
[0312] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s NT-proBNP levels. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 10 pg / mL. In some embodiments, the method relates to reducing the patient’s NT- proBNP by at least 50 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 100 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 200 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 300 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 400 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 500 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 600 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 700 pg / mL. In some embodiments, the method relates to reducing the patient’s NT- proBNP by at least 800 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 900 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 1000 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 5000 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 10,000 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 15,000 pg / mL. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 20,000 pg / mL. In some embodiments, the method relates to reducing the patient’s NT- proBNP by at least 25,000 pg / mL.
[0313] In some embodiments, the method relates to decreasing the patient’s NT-proBNP levels to a normal level and maintaining their normal NT-proBNP levels. In some embodiments, the disclosure relates to methods of maintaining one or more hemodynamic parameters in the PcPH patient at a normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to maintaining the patient’s NT-proBNP levels at a normal level. In some embodiments, the method relates to maintaining the patient’s NT-proBNP level at less than 100 pg / mL. In some embodiments, the method relates to maintaining the patient’s NT-proBNP level at less than 200 pg / mL. In some embodiments, the method relates to maintaining the patient’s NT-proBNP level at less than 300 pg / mL. In some embodiments, the method relates to maintaining the patient’s NT-proBNP level at less than 400 pg / mL.
[0314] In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 5% (e.g., 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 5%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 10%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 15%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 20%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 25%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 30%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 35%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 40%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 45%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 50%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 55%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 60%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 65%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 70%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 75%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 80%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 85%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 90%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 95%. In some embodiments, the method relates to reducing the patient’s NT-proBNP by at least 100%. In some embodiments, the method relates to reducing the patient’s NT-proBNP levels to normal levels. In some embodiments, normal levels of NT-proBNP is <100 pg / ml. In some embodiments, the method relates to reducing the patient’s NT-proBNP levels to less than 300 ng / L.
[0315] Smooth muscle hypertrophy
[0316] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has smooth muscle hypertrophy. In some embodiments, the disclosure relates to methods of adjusting one or more parameters in the PcPH patient toward a more normal level (e.g. , normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing smooth muscle hypertrophy in the patient. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 1%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 5%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 10%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 15%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 20%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 25%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 30%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 35%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 40%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 45%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 50%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 55%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 60%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 65%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 70%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 75%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 80%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 85%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 90%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 95%. In some embodiments, the method relates to decreasing the patient’s smooth muscle hypertrophy by at least 100%.
[0317] Pulmonary arteriole muscularity
[0318] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has increased pulmonary arteriole muscularity. In some embodiments, the disclosure relates to methods of adjusting one or more parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30- 110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing pulmonary arteriole muscularity in the patient. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 1%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 5%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 10%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 15%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 20%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 25%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 30%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 35%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 40%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 45%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 50%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 55%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 60%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 65%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 70%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 75%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 80%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 85%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 90%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 95%. In some embodiments, the method relates to decreasing the patient’s pulmonary arteriole muscularity by at least 100%.
[0319] Rate of hospitalization
[0320] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the method reduces the patient’s hospitalization rate by at least 1% (e.g., 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 1%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 2%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 3%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 4%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 5%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 10%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 15%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 20%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 25%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 30%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 35%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 40%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 45%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 50%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 55%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 60%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 65%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 70%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 75%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 80%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 85%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 90%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 95%. In some embodiments, the method relates to reducing the patient’s hospitalization rate by at least 100%. In some embodiments, the method reduces the risk of hospitalization for one or more complications associated with PcPH.
[0321] Quality of Life
[0322] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the method increases the patient’s quality of life by at least 1% (e.g., 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%). In some embodiments, the method relates to increasing the patient’s quality of life by at least 1%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 2%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 3%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 4%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 5%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 10%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 15%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 20%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 25%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 30%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 35%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 40%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 45%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 50%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 55%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 60%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 65%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 70%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 75%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 80%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 85%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 90%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 95%. In some embodiments, the method relates to increasing the patient’s quality of life by at least 100%.
[0323] In some embodiments, the patient’s quality of life is measured using the Cambridge Pulmonary Hypertension Outcome Review (CAMPHOR). In some embodiments, the patient’s quality of life is measured using PAH-SYMPACT®. In some embodiments, the patient’s quality of life is measured using the Medical Outcomes Survey Short Form-36 (SF-36). In some embodiments, the patient’s quality of life is measured using the Euro Quality of Life (EuroQol). In some embodiments, the patient’s quality of life is measured using the Euro Quality of Life - 5 dimensions (EQ-5D). In some embodiments, the patient’s quality of life is measured using the Euro Quality of Life - 5 dimensions 5-levels (EQ-5D-5L). In some embodiments, the patient’s quality of life is measured using the Kansas City Cardiomyopathy Questionnaire (KCCQ).
[0324] Diastolic function
[0325] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the method increases the patient’s LV diastolic function by at least 5% (e.g., 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 5%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 10%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 15%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 20%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 25%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 30%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 35%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 40%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 45%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 50%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 55%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 60%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 65%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 70%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 75%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 80%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 85%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 90%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 95%. In some embodiments, the method relates to increasing the patient’s LV diastolic function by at least 100%.
[0326] Ejection Fraction
[0327] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has an ejection fraction of less than 10% (e.g., 10, 15, 20, 25, 30, 35, 40, or 45%). In some embodiments, the method relates to patient’s having an ejection fraction of less than 10%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 15%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 20%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 25%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 30%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 35%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 40%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 45%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 50%. In some embodiments, the method relates to patient’s having an ejection fraction of less than 55%.
[0328] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has an ejection fraction of at least 35% (e.g., 35, 40, 45, 50, or 55%). In some embodiments, the method relates to patient’s having an ejection fraction of at least 35%. In some embodiments, the method relates to patient’s having an ejection fraction of at least 40%. In some embodiments, the method relates to patient’s having an ejection fraction of at least 45%. In some embodiments, the method relates to patient’s having an ejection fraction of at least 50%. In some embodiments, the method relates to patient’s having an ejection fraction of at least 55%. In some embodiments, the ejection fraction is the right ventricular ejection fraction. In some embodiments, the ejection fraction is the left ventricular ejection fraction (LVEF). In some embodiments, the ejection fraction is measured using an echocardiogram. In some embodiments, the patient has a preserved left ventricular ejection fraction.
[0329] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g. , >50% ejection fraction), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to increasing the patient’s ejection fraction by least 1%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 5%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 10%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 15%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 20%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 25%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 30%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 35%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 40%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 45%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 50%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 55%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 60%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 65%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 70%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 75%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 80%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 85%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 90%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 95%. In some embodiments, the method relates to increasing the patient’s ejection fraction by at least 100%.
