Immunogenic compositions comprising conjugated capsular saccharide antigens and uses thereof

Abstract

The present invention relates to new conjugated capsular saccharide antigens (glycoconjugates), immunogenic compositions comprising said glycoconjugates and uses thereof. Fig. 2

Description

[0001]Immunogenic compositions comprising conjugated capsular saccharide antigens and uses thereof Field of the Invention The present invention relates to new conjugated capsular saccharide antigens (glycoconjugates), immunogenic compositions comprising said glycoconjugates and uses thereof. Immunogenic compositions of the present invention will typically comprise glycoconjugates, wherein the saccharides are derived from serotypes of Streptococcus pneumoniae. The invention also relates to vaccination of human subjects, in particular infants and elderly, against pneumoccocal infections using said glycoconjugates. Background of the Invention The approach to increasing immunogenicity of poorly immunogenic molecules by conjugating these molecules to “carrier” molecules has been utilized successfully for decades (see, e.g., Goebel et al. (1939) J. Exp. Med. 69: 53). For example, many immunogenic compositions have been described in which purified capsular polymers have been conjugated to carrier proteins to create more effective immunogenic compositions by exploiting this “carrier effect.” Schneerson et al. (1984) Infect. Immun. 45: 582-591). Conjugation has also been shown to bypass the poor antibody response usually observed in infants when immunized with a free polysaccharide (Anderson et al. (1985) J. Pediatr.107: 346; Insel et al. (1986) J. Exp. Med.158: 294). Conjugates have been successfully generated using various cross-linking or coupling reagents, such as homobifunctional, heterobifunctional, or zero-length crosslinkers. Many methods are currently available for coupling immunogenic molecules, such as saccharides, proteins, and peptides, to peptide or protein carriers. Most methods create amine, amide, urethane, isothiourea, or disulfide bonds, or in some cases thioethers. A disadvantage to the use of cross-linking or coupling reagents which introduce reactive sites into the side chains of reactive amino acid molecules on carrier and / or immunogenic molecules is that the reactive sites, if not neutralized, are free to react with any unwanted molecule either in vitro (thus potentially adversely affecting the functionality or stability of the conjugates) or in vivo (thus posing a potential risk of adverse events in persons or animals immunized with the preparations). Such excess reactive sites can be reacted or “capped”, so as to inactivate these sites, utilizing various known chemical reactions, but these reactions may be otherwise disruptive to the functionality of the conjugates. Thus, there remains a need for new glycoconjugates appropriately capped and methods to prepare said conugates, such that the functionality is preserved and the conjugate retains the ability to elicit the desired immune response. Pneumococcal polysaccharides, in particular capsular polysaccharides, are important immunogens found on the surface of the bacteria. This has led to them being an important component in the design of pneumococcal vaccines. They have proved useful in eliciting immune responses especially when linked to carrier proteins. Some serotypes, in particular Streptococcus pneumoniae serotype 3, produce large and viscous polysaccharide chains (e.g., for Type 3, chains of glucose / glucuronic acid of 2-3 million Daltons). Its viscosity has made it difficult to handle. Furthermore, significant immunogenicity with respect to serotype 3 polysaccharides has been difficult to obtain. For example, in a study of the immunogenicity and safety of an 11-valent pneumococcal protein D conjugate vaccine (11-Pn-PD), no priming effect was observed for serotype 3 in infants who had received three doses of the vaccine followed by a booster dose of either the same vaccine or a pneumococcal polysaccharide vaccine (Nurkka et al. (2004) Ped. Inf. Dis. J., 23:1008- 1014). In another study, opsonophagocytic assay (OPA) results from infants who had received doses of 11-Pn-PD failed to show antibody responses for serotype 3 at levels comparable to other tested serotypes (Gatchalian et al., 17thannual Meeting of the Eur. Soc. Paed. Inf. Dis. (ESPID), Poster No.4, PIA Poster Session 1, Istanbul Turkey, Mar. 27, 2001). In yet another study, which assessed the efficacy of an 11-Pn-PD in the prevention of acute otitis media, the vaccine did not provide protection against episodes caused by serotype 3 (Prymula et al. The Lancet, Vol.367: 740-748 (March 4, 2006)). Thus, there is a need for antigens which are able to generate a more robust immune response to Streptococcus pneumoniae serotype 3. The present invention provides in particular Streptococcus pneumoniae serotype 3 glycoconjugates which show improved immunogenicity. The present invention also provides a process (method of making) which generates Streptococcus pneumoniae serotype 3 glycoconjugate with improved conjugation yield. Summary of the Invention In an aspect, the invention relates to a method of making a Streptococcus pneumoniae serotype 3 glycoconjugate, comprising the steps of: (a) reacting an isolated Streptococcus pneumoniae serotype 3 capsular polysaccharide with a carbonic acid derivative and an azido linker in an aprotic solvent to produce an activated azido polysaccharide, (b) reacting a carrier protein with an agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group where the NHS moiety reacts with the amino groups to form an amide linkage thereby obtaining an alkyne functionalized carrier protein, (c) reacting the activated azido polysaccharide of step (a) with the activated alkyne-carrier protein of step (b) by Cu+1mediated azide-alkyne cycloaddition reaction to form a glycoconjugate. In a particlaur aspect, the isolated polysaccharide is sized to a weight average molecular weight between 100 kDa and 200 kDa before the activation step (a). In an aspect, the carbonic acid derivative is 1,1’-carbonyldiimidazole (CDI). In an aspect, the invention relates to a Streptococcus pneumoniae serotype 3 glycoconjugate produced according to said methods. In an aspect, the invention relates to a Streptococcus pneumoniae serotype 3 glycoconjugate comprising a Streptococcus pneumoniae serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII): wherein X is selected from the group consisting of CH2(CH2)n’, (CH2CH2O)mCH2CH2, NHCO(CH2)n’, NHCO(CH2CH2O)mCH2CH2, OCH2(CH2)n’and O(CH2CH2O)mCH2CH2; where n’ is selected from 1 to 10 and m is selected from 1 to 4, and wherein X' is selected from the group consisting of CH2O(CH2)n’’CH2C=O, CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In yet a further aspect, the invention relates to an immunogenic composition comprising said Streptococcus pneumoniae serotype 3 glycoconjugate. Figures Figure 1 shows a repeating polysaccharide structure of the S. pneumoniae serotype 3 capsular polysaccharide. Figure 2 shows a general scheme for the preparation of Streptococcus pneumoniae serotype 3 glycoconjugate of the invention prepared using click chemistry. Pn3 poly = S. pneumoniae serotype 3 capsular polysaccharide; CP = Carrier Protein, CDI = 1,1’- carbonyldiimidazole. Figure 3 shows opsonophagocytic activity (OPA) titers for Serotype 3-CRM197 conjugates in mice comprising polysaccharide of different size. Sized Serotype 3 polysaccharides (~25, 150, or 250 kDa) conjugated to CRM197 using either RAC / Aqueous or RAC / DMSO conjugation was used to vaccinate mice. Figure 4 shows opsonophagocytic activity (OPA) titers for Serotype 3-CRM197conjugates in mice with different Degree of Activation (DoA). Sized Serotype 3 polysaccharides conjugated to CRM197 using the either RAC / Aqueous or RAC / DMSO conjugation were used to vaccinate mice. Figure 5 shows the opsonophagocytic activity (OPA) titers for Serotype 3 conjugates to -CRM197, -SCP, or Tetanus toxoid (TT) in mice. Reductive Amination in DMSO (RAC / DMSO) was used. Figure 6 shows opsonophagocytic activity (OPA) titers for Serotype 3-CRM197conjugates in mice. Different chemistries have been used (Reductive Amination in aqueous (RAC / Aq.), Reductive Amination in DMSO (RAC / DMSO), eTEC linked glycoconjugates (eTEC) or click chemistry (Click). Figure 7 shows Post dose 1 OPA titers in infant rhesus vaccinated with serotype 3 chemistry / carrier conjugates. Different chemistries have been used (Reductive Amination in aqueous (RAC / Aq.) or click chemistry (Click). Opsonophagocytic titers measured from sera collected at 4 weeks post dose 1 time point between different conjugation chemistries. Each dot represents individual animal and data expressed as geomean titers with 95% confidence interval. Statistical significance determined based on one-way ANOVA. Tukey’s multiplicity adjusted p values are reported. ****=p≤0.0001 LLOQ - lower limit of quantitation. Figure 8 shows Post dose 2 OPA response in infant rhesus macaques vaccinated with serotype 3 chemistry / carrier conjugates. Opsonophagocytic titers measured from sera collected at 4 weeks post dose 2 between different conjugation chemistries. Each dot represents individual animal and data expressed as geomean titers with 95% confidence interval. Statistical significance determined based on one-way ANOVA. Tukey’s multiplicity adjusted p values are reported. LLOQ - lower limit of quantitation 1. Glycoconjugates of the invention The present invention is directed in part to conjugated capsular saccharide antigens (also named glycoconjugates), where saccharides are derived from serotypes of S. pneumoniae, in particular from serotype 3. For the purpose of the invention the term 'glycoconjugate' indicates a capsular saccharide linked covalently to a carrier protein. In one embodiment a capsular saccharide is linked directly to a carrier protein. In a second embodiment a bacterial saccharide is linked to a protein through a spacer / linker. 1.1 Pneumococcal saccharide from S. pneumoniae serotype 3 As shown at Figure 1, the polysaccharide repeating unit of serotype 3 consists of a linear disaccharide unit with one glucopyranose (Glcp) and one glucuronic acid (GlcpA) (see e.g. Geno K et al. (2015) Clin Microbiol Rev Vol 28:3, p 871-899). In an embodiment, the capsular S. pneumoniae serotype 3 saccharide used in the present invention is a synthetic carbohydrate. Preparation of a synthetic Streptococcus pneumoniae type 3 capsular saccharide can for example be conducted as disclosed in WO2017178664. In a preferred embodiment though, the source of bacterial polysaccharide according to this invention can be Streptococcus pneumoniae serotype 3 bacterial cells. Bacterial strains which can be used as source of Streptococcus pneumoniae serotype 3 polysaccharides may be obtained from established culture collections (such as for example from the Streptococcal Reference Laboratory (Centers for Disease Control and Prevention, Atlanta, GA USA)) or clinical specimens. Serotype 3 polysaccharides can be obtained directly from bacteria using isolation procedures known to one of ordinary skill in the art (see for example methods disclosed in US2006 / 0228380, US2006 / 0228381, US2007 / 0184071, US2007 / 0184072, US2007 / 0231340, and US2008 / 0102498 and WO2008 / 118752). They can also be produced using synthetic protocols known to the man skilled in the art. They can also be purchased (such as for example from the American Type Culture Collection (ATCC, Manassas, VA USA) (e.g., reference No. ATCC 172-X or ATCC 33-X)). In case the serotype 3 polysaccharide is obtained directly from bacteria, the bacterial cells can be grown in a medium, preferably in a soy based medium. Following fermentation of bacterial cells that produce S. pneumoniae serotype 3 capsular polysaccharides, the bacterial cells can be lysed to produce a cell lysate. The serotype 3 polysaccharide may then be isolated from the cell lysate using purification techniques known in the art, including the use of centrifugation, depth filtration, precipitation, ultra-filtration, treatment with activate carbon, diafiltration and / or column chromatography (see, for example, US2006 / 