[0330] Ventricular function
[0331] In certain aspects, the disclosure relates to methods of improving or maintaining ventricular function (e.g., left ventricular function or right ventricular function) in PcPH comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). Echocardiography is a useful noninvasive screening tool for determining the severity of pulmonary hypertension in a patient. Improvement or maintenance of ventricular function (e.g., left ventricular function or right ventricular function) can be assessed by many echocardiographic measurements. One such quantitative approach to assess ventricular function is the measurement of the tricuspid annular plane systolic excursion (TAPSE). The TAPSE estimates RV systolic function by measuring the level of systolic excursion of the lateral tricuspid valve annulus towards the apex. Other echocardiographic measurements that may be used to assess maintenance and / or improvements in ventricular function include, but are not limited to, right ventricular fractional area change (RVFAC), right ventricular end-diastolic area (RVEDA), right ventricular end-systolic area (RVESA), right ventricular free wall thickness (RVFWT), right ventricular ejection fraction (RVEF), right ventricular- pulmonary artery (RV-PA) coupling, pulmonary arterial systolic pressure (PASP), right ventricular systolic pressure (RVSP), pulmonary artery acceleration time (PAAT), tricuspid regurgitation velocity (TRV), left ventricular hypertrophy, and right ventricular hypertrophy.
[0332] TAPSE
[0333] The tricuspid annular plane systolic excursion (TAPSE) can be obtained using echocardiography and represents a measure of RV longitudinal function. The TAPSE has previously been shown to have good correlations with parameters estimating RV global systolic function. A TAPSE <17 mm is highly suggestive of RV systolic dysfunction. In some embodiments, an improvement or maintenance of right ventricular function in a PcPH patient is measured as an increase in TAPSE. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE between 20mm - 28 mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 20mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 22 mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 24 mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 26 mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 28 mm. In some embodiments, the TAPSE is measured using echocardiography.
[0334] In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE between 16mm-30mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE between 18mm -28mm. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE of at least 18mm. In some embodiments, the TAPSE is measured using echocardiography.
[0335] PASP and RVSP
[0336] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a pulmonary arterial systolic pressure (PASP) of at least 30 mmHg ( e.g ., 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80 mmHg). In some embodiments, the method relates to patients having a PASP of at least 30 mmHg. In some embodiments, the method relates to patients having a PASP of at least 35 mmHg. In some embodiments, the method relates to patients having a PASP of at least 40 mmHg. In some embodiments, the method relates to patients having a PASP of at least 45 mmHg. In some embodiments, the method relates to patients having a PASP of at least 50 mmHg. In some embodiments, the method relates to patients having a PASP of at least 55 mmHg. In some embodiments, the method relates to patients having a PASP of at least 60 mmHg. In some embodiments, the method relates to patients having a PASP of at least 65 mmHg. In some embodiments, the method relates to patients having a PASP of at least 70 mmHg. In some embodiments, the method relates to patients having a PASP of at least 75 mmHg. In some embodiments, the method relates to patients having a PASP of at least 80 mmHg. In some embodiments, the
[0337] PASP is a resting PASP. In some embodiments, the PASP is determined using the tricuspid regurgitation velocity (TRV) and right arterial (RA) pressure. In some embodiments, the PASP is determined using the following formula:
[0338] PASP = TRV2x 4 + RA pressure
[0339] TRV has been shown to correlate with PASP at rest and with exercise. The pressure gradient between the right ventricle and the right atrium can be calculated using the modified Bernoulli equation (Ap = 4V2).
[0340] In some embodiments, the right ventricular systolic pressure (RVSP) is equal to PASP. In some embodiments, the RVSP is measured in the absence of right ventricular outflow tract obstruction. In some embodiments, the RVSP is determined using the following formula:
[0341] RVSP = 4 ^ + RAP
[0342] In the above formula, V represents the peak tricuspid regurgitant jet velocity and RAP is the mean right atrial pressure. RVSP is frequently used for estimating PASP.
[0343] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving the pulmonary arterial systolic pressure (PASP) in the patient. In some embodiments, the method relates to reducing PASP. In some embodiments, the method relates to reducing the patient’s PASP by at least 1 mmHg ( e.g ., 1, 2, 3, 5, 7, 10, 12, 15, 20, 25, 30, or 35 mmHg). In some embodiments, the method relates to reducing the patient’s PASP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s PASP by at least 3 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 5 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 7 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 10 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 12 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 15 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 20 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 25 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 30 mmHg. In certain embodiments, the method relates to reducing the patient’s PASP by at least 35 mmHg.
[0344] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s PASP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to reducing the patient’s PASP by at least 1%. In some embodiments, the method relates to reducing the patient’s PASP by at least 5%. In some embodiments, the method relates to reducing the patient’s PASP by at least 10%. In some embodiments, the method relates to reducing the patient’s PASP by at least 15%. In some embodiments, the method relates to reducing the patient’s PASP by at least 20%. In some embodiments, the method relates to reducing the patient’s PASP by at least 25%. In some embodiments, the method relates to reducing the patient’s PASP by at least 30%. In some embodiments, the method relates to reducing the patient’s PASP by at least 35%. In some embodiments, the method relates to reducing the patient’s PASP by at least 40%. In some embodiments, the method relates to reducing the patient’s PASP by at least 45%. In some embodiments, the method relates to reducing the patient’s PASP by at least 50%. In some embodiments, the method relates to reducing the patient’s PASP by at least 55%. In some embodiments, the method relates to reducing the patient’s PASP by at least 60%. In some embodiments, the method relates to reducing the patient’s PASP by at least 65%. In some embodiments, the method relates to reducing the patient’s PASP by at least 70%. In some embodiments, the method relates to reducing the patient’s PASP by at least 75%. In some embodiments, the method relates to reducing the patient’s PASP by at least 80%. In some embodiments, the method relates to reducing the patient’s PASP by at least 85%. In some embodiments, the method relates to reducing the patient’s PASP by at least 90%. In some embodiments, the method relates to reducing the patient’s PASP by at least 95%. In some embodiments, the method relates to reducing the patient’s PASP by at least 100%.
[0345] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving the right ventricular systolic pressure (RVSP) in the patient. In some embodiments, the method relates to reducing RVSP. In some embodiments, the method relates to reducing the patient’s RVSP by at least 1 mmHg (e.g., 1, 2, 3, 5, 7, 10, 12, 15, 20, 25, 30, or 35 mmHg). In some embodiments, the method relates to reducing the patient’s RVSP by at least 2 mmHg. In some embodiments, the method relates to reducing the patient’s RVSP by at least 3 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 5 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 7 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 10 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 12 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 15 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 20 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 25 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 30 mmHg. In certain embodiments, the method relates to reducing the patient’s RVSP by at least 35 mmHg. In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to reducing the patient’s RVSP by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to reducing the patient’s RVSP by at least 5%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 10%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 15%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 20%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 25%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 30%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 35%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 40%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 45%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 50%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 55%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 60%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 65%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 70%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 75%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 80%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 85%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 90%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 95%. In some embodiments, the method relates to reducing the patient’s RVSP by at least 100%.
[0346] RV-PA Coupling
[0347] Right ventricular dysfunction can occur in PcPH and is a factor affecting prognosis. Energy transfer between ventricle contractility and arterial afterload is termed coupling. Energy transfer specifically between the right ventricle (RV) and pulmonary artery is termed right ventricle-pulmonary artery (RV-PA) coupling. In some embodiments, right ventricular dysfunction is due to a decrease in RV-PA coupling. RV-PA coupling can be estimated non- invasive ly as a ratio of TAPSE / PASP values. In some embodiments, a TAPSE / PASP ratio of >0.31 mm / mm Hg may be associated with a better prognosis and reduced risk of clinical worsening. In some embodiments, the improvement in RV-PA coupling is due to an improvement in PASP. In some embodiments, the calculation of RV-PA coupling is dependent upon paired results for three parameters (e.g., TRV, RAP, and TAPSE).
[0348] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a TAPSE / PASP ratio less than 0.31 mm / mmHg (e.g. , 0.3, 0.25, 0.2, 0.15, or 0.1 mm / mmHg). In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.31 mm / mmHg. In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.3 mm / mmHg. In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.25 mm / mmHg. In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.2 mm / mmHg. In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.15 mm / mmHg. In some embodiments, the method relates to patients having a TAPSE / PASP ratio less than 0.1 mm / mmHg. In some embodiments, the method relates to patients having a decreased TAPSE / PASP ratio as compared to a normal TAPSE / PASP ratio.
[0349] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.3 mm / mmHg (e.g., greater than 0.31, 0.32, 0.33, 0.34, or 0.35 mm / mmHg). In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.31 mm / mmHg. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.32 mm / mmHg. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.33 mm / mmHg. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.34 mm / mmHg. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a TAPSE / PASP ratio greater than 0.35 mm / mmHg. In some embodiments, the improvement in right ventricular function is an increase in TAPSE / PASP ratio. In some embodiments, the method relates to increasing the TAPSE / PASP ratio. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.05 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.07 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.10 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.12 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.15 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.18 mm / mmHg. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 0.20 mm / mmHg.
[0350] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 5%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 10%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 15%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 20%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 25%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 30%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 35%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 40%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 45%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 50%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 55%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 60%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 65%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 70%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 75%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 80%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 85%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 90%. In some embodiments, the method relates to increasing the patient’s TAPSE / PASP ratio by at least 100%.
[0351] RYFAC. RYEDA and RYESA
[0352] Right ventricular fractional area change (RVFAC) is a non-invasive quantitative measure of right ventricular function. RVFAC can be calculated using the formula [(RVEDA- RVESA) / RVEDA]* 100. In some embodiments, the RVFAC is measured using echocardiography. In some embodiments, normal RVFAC is approximately 47.5 ± 8.6% in men and approximately 50.9 ± 8.0 % in women. See, e.g.. Kou S, et al. European Heart Journal - Cardiovascular Imaging. 2014 Jun l;15(6):680-90. In some embodiments, PcPH patients have a decrease in RVFAC.
[0353] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a RVFAC of less than 20% (e.g., 20, 25, 30, 35, or 40%). In some embodiments, the method relates to patients having a RVFAC of less than 25%. In some embodiments, the method relates to patients having a RVFAC of less than 30%. In some embodiments, the method relates to patients having a RVFAC of less than 35%. In some embodiments, the method relates to patients having a RVFAC of less than 40%.
[0354] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, the improvement or maintenance of right ventricular function is due to an increase in right ventricular fractional area change (RVFAC). In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC between 32 - 56%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 32%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 34%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 35%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 36%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 38%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 40%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 42%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 44%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 46%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 48%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 50%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 52%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 54%. In some embodiments, a PcPH patient with an improvement or maintenance of right ventricular function has a RVFAC of at least 56%.
[0355] In some embodiments, the disclosure relates to methods of adjusting one or more echocardiogram parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s RVEDA by least 1% (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, or 20 %). In some embodiments, the method relates to increasing the patient’s RVFAC by least 2%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 3%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 4%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 5%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 6%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 7%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 8%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 9%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 10%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 12%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 14%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 16%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 18%. In some embodiments, the method relates to increasing the patient’s RVFAC by least 20%.
[0356] In some embodiments, the improvement in right ventricular function is due to an increase in ejection fraction. In some embodiments, the improvement in right ventricular function is due to an increase in ejection fraction and an increase in the patient’s RVFAC.
[0357] The right ventricular end-diastolic area (RVEDA) can be measured using echocardiography. In some embodiments, normal RVEDA is approximately 18.2 ± 4.3 cm2in men and approximately 14.8 ± 3.5 cm2in women. See, e.g., Kou S, et al. European Heart Journal - Cardiovascular Imaging. 2014 Jun l;15(6):680-90.
[0358] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a RVEDA of at least 22 cm2(e.g., 22, 24, 26, 28, 30, 32, or 34 cm2). In some embodiments, the method relates to patients having a RVEDA of at least 24 cm2. In some embodiments, the method relates to patients having a RVEDA of at least 26 cm2. In some embodiments, the method relates to patients having a RVEDA of at least 28 cm2. In some embodiments, the method relates to patients having a RVEDA of at least 30 cm2. In some embodiments, the method relates to patients having a RVEDA of at least 32 cm2. In some embodiments, the method relates to patients having a RVEDA of at least 34 cm2. In some embodiments, the method relates to patients having increased RVEDA as compared to normal RVEDA.
[0359] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEDA of 14-22 cm2. In some embodiments, the improvement in right ventricular function is a reduction in RVEDA. In some embodiments, the method relates to reducing the RVEDA. In some embodiments, the method relates to reducing the patients RVEDA by at least 1 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 2 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 3 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 4 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 5 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 6 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 7 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 8 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 9 cm2. In some embodiments, the method relates to reducing the patients RVEDA by at least 10 cm2.
[0360] In some embodiments, the disclosure relates to methods of adjusting one or more echocardiogram parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s RVEDA by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, or 40%). In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 5%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 10%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 15%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 20%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 25%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 30%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 35%. In some embodiments, the method relates to decreasing the patient’s RVEDA by at least 40%.
[0361] The right ventricular end-systolic area (RVESA) can be measured using echocardiography. In some embodiments, normal RVESA is approximately 9.6 ± 2.8 cm2in men and approximately 7.3 ± 2.3 cm2in women. See, e.g.. Kou S, et al. European Heart Journal - Cardiovascular Imaging. 2014 Jun l;15(6):680-90.
[0362] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a RVESA of at least 12 cm2(e.g., 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, or 32 cm2). In some embodiments, the method relates to patients having a RVESA of at least 14 cm2. In some embodiments, the method relates to patients having a RVESA of at least 16 cm2. In some embodiments, the method relates to patients having a RVESA of at least 18 cm2. In some embodiments, the method relates to patients having a RVESA of at least 20 cm2. In some embodiments, the method relates to patients having a RVESA of at least 22 cm2. In some embodiments, the method relates to patients having a RVESA of at least 24 cm2. In some embodiments, the method relates to patients having a RVESA of at least 26 cm2. In some embodiments, the method relates to patients having a RVESA of at least 28 cm2. In some embodiments, the method relates to patients having a RVESA of at least 30 cm2. In some embodiments, the method relates to patients having a RVESA of at least 32 cm2. In some embodiments, the method relates to patients having increased RVESA as compared to normal RVESA.
[0363] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVESA of 7-20 cm2. In some embodiments, the improvement in right ventricular function is a reduction in RVESA. In some embodiments, the method relates to reducing the RVESA. In some embodiments, the method relates to reducing the patient’s RVESA by at least 1 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 2 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 3 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 4 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 5 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 6 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 7 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 8 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 9 cm2In some embodiments, the method relates to reducing the patient’s RVESA by at least 10 crri
[0364] In some embodiments, the disclosure relates to methods of adjusting one or more echocardiogram parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s RVESA by least 1% (e.g., 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, or 40%). In some embodiments, the method relates to decreasing the patient’s RVESA by at least 2%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 3%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 4%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 5%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 10%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 15%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 20%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 25%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 30%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 35%. In some embodiments, the method relates to decreasing the patient’s RVESA by at least 40%. RVFWT
[0365] In patients with pulmonary hypertension, the right ventricle dilates in response to increased PAP and right ventricular remodeling. As the disease progresses right ventricular hypertrophy develops, resulting in increased right ventricle free wall thickness. In some embodiments, the right ventricular free wall thickness (RVFWT) can be measured using echocardiography. In some embodiments, normal RVFWT is approximately 0.22 - 0.42 cm in women and approximately 0.24 - 0.42 cm in men. See, e.g. , Lang RM, J Am Soc Echocardiogr. 2015;28(1): l-39.el4.