0228380, US2006 / 0228381 and WO2008 / 118752). The purified serotype 3 capsular polysaccharide can then be used for the preparation of immunogenic conjugates. The isolated serotype 3 capsular polysaccharide obtained by purification of serotype 3 polysaccharide from the S. pneumoniae lysate and optionally sizing of the purified polysaccharide can be characterized by different parameters including, for example the weight average molecular weight (Mw). The molecular weight of the polysaccharide can be measured by Size Exclusion Chromatography (SEC) combined with Multiangle Laser Light Scattering detector (MALLS). In a preferred embodiment, the isolated serotype 3 capsular polysaccharide (i.e. purified before further treatment) has a weight average molecular weight between 5 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 5 kDa and 100 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 50 kDa and 100 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 100 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 150 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 200 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 300 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 400 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 500 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 750 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1000 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1000 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1000 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1000 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1000 kDa and 1500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1500 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1500 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1500 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 1500 kDa and 2000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2000 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2000 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2000 kDa and 3000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2500 kDa and 5000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2500 kDa and 4000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide has a weight average molecular weight between 2500 kDa and 3000 kDa. Any whole number integer within any of the above ranges is contemplated as an embodiment of the disclosure. Preferably, in order to generate serotype 3 conjugates with advantageous filterability characteristics, immunogenicity and / or yields, sizing of the polysaccharide to a target molecular weight range is performed prior to the conjugation to a carrier protein. Advantageously, the size of the purified serotype 3 polysaccharide is reduced while preserving critical features of the structure of the polysaccharide. Mechanical or chemical sizing maybe employed. In an embodiment, the size of the purified serotype 3 polysaccharide is reduced by chemical hydrolysis. Chemical hydrolysis maybe conducted using a mild acid ( e.g acetic acid, formic acid, propanoic acid). In an embodiement, chemical hydrolysis is conducted using formic acid. In an embodiement, chemical hydrolysis is conducted using propanoic acid. In a preferred embodiement, chemical hydrolysis is conducted using acetic acid. Chemical hydrolysis may also be conducted using a diluted strong acid (such as diluted hydrochloric acid, diluted sulfuric acid, diluted phosphoric acid, diluted nitric acid or diluted perchloric acid). In an embodiement, chemical hydrolysis is conducted using diluted hydrochloric acid. In an embodiement, chemical hydrolysis is conducted using diluted sulfuric acid. In an embodiement, chemical hydrolysis is conducted using diluted phosphoric acid. In an embodiement, chemical hydrolysis is conducted using diluted nitric acid. In an embodiement, chemical hydrolysis is conducted using diluted perchloric acid. The size of the purified serotype 3 polysaccharide can also be reduced by mechanical homogenization. In an embodiment, the size of the purified serotype 3 polysaccharide is reduced by high pressure homogenization. High pressure homogenization achieves high shear rates by pumping the process stream through a flow path with sufficiently small dimensions. The shear rate is increased by using a larger applied homogenization pressure, and exposure time can be increased by recirculating the feed stream through the homogenizer. The high-pressure homogenization process can be appropriate for reducing the size of the purified serotype 3 polysaccharide while preserving the structural features of the polysaccharide. In a preferred embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 100 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 5 kDa and 50 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 50 kDa and 100 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 110 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 120 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 110 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 130 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 120 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 120 kDa and 140 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 120 kDa and 130 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 130 kDa and 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 130 kDa and 140 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 150 kDa and 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 200 kDa and 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 250 kDa and 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 300 kDa and 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 350 kDa and 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 400 kDa and 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 450 kDa and 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 500 kDa and 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 600 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 600 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 600 