[0366] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has a RVFWT of at least 0.42 cm (e.g., 0.42, 0.44, 0.46, 0.48, 0.50, 0.52, 0.54, 0.56, 0.58, or 0.60 cm). In some embodiments, the method relates to patients having a RVFWT of at least 0.44 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.46 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.48 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.50 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.52 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.54 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.56 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.58 cm. In some embodiments, the method relates to patients having a RVFWT of at least 0.60 cm. In some embodiments, the method relates to patients having increased RVFWT as compared to normal RVFWT.
[0367] In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVFWT of between 0.22 - 0.42 cm. In some embodiments, the improvement in right ventricular function is a reduction in RVFWT. In some embodiments, the method relates to reducing the RVFWT. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.05 cm (e.g., 0.05, 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, or 0.4 cm). In some embodiments, the method relates to reducing the patients RVFWT by at least 0.1 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.15 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.2 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.25 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.3 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.35 cm. In some embodiments, the method relates to reducing the patients RVFWT by at least 0.4 cm.
[0368] In some embodiments, the disclosure relates to methods of adjusting the RVFWT in the PcPH patient toward a more normal level (e.g. , normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s RVFWT by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, or 75%). In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 5%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 10%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 15%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 20%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 25%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 30%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 35%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 40%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 45%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 50%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 55%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 60%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 65%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 70%. In some embodiments, the method relates to decreasing the patient’s RVFWT by at least 75%.
[0369] RYEF
[0370] Right ventricular ejection fraction is a global measure of RV systolic performance. RVEF can be calculated using the RV end-diastolic volume (RVEDV) and RV end systolic volume (RVESV). Specifically, RVEF can be calculated using the following formula: RVEF (%) = ((RVEDV -RVESV) / RVEDV) * 100. Normal RVEF is approximately 56-65% in men and 60-71% in women. See, e.g., Lang RM, J Am Soc Echocardiogr. 2015;28(l):l-39.el4. In some embodiments, the RVEF is measured using echocardiography. In some embodiments, the disclosure relates to methods of adjusting one or more hemodynamic parameters in the PcPH patient toward a more normal level (e.g. , normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to improving or maintaining the right ventricular function in the patient. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of 45-71%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 45%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 50%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 55%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 60%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 65%. In some embodiments, a patient with an improvement or maintenance of right ventricular function has a RVEF of at least 70%.
[0371] In some embodiments, the disclosure relates to methods of adjusting one or more echocardiogram parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to increasing the patient’s RVEF by least 2%. In some embodiments, the method relates to increasing the patient’s RVEF by least 3%. In some embodiments, the method relates to increasing the patient’s RVEF by least 4%. In some embodiments, the method relates to increasing the patient’s RVEF by least 5%. In some embodiments, the method relates to increasing the patient’s RVEF by least 6%. In some embodiments, the method relates to increasing the patient’s RVEF by least 7%. In some embodiments, the method relates to increasing the patient’s RVEF by least 8%. In some embodiments, the method relates to increasing the patient’s RVEF by least 9%. In some embodiments, the method relates to increasing the patient’s RVEF by least 10%. In some embodiments, the method relates to increasing the patient’s RVEF by least 11%. In some embodiments, the method relates to increasing the patient’s RVEF by least 12%. In some embodiments, the method relates to increasing the patient’s RVEF by least 13%. In some embodiments, the method relates to increasing the patient’s RVEF by least 14%. In some embodiments, the method relates to increasing the patient’s RVEF by least 15%.
[0372] Right ventricular hypertrophy
[0373] In certain aspects, the improvement in right ventricular function is measured as a decrease in right ventricular hypertrophy. In some embodiment, the right ventricular hypertrophy is measured using the Fulton Index (RV / (FV+S)).
[0374] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has right ventricular hypertrophy. In some embodiments, the disclosure relates to methods of adjusting one or more parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the right ventricular hypertrophy is measured using the Fulton index (RV / (LV+S)). In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by least 1 % (e.g, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 1%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 5%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 10%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 15%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 20%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 25%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 30%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 35%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 40%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 45%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 50%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 55%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 60%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 65%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 70%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 75%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 80%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 85%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 90%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 95%. In some embodiments, the method relates to decreasing the patient’s right ventricular hypertrophy by at least 100%.
[0375] Left ventricular hypertrophy
[0376] In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the patient has left ventricular hypertrophy. In some embodiments, the disclosure relates to methods of adjusting one or more parameters in the PcPH patient toward a more normal level (e.g., normal as compared to healthy people of similar age and sex), comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1). In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by least 1% (e.g., 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 1 %. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 5%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 10%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 15%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 20%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 25%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 30%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 35%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 40%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 45%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 50%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 55%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 60%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 65%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 70%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 75%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 80%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 85%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 90%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 95%. In some embodiments, the method relates to decreasing the patient’s left ventricular hypertrophy by at least 100%. Cardiac Output
[0377] Cardiac output is the volume of blood the heart pumps per minute. Cardiac output is calculated by multiplying the stroke volume by the heart rate. In general, normal cardiac output at rest is about 4 to 8 L / min. The cardiac index is an assessment of the cardiac output value based on the patient’s size. To find the cardiac index, the cardiac output is divided by the person’s body surface area (BSA). The normal range for Cl is 2.5 to 4 L / min / m2. Cardiac output can decline by almost 40% without deviating from the normal limits. A low cardiac index of less than about 2.5 L / min / m2usually indicates a disturbance in cardiovascular performance. The cardiac output can be utilized to calculate the cardiac index (e.g., cardiac index= cardiac output / body surface area). The cardiac output can also be utilized to calculate the stroke volume (e.g., stroke volume = CO / heart rate). In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g. , treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30- 110 of SEQ ID NO: 1), wherein the method increases the patient’s cardiac output by at least 5% (e.g, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100%). In some embodiments, the method relates to increasing the patient’s cardiac output by at least 5%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 10%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 15%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 20%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 25%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 30%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 35%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 40%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 45%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 50%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 55%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 60%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 65%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 70%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 75%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 80%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 85%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 90%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 95%. In some embodiments, the method relates to increasing the patient’s cardiac output by at least 100%. In some embodiments, the method relates to increasing the patient’s cardiac index to at least 4.2 L / min / m2. In some embodiments, the cardiac index is measured at rest. In some embodiments, the method relates to increasing the patient’s cardiac output to at least 4 L / min. In some embodiments, the cardiac output is measured at rest. In some embodiments, the cardiac output is using a right heart catheter. In some embodiments, cardiac output is measured by thermodilution. In some embodiments, cardiac output is measured using the Fick method.