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 600 kDa and 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 700 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 700 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 700 kDa and 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 800 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 800 kDa and 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 900 kDa and 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 5 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 50 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 100 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 110 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 120 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 130 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 140 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 150 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 160 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 170 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 180 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 190 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 200 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 250 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 300 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 350 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 400 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 450 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 500 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 550 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 600 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 700 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 800 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 900 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight of about 1000 kDa. In an embodiment, the isolated serotype 3 capsular polysaccharide is not sized. The isolated serotype 3 capsular polysaccharide described above may be activated (e.g., chemically activated) to make them capable of reacting (e.g. with a linker or directly with the carrier protein) and then incorporated into glycoconjugates, as further described herein. For the purposes of the invention the term 'glycoconjugate' indicates a saccharide covalently linked to a carrier protein. In one embodiment a saccharide is linked directly to a carrier protein. In a second embodiment a saccharide is linked to a carrier protein through a spacer / linker. In general, covalent conjugation of saccharides to carriers enhances the immunogenicity of saccharides as it converts them from T-independent antigens to T-dependent antigens, thus allowing priming for immunological memory. Conjugation is particularly useful for pediatric vaccines. 1.2 Streptococcus pneumoniae serotype 3 glycoconjugates of the invention In some embodiments, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 10 kDa and 2,000 kDa. The weight average molecular weight (Mw) of the saccharide before conjugation refers to the Mw before the activation of the polysaccharide (i.e. after an eventual sizing step but before reacting the polysaccharide with an activating agent). In the context of the present invention the Mw of the polysaccharide is not substantially modified by the activation step and the Mw of the polysaccharide incorporated in the conjugate is similar to the Mw of the polysaccharide as measured before activation. In an embodiment, the polysaccharide is activated with a carbonic acid derivative (e.g. CDI or CDT) in combination with an azido linker (see sections 1.3 below). In an embodiment, the polysaccharide is activated with CDI in combination with an azido linker (see sections 1.3 below). In an embodiment, the polysaccharide is activated with CDT in combination with an azido linker (see sections 1.3 below). In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 50 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 200 kDa In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 150 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 140 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 130 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 120 kDa. In an embodiment, the weight average molecular weight (Mw) is between 50 kDa and 110 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 75 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 200 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 150 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 140 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 130 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 120 kDa. In an embodiment, the weight average molecular weight (Mw) is between 75 kDa and 110 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 100 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 200 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 150 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 140 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 130 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 120 kDa. In an embodiment, the weight average molecular weight (Mw) is between 100 kDa and 110 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 125 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 200 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 150 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 140 kDa. In an embodiment, the weight average molecular weight (Mw) is between 125 kDa and 130 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 130 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 200 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 150 kDa. In an embodiment, the weight average molecular weight (Mw) is between 130 kDa and 140 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 150 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 300 kDa. In an embodiment, the weight average molecular weight (Mw) is between 150 kDa and 200 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 200 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 400 kDa. In an embodiment, the weight