[0378] Progression of IpcPH to CpcPH
[0379] The predominant mechanism underlying PcPH (e.g., WHO Group 2 and / or Group 5 PH) is elevated left-side fdling pressure (i.e., left atrial pressure). Sustained elevations in left atrial pressure may cause passive pulmonary venous congestion with elevation of pulmonary pressures. In some patients, transmission of venous congestion to the pulmonary capillaries results in leakage and damage, ultimately leading to the creation of an obstructive vasculopathy such that higher pulmonary pressures are needed to sustain forward flow. This is sometimes referred to as the development of a “pre-capillary” component of PH. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g., treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g., an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the method reduces the development of a pre capillary component of PH by at least 1% (e.g., 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 1%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 2%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 3%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 4%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 5%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 10%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 15%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 20%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 25%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 30%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 35%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 40%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 45%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 50%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 55%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 60%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 65%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 70%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 75%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 80%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 85%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 90%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 95%. In some embodiments, the method relates to reducing the development of a pre-capillary component of PH in a patient by at least 100%. In some embodiments, sustained left atrial pressure in IpcPH has been shown to lead to the development of CpcPH. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and / or severity of PcPH (e.g. , treating, preventing, or reducing the progression rate and / or severity of one or more complications of PcPH in WHO Group 2 and / or Group 5 PH) comprising administering to a patient in need thereof an effective amount of an ActRII polypeptide (e.g. , an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1), wherein the method reduces the progression of IpcPH to CpcPH in a patient by at least 1% (e.g. , 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 1%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 2%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 3%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 4%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 5%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 10%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 15%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 20%. In some embodiments, the method relates to reducing the progression of IpcPH to CpcPH in a patient by at least 25%. In some embodiments, the me...
Claims
We Claim:
1. A method of treating post-capillary pulmonary hypertension (PcPH), comprising administering to a patient in need thereof an effective amount of a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO:
12. A method of treating, preventing, or reducing the progression rate and / or severity of one or more complications of post-capillary pulmonary hypertension, comprising administering to a patient in need thereof an effective amount of a polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO:
13. The method of claim 2, wherein the one or more complications of post-capillary pulmonary hypertension is selected from the group consisting of: smooth muscle and / or endothelial cell proliferation in the pulmonary artery, angiogenesis in the pulmonary artery, dyspnea, chest pain, pulmonary vascular remodeling, right ventricular hypertrophy, left ventricular hypertrophy, left atrium dilation, left ventricular fibrosis, right ventricular fibrosis, and pulmonary fibrosis.
4. The method of any one of claims 1-3, wherein the PcPH is isolated post-capillary pulmonary hypertension (IpcPH).
5. The method of any one of claims 1-3, wherein the PcPH is combined post- and pre capillary PH (CpcPH).
6. The method of any one of claims 1-5, wherein the patient has Group 2 pulmonary hypertension as recognized by the World Health Organization (WHO).
7. The method of any one of claims 1-6, wherein the patient has pulmonary hypertension due to heart failure with preserved left ventricular ejection fraction (LVEF).
8. The method of any one of claims 1-6, wherein the patient has pulmonary hypertension due to heart failure with reduced left ventricular ejection fraction (LVEF).
9. The method of any one of claims 1-6, wherein the patient has valvular heart disease.
10. The method of any one of claims 1-6, wherein the patient has congenital / acquired cardiovascular conditions leading to post-capillary PH.
11. The method of any one of claims 1-5, wherein the patient has Group 5 pulmonary hypertension as recognized by the WHO.
12. The method of any one of claims 1-5 and 11, wherein the patient has pulmonary hypertension with unclear and / or multifactorial mechanisms.
13. The method of claim 9, wherein the valvular heart disease is aortic regurgitation.
14. The method of claim 9, wherein the valvular heart disease is aortic stenosis.
15. The method of claim 9, wherein the valvular heart disease is mitral valve regurgitation.
16. The method of claim 9, wherein the valvular heart disease is mitral valve stenosis.
17. The method of any one of claims 1-17, wherein the patient has a mean pulmonary arterial pressure (mPAP) selected from the group consisting of: a. an mPAP of at least 20 mmHg; b. an mPAP of at least 25 mmHg; c. an mPAP of at least 30 mmHg; d. an mPAP of at least 35 mmHg; e. an mPAP of at least 40 mmHg; f. an mPAP of at least 45 mmHg; and g. an mPAP of at least 50 mmHg.
18. The method of any one of claims 1-17, wherein the method reduces mPAP in the patient.
19. The method of any one of claims 1-18, wherein the method reduces the mPAP in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
20. The method of any one of claims 1-18, wherein the method reduces the mPAP by at least 3 mmHg (e.g., at least 3, 5, 7, 10, 12, 15, 20, or 25 mm Hg) in the patient.
21. The method of any one of claims 1-20, wherein the patient has a pulmonary arterial wedge pressure (PAWP) of greater than 15 mmHg.
22. The method of claim 21, wherein the method decreases the PAWP in the patient.
23. The method of claim 22, wherein the method reduces the PAWP in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
24. The method of any one of claims 1-20, wherein the patient has a left ventricular end diastolic pressure (LVEDP) of greater than 15 mmHg.
25. The method of claim 24, wherein the method decreases the LVEDP in the patient.
26. The method of claim 24, wherein the method reduces the LVEDP in the patient by at least 10% (e.g, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
27. The method of any one of claims 1-4 and 6-26, wherein the patient has a diastolic pressure gradient (DPG) of less than 7 mmHg.
28. The method of any one of claims 1-3 and 5-26, wherein the patient has a DPG of at least 7 mmHg.
29. The method of claim 28, wherein the method decreases the DPG in the patient.
30. The method of claim 29, wherein the method reduces the DPG in the patient by at least 10% (e.g, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
31. The method of any one of claims 1 -4 and 6-30, wherein the patient has a transpulmonary pressure gradient (TPG) of less than or equal to 12 mm Hg.
32. The method of any one of claims 1-3 and 5-30, wherein the patient has a TPG of greater than 12 mm Hg.
33. The method of claim 32, wherein the method decreases the TPG in the patient.
34. The method of claim 33, wherein the method reduces the TPG in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
35. The method of any one of claims 1-3 and 5-34, wherein the patient has a pulmonary vascular resistance (PVR) greater than or equal to 3 Wood Units.
36. The method of claim 35, wherein the method decreases the PVR in the patient.
37. The method of claim 36, wherein the method reduces the PVR in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
38. The method of any one of claims 1-4 and 6-37, wherein the method prevents the progression of IpcPH to CpcPH.
39. The method of any one of claims 1-4 and 6-37, wherein the method reduces the development of a pre-capillary component of PH.
40. The method of any one of claims 1-6 and 8-39, wherein the patient has preserved left ventricular ejection fraction.
41. The method of claim 40, wherein the preserved left ventricular ejection fraction is greater than 45%.
42. The method of claim 41, wherein the preserved left ventricular fraction is measured using echocardiography.
43. The method of any one of claims 1-42, wherein the patient has diastolic dysfunction of the left ventricle.
44. The method of any one of claims 1-42, wherein the patient has systolic dysfunction of the left ventricle.
45. The method of any one of claims 1-44, wherein the method decreases right ventricular hypertrophy in the patient.
46. The method of claim 45, wherein the method decreases right ventricular hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
47. The method of any one of claims 1-46, wherein the method decreases left ventricular hypertrophy in the patient.
48. The method of claim 47, wherein the method decreases left ventricular hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
49. The method of any one of claims 1-48, wherein the method decreases smooth muscle hypertrophy in the patient.
50. The method of claim 49, wherein the method decreases smooth muscle hypertrophy in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
51. The method of any one of claims 1-50, wherein the method decreases pulmonary arteriole muscularity in the patient.
52. The method of claim 51, wherein the method decreases pulmonary arteriole muscularity in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
53. The method of any one of claims 1-52, wherein the patient has a right ventricular systolic pressure (RVSP) of greater than 35 mmHg.
54. The method of claim 53, wherein the method decreases the RVSP in the patient.
55. The method of claim 54, wherein the method reduces the RVSP in the patient by at least10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
56. The method of any one of claims 1-55, wherein the patient has left ventricular fibrosis.
57. The method of claim 56, wherein the method decreases the left ventricular fibrosis in the patient.
58. The method of claim 57, wherein the method reduces the left ventricular fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
59. The method of any one of claims 1-58, wherein the patient has right ventricular fibrosis.
60. The method of claim 59, wherein the method decreases the right ventricular fibrosis in the patient.
61. The method of claim 60, wherein the method reduces the right ventricular fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
62. The method of any one of claims 1-61, wherein the patient has pulmonaiy fibrosis.
63. The method of claim 62, wherein the method decreases the pulmonaiy fibrosis in the patient.
64. The method of claim 63, wherein the method reduces the pulmonaiy fibrosis in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or at least 50%).
65. The method of any one of claims 1-64, wherein the patient has a comorbidity selected from the group consisting of systemic hypertension, diabetes mellitus, obesity, coronary artery disease (CAD), heart failure, and anemia.
66. The method of any one of claims 1-65, comprising further administering to the patient an additional active agent and / or supportive therapy.
67. The method of claim 66, wherein the additional active agent and / or supportive therapy is selected from the group consisting of: beta-blockers, angiotensin-converting enzyme inhibitors (ACE inhibitors), angiotensin receptor blockers (ARBs), neprilysin inhibitors, angiotensin receptor-neprilysin inhibitors (ARNI), mineralocorticoid receptor antagonists (MRA), hyperpolarization-activated cyclic nucleotide-gated (HCN) channel blockers, diuretic agents, lipid-lowering medications, endothelin blockers, PDE5 inhibitors, prostacyclins, cardiac resynchronization therapy, valve replacement, valve repair, implantable cardioverter- defibrillator (ICD), or a left ventricular assist device (LVAD).
68. The method of claim 66, wherein the additional active agent and / or supportive therapy is selected from the group consisting of: prostacyclin and derivatives thereof (e.g., epoprostenol, treprostinil, and iloprost); prostacyclin receptor agonists (e.g., selexipag); endothelin receptor antagonists (e.g., thelin, ambrisentan, macitentan, and bosentan); calcium channel blockers (e.g., amlodipine, diltiazem, and nifedipine); anticoagulants (e.g., warfarin); diuretics; oxygen therapy; atrial septostomy; pulmonary thromboendarterectomy; phosphodiesterase type 5 inhibitors (e.g., sildenafil and tadalafil); activators of soluble guanylate cyclase (e.g., cinaciguat and riociguat); ASK-1 inhibitors (e.g., CIIA; SCH79797; GS-4997; MSC2032964A; 3H-naphtho[l,2,3-de]quiniline-2,7-diones, NQDI-1; 2-thioxo- thiazolidines, 5-bromo-3-(4-oxo-2-thioxo-thiazolidine-5-ylidene)-l,3-dihydro-indol-2-one); NF-KB antagonists (e.g., dh404, CDDO-epoxide; 2.2-difluoropropionamide; C28 imidazole (CDDO-Im); 2-cyano-3,12-dioxoolean-l,9-dien-28-oic acid (CDDO); 3-Acetyloleanolic Acid; 3-Triflouroacetyloleanolic Acid; 28-Methyl-3-acetyloleanane; 28-Methyl-3- trifluoroacetyloleanane; 28-Methyloxyoleanolic Acid; SZC014; SCZ015; SZC017; PEGylatedderivatives of oleanolic acid; 3-0-(beta-D-glucopyranosyl) oleanolic acid; 3-0-[beta-D- glucopyranosyl-(l— >3)-beta-D-glucopyranosyl] oleanolic acid; 3-0-[beta-D-glucopyranosyl- (1— >2)-beta-D-glucopyranosyl] oleanolic acid; 3-0-[beta-D-glucopyranosyl-(l— >3)-beta-D- glucopyranosyl] oleanolic acid 28-O-beta-D-glucopyranosyl ester; 3-0-[beta-D- glucopyranosyl-(l— >2)-beta-D-glucopyranosyl] oleanolic acid 28-O-beta-D-glucopyranosyl ester; 3-0-[a-L-rhamnopyranosyl-(l— >3)-beta-D-glucuronopyranosyl] oleanolic acid; 3-0- [alpha-L-rhamnopyranosyl-(l— >3)-beta-D-glucuronopyranosyl] oleanolic acid 28-O-beta-D- glucopyranosyl ester; 28-0- -D-glucopyranosyl-oleanolic acid; 3-O -D-glucopyranosyl (l 3)- -D-glucopyranosiduronic acid (CS1); oleanolic acid 3-0- -D-glucopyranosyl (1 3)- b-D-glucopyranosiduronic acid (CS2); methyl 3,ll-dioxoolean-12-en-28-olate (DIOXOL); ZCVI4-2; Benzyl 3-dehydr-oxy-l,2,5-oxadiazolo[3',4':2,3]oleanolate); eplerenone, spironolactone, ivabradine, implantable cardioverter-defibrillator (ICD), a left ventricular assist device (LVAD), or lung and / or heart transplantation.
69. The method of any one of claims 1-68, wherein the patient has elevated brain natriuretic peptide (BNP) levels as compared to a healthy patient.
70. The method of claim 69, wherein the patient has a BNP level of at least 100 pg / mL (e.g., 100, 150, 200, 300, 400, 500, 1000, 3000, 5000, 10,000, 15,000, or 20,000 pg / mL).
71. The method of claim 69 or claim 70, wherein the method decreases BNP levels in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%).
72. The method of any one of claims 1-70, wherein the method decreases BNP levels to normal levels (i.e., <100 pg / ml).
73. The method of any one of claims 1-72, wherein the method decreases NT-proBNP levels in the patient.
74. The method of any one of claims 1-73, wherein the method decreases NT-proBNP levels in the patient by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or at least 80%).
75. The method of any one of claims 1-74, wherein the method decreases NT-proBNP levels in the patient by at least 30%.
76. The method of any one of claims 1-75, wherein the method decreases NT-proBNP levels to normal levels.
77. The method of claim 76, wherein the normal level of NT-proBNP is <100 pg / ml.
78. The method of any one of claims 1-77, wherein the method increases exercise capacity of the patient.
79. The method of any one of claims 1-78, wherein the patient has a 6-minute walk distance from 150 to 400 meters.
80. The method of any one of claims 1-78, wherein the patient has a 6-minute walk distance from 150 to 550 meters.
81. The method of any one of claims 1-80, wherein the method increases the patient’s 6- minute walk distance.
82. The method of any one of claims 1-81, wherein the method increases the patient’s 6- minute walk distance by at least 10 meters (e.g., at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, or more than 400 meters).
83. The method of any one of claims 1-82, wherein the method reduces the patient’s Borg dyspnea index (BDI).
84. The method of any one of claims 1-83, wherein the method reduces the patient’s BDI by at least 0.5 index points (e.g., at least 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 index points).
85. The method of any one of claims 1-84, wherein the patient has decreased renal function.
86. The method of any one of claims 1-85, wherein the method further improves renal function.
87. The method of any one of claims 1-86, wherein the patient has Functional Class II or Class III pulmonary hypertension in accordance with the World Health Organization’s functional classification system for pulmonary hypertension.
88. The method of any one of claims 1-86, wherein the patient has Functional Class I, Class II, Class III, or Class IV pulmonary hypertension as recognized by the World Health Organization.
89. The method of any one of claims 1-88, wherein the method prevents or delays pulmonary hypertension Functional Class progression (e.g., prevents or delays progression from Functional Class I to Class II, Class II to Class III, or Class III to Class IV pulmonary hypertension as recognized by the World Health Organization).
90. The method of any one of claims 1-88, wherein the method promotes or increases pulmonary hypertension Functional Class regression (e.g., promotes or increases regression from Class IV to Class III, Class III to Class II, or Class II to Class I pulmonary hypertension as recognized by the World Health Organization).
91. The method of any one of claims 1-82, wherein the patient has Functional Class II or Class III pulmonary hypertension in accordance with the New York Heart Association’s functional classification system for pulmonary hypertension.
92. The method of any one of claims 1-82, wherein the patient has Functional Class I, Class II, Class III, or Class IV pulmonary hypertension as recognized by the New York Heart Association.
93. The method of any one of claims 1-82, 91, and 92, wherein the method prevents or delays pulmonary hypertension Functional Class progression (e.g., prevents or delays progression from Functional Class I to Class II, Class II to Class III, or Class III to Class IV pulmonary hypertension as recognized by the New York Heart Association).
94. The method of any one of claims 1-82, 91, and 92, wherein the method promotes or increases pulmonary hypertension Functional Class regression (e.g., promotes or increases regression from Class IV to Class III, Class III to Class II, or Class II to Class I pulmonary hypertension as recognized by the New York Heart Association).
95. The method of any one of claims 1-94, wherein the method delays clinical worsening ofPcPH.
96. The method of claim 95, wherein the method delays clinical worsening of PcPH in accordance with the World Health Organization’s functional classification system for pulmonary hypertension.
97. The method of claim 95, wherein the method delays clinical worsening of PcPH in accordance with the New York Heart Association’s functional classification system for pulmonary hypertension.
98. The method of any one of claims 1-97, wherein the method reduces the risk of hospitalization for one or more complications associated with PcPH.
99. The method of any one of claims 1-98, wherein the patient has a hemoglobin level from >8 and <15 g / dl.
100. The method of any one of claims 1-99, wherein the patient has been treated with one or more vasodilators.
101. The method of any one of claims 1-100, wherein the patient has been treated with one or more agents selected from the group consisting of: phosphodiesterase type 5 inhibitors, soluble guanylate cyclase stimulators, prostacyclin receptor agonist, and endothelin receptor antagonists.
102. The method of claim 101, wherein the one or more agents is selected from the group consisting of: bosentan, sildenafil, beraprost, macitentan, selexipag, epoprostenol, treprostinil, iloprost, ambrisentan, and tadalafil.
103. The method of any one of claims 1-102, wherein the method further comprises administration of one or more vasodilators.
104. The method of any one of claims 1-103, wherein the method further comprises administration of one or more agents selected from the group consisting of: phosphodiesterase type 5 inhibitors, soluble guanylate cyclase stimulators, prostacyclin receptor agonist, and endothelin receptor antagonists.
105. The method of claim 104, wherein the one or more agents is selected from the group consisting of: bosentan, sildenafil, beraprost, macitentan, selexipag, epoprostenol, treprostinil, iloprost, ambrisentan, and tadalafil.
106. The method of any one of claims 1-105, wherein the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids corresponding to residues 30-110 of SEQ ID NO: 1.
107. The method of any one of claims 1-105, wherein the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence SEQ ID NO: 2.
108. The method of any one of claims 1-105, wherein the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3.
109. The method of any one of claims 106-108, wherein the ActRII polypeptide is a fusion protein further comprising an Fc domain of an immunoglobulin.
110. The method of claim 109, wherein the Fc domain of the immunoglobulin is an Fc domain of an IgGl immunoglobulin.
111. The method of claim 109 or 110, wherein the Fc fusion protein further comprises a linker domain positioned between the ActRII polypeptide domain and the Fc domain of the immunoglobulin.
112. The method of claim 111, wherein the linker domain is selected from the group consisting of: TGGG (SEQ ID NO: 20), TGGGG (SEQ ID NO: 18), SGGGG (SEQ ID NO: 22), GGGGS (SEQ ID NO: 22), GGG (SEQ ID NO: 16), GGGG (SEQ ID NO: 17), and SGGG (SEQ ID NO: 21).
113. The method of any one of claims 1-112, wherein the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23.
114. The method of any one of claims 1-105, wherein the polypeptide comprises an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1, wherein the polypeptide binds to activing and / or GDF11.
115. The method of any one of claims 1-105, wherein the polypeptide comprises an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1, wherein the polypeptide binds to activing and / or GDF11.
116. The method of any one of claims 1-115, wherein the polypeptide is lyophilized.
117. The method of any one of claims 1-116, wherein the polypeptide is soluble.
118. The method of any one of claims 1-117, wherein the polypeptide is administered using subcutaneous injection.
119. The method of any one of claims 1-118, wherein the polypeptide is administered every 4 weeks.
120. The method of any one of claims 1-119, wherein the polypeptide is part of a homodimer protein complex.
121. The method of any one of claims 1-120, wherein the polypeptide is glycosylated.
122. The method of any one of claims 1-121, wherein the polypeptide has a glycosylation pattern obtainable by expression in a Chinese hamster ovary cell.
123. The method of any one of claims 1-122, wherein the ActRII polypeptide binds to one or more ligands selected from the group consisting of: activin A, activin B, and GDF 11.
124. The method of claim 123, wherein the ActRII polypeptide further binds to one or more ligands selected from the group consisting of: BMP10, GDF8, and BMP6.
125. A kit comprising a lyophilized polypeptide and an injection device, wherein the polypeptide is an ActRII polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 of SEQ ID NO: 1 and ends at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, or 135 of SEQ ID NO: 1.
126. The kit of claim 125, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to an amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1.
127. The kit of claim 125 or 126, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1.
128. The kit of any one of claims 125-127, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1.
129. The kit of any one of claims 125-128, wherein the polypeptide is a polypeptide comprising the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1.
130. The kit of any one of claims 125-129, wherein the polypeptide is a polypeptide consisting of the amino acid sequence corresponding to residues 30-110 of SEQ ID NO: 1.
131. The kit of claim 125, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
132. The kit of claim 125 or claim 131, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
133. The kit of any one of claims 125, 131, or 132, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
134. The kit of any one of claims 125 or 131-133, wherein the polypeptide is a polypeptide comprising the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
135. The kit of any one of claims 125 or 131-134, wherein the polypeptide is a polypeptide consisting of the amino acid sequence corresponding to residues 21-135 of SEQ ID NO: 1.
136. The kit of claim 125, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 2.
137. The kit of claim 125 or claim 136, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 2.
138. The kit of any one of claims 125, 136, or 137, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO: 2.
139. The kit of any one of claims 125 or 136-138, wherein the polypeptide is a polypeptide comprising the amino acid sequence of SEQ ID NO: 2.
140. The kit of any one of claims 125 or 136-139, wherein the polypeptide is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 2.
141. The kit of claim 125, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 3.
142. The kit of claim 125 or claim 141, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 3.
143. The kit of any one of claims 125, 141, or 142, wherein the polypeptide is a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO: 3.
144. The kit of any one of claims 125 or 141-143, wherein the polypeptide is a polypeptide comprising the amino acid sequence of SEQ ID NO: 3.
145. The kit of any one of claims 125 or 141-144, wherein the polypeptide is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 3.
146. The kit of any one of claims 125-145, wherein the polypeptide is a fusion protein further comprising an Fc domain of an immunoglobulin.
147. The kit of claim 146, wherein the Fc domain of the immunoglobulin is an Fc domain of an IgGl immunoglobulin.
148. The kit of claim 146 or claim 147, wherein the fusion protein further comprises a linker domain positioned between the polypeptide domain and the Fc domain of the immunoglobulin.
149. The kit of claim 148, wherein the linker domain is selected from the group consisting of: TGGG (SEQ ID NO: 20), TGGGG (SEQ ID NO: 18), SGGGG (SEQ ID NO: 19), GGGGS (SEQ ID NO: 22), GGG (SEQ ID NO: 16), GGGG (SEQ ID NO: 17), and SGGG (SEQ ID NO: 21).
150. The kit of claim 148 or claim 149, wherein the linker domain comprises TGGG (SEQ ID NO: 20).
151. The kit of any one of claims 125-150, wherein the ActRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 23.
152. The kit of any one of claims 125-151, wherein the ActRII polypeptide comprises the amino acid sequence of SEQ ID NO: 23.
153. The kit of any one of claims 125-152, wherein the ActRII polypeptide consists of the amino acid sequence of SEQ ID NO: 23.
154. The kit of any one of claims 125-153, wherein the polypeptide is part of a homodimer protein complex.
155. The kit of any one of claims 125-154, wherein the polypeptide is glycosylated.
156. The kit of any one of claims 125-155, wherein the polypeptide binds to one or more ligands selected from the group consisting of: activin A, activin B, and GDF 11.
157. The kit of claim 156, wherein the polypeptide further binds to one or more ligands selected from the group consisting of: BMP 10, GDF8, and BMP6.
158. The kit of any one of claims 125-155, wherein the polypeptide binds to activin and / or GDF11.
159. The kit of any one of claims 125-158, wherein the kit comprises one or more vials containing the lyophilized polypeptide.
160. The kit of any one of claims 125-159, wherein the injection device comprises a pre filled syringe.
161. The kit of any one of claims 125-159, wherein the injection device comprises apump apparatus.
162. The kit of claim 161, wherein the pump apparatus comprises an electromechanical pumping assembly.
163. The kit of claim 161, wherein the pump apparatus is a wearable pump apparatus.
164. The kit of claim 162, wherein the pre-filled syringe comprises a reconstitution solution.
165. The kit of claim 162, wherein the reconstitution solution comprises a pharmaceutically acceptable carrier and / or excipient.
166. The kit of claim 165, wherein the pharmaceutically acceptable carrier is selected from saline solution, purified water, or sterile water for injection.
167. The kit of claim 165, wherein the pharmaceutically acceptable excipient is selected from a buffering agent [e.g., citric acid (monohydrate) and / or trisodium citrate (dehydrate)], a surfactant (e.g., polysorbate 80), a stabilizer (e.g., sucrose), and a lyoprotectant (e.g, sucrose).
168. The kit of any one of claims 125-167, wherein the injection device comprises a vial adapter.
169. The kit of claim 168, wherein the vial adapter is capable of attaching to a vial.
170. The kit of claim 168 or claim 169, wherein the vial adapter is capable of attaching to a pre-fdled syringe.
171. The kit of claim 170, wherein the pre-fdled syringe and the vial are attached to opposite ends of the vial adapter.
172. The kit of claim 171, wherein the reconstitution solution is transferred from the pre- fdled syringe to the vial.
173. The kit of claim 125-172, wherein the lyophilized polypeptide is reconstituted into a sterile injectable solution.
174. The kit of claim 125-172, wherein the lyophilized polypeptide is reconstituted into a sterile injectable solution prior to use.
175. The kit claim of 173 or claim 174, wherein the sterile injectable solution is sterile water for injection.
176. The kit of any one of claims 173-175, wherein the sterile injectable solution is administered parenterally.
177. The kit of claim 176, wherein the injection device is used to administer the sterile injectable solution parenterally.
178. The kit of any one of claims 173-177, wherein the sterile injectable solution is administered via subcutaneous injection.
179. The kit of any one of claims 173-177, wherein the sterile injectable solution is administered via intradermal injection.
180. The kit of any one of claims 173-177, wherein the sterile injectable solution is administered via intramuscular injection.
181. The kit of any one of claims 173-177, wherein the sterile injectable solution is administered via intravenous injection.
182. The kit of any one of claims 173-177, wherein the sterile injectable solution is self- administered.
183. The kit of any one of claims 125-182, wherein the sterile injectable solution comprises a therapeutically effective dose.
184. The kit of claim 183, wherein the therapeutically effective dose comprises a weight based dose.
185. The kit of any one of claims 125-184, wherein the lyophilized polypeptide is administered every 4 weeks.
186. The kit of any one of claims 125-185, wherein the kit is used to treat post-capillary pulmonary hypertension (PcPH).
187. The kit of claim 186, wherein the PcPH is isolated post-capillary pulmonary hypertension (IpcPH).
188. The kit of claim 186, wherein the PcPH is combined post- and pre-capillary PH (CpcPH).
189. The kit of any one of claims 186-188, wherein the patient has Group 2 pulmonary hypertension as recognized by the WHO.
190. The kit of any one of claims 186-189, wherein the patient has pulmonary hypertension due to heart failure with preserved left ventricular ejection fraction (LVEF).
191. The kit of any one of claims 186-189, wherein the patient has pulmonary hypertension due to heart failure with reduced left ventricular ejection fraction (LVEF).
192. The kit of any one of claims 186-189, wherein the patient has valvular heart disease.
193. The kit of any one of claims 186-189, wherein the patient has congenital / acquired cardiovascular conditions leading to post-capillary PH.
194. The kit of any one of claims 186-188, wherein the patient has Group 5 pulmonary hypertension as recognized by the WHO.
195. The kit of any one of claims 186-188, wherein the patient has pulmonary hypertension with unclear and / or multifactorial mechanisms.
196. The kit of any one of claims 1-195, wherein the shelf life of the lyophilized polypeptide is at least 1, 1.5, 2, 2.5, or 3 years.
197. The kit of any one of claims 1-195, wherein the lyophilized polypeptide is reconstituted.
198. The kit of claim 197, wherein the reconstituted polypeptide has a shelf life of at least 2 hrs, 3 hrs, or 4 hrs.