average molecular weight (Mw) is between 200 kDa and 300 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 300 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 300 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 300 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 300 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 300 kDa and 500 kDa. In an embodiment, the weight average molecular weight (Mw) is between 300 kDa and 400 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 400 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 400 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 400 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 400 kDa and 600 kDa. In an embodiment, the weight average molecular weight (Mw) is between 400 kDa and 500 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 500 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 500 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 500 kDa and 700 kDa. In an embodiment, the weight average molecular weight (Mw) is between 500 kDa and 600 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 600 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 600 kDa and 750 kDa. In an embodiment, the weight average molecular weight (Mw) is between 600 kDa and 700 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 700 kDa and 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is between 700 kDa and 750 kDa. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 750 kDa and 1,000 kDa. Any whole number integer within any of the above ranges is contemplated as an embodiment of the disclosure. In an embodiment, the serotype 3 glycoconjugate of the present invention comprises a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is about 1,000 kDa. In an embodiment, the weight average molecular weight (Mw) is about 750 kDa. In an embodiment, the weight average molecular weight (Mw) is about 700 kDa. In an embodiment, the weight average molecular weight (Mw) is about 600 kDa. In an embodiment, the weight average molecular weight (Mw) is about 500 kDa. In an embodiment, the weight average molecular weight (Mw) is about 400 kDa. In an embodiment, the weight average molecular weight (Mw) is about 300 kDa. In an embodiment, the weight average molecular weight (Mw) is about 200 kDa. In an embodiment, the weight average molecular weight (Mw) is about 150 kDa. In an embodiment, the weight average molecular weight (Mw) is about 140 kDa. In an embodiment, the weight average molecular weight (Mw) is about 130 kDa. In an embodiment, the weight average molecular weight (Mw) is about 120 kDa. In an embodiment, the weight average molecular weight (Mw) is about 110 kDa. In an embodiment, the weight average molecular weight (Mw) is about 100 kDa. In some such embodiments, the serotype 3 glycoconjugates are prepared using click chemistry (see section 1.3). In some embodiments, the serotype 3 glycoconjugate of the invention has a weight average molecular weight (Mw) of between 250 kDa and 20,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 15,000 kDa. In yet other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 2,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 1,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 1,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 750 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 600 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 250 kDa and 400 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 2,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 1,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 1,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 750 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 500 kDa and 600 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 2,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 1,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 750 kDa and 1,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 2,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 1,000 kDa and 1,500 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,000 kDa and 3,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 2,250 kDa and 3,500 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 3,000 kDa and 4,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 4,000 kDa and 5,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 5,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 5,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 5,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 5,000 kDa and 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 5,000 kDa and 6,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 6,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 6,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 6,000 kDa and 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 6,000 kDa and 7,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 7,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 7,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 7,000 kDa and 8,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 8,000 kDa and 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 8,000 kDa and 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of between 9,000 kDa and 10,000 kDa. Any whole number integer within any of the above ranges is contemplated as an embodiment of the disclosure. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 10,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 9,000 kDa. In other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 8,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 7,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 6,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 5,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 4,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 3,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 3,250 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 3,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 2,500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 2,250 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 2,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 1,000 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 750 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 600 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 500 kDa. In still other embodiments, the serotype 3 glycoconjugate has a weight average molecular weight (Mw) of about 400 kDa. The molecular weight of the polysaccharide can be measured by Size Exclusion Chromatography (SEC) combined with Multiangle Laser Light Scattering detector (MALLS). Another way to characterize the serotype 3 glycoconjugates of the invention is by the number of lysine residues in the carrier protein (e.g., CRM197 or SCP) that become conjugated to the saccharide which can be characterized as a range of conjugated lysines (degree of conjugation). The evidence for lysine modification of the carrier protein, due to covalent linkages to the polysaccharides, can be obtained by amino acid analysis using routine methods known to those of skill in the art. Conjugation results in a reduction in the number of lysine residues recovered compared to the carrier protein starting material used to generate the conjugate materials. In a preferred embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 15. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 13. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 10. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 8. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 6. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 5. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 2 and 4. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 15. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 13. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 10. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 8. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 6. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 5. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 3 and 4. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 5 and 15. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 5 and 10. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 8 and 15. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 8 and 12. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 10 and 15. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 10 and 12. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 2. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 3. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 4. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 5. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 6. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 7. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 8. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 9. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 10, about 11. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 12. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 13. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 14. In an embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is about 15. In a preferred embodiment, the degree of conjugation of the serotype 3 glycoconjugate of the invention is between 4 and 7. In some such embodiments, the carrier protein is CRM197. In other such embodiments, the carrier protein is SCP. The serotype 3 glycoconjugates of the invention may also be characterized by the ratio (weight / weight) of saccharide to carrier protein. In some embodiments, the ratio of serotype 3 polysaccharide to carrier protein in the glycoconjugate (w / w) is between 0.5 and 3.0. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 0.5 and 2.0. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 0.5 and 1.5. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 0.8 and 1.2. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 0.5 and 1.0. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 1.0 and 1.5. In other embodiments, the saccharide to carrier protein ratio (w / w) is between 1.0 and 2.0. In further embodiments, the saccharide to carrier protein ratio (w / w) is between 0.8 and 1.2. In a preferred embodiment, the ratio of serotype 3 capsular polysaccharide to carrier protein in the conjugate is between 0.9 and 1.1. In an embodiment, the saccharide to carrier protein ratio (w / w) is about 0.5. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 0.6. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 0.7. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 0.8. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 0.9. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.0. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.1. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.2. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.3. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.4. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.5. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.6. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.7. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.8. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 1.9. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 2.0. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 2.1. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 2.2. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 2.5. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 2.8. In other embodiments, the saccharide to carrier protein ratio (w / w) is about 3.0. In some such embodiments, the carrier protein is CRM197. In other such embodiments, the carrier protein is SCP. The serotype 3 glycoconjugates of the invention may also be characterized by the number of covalent linkages between the carrier protein and the saccharide as a function of repeat units of the saccharide. In one embodiment, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 4 saccharide repeat units of the polysaccharide. In another embodiment, the covalent linkage between the carrier protein and the polysaccharide occurs at least once in every 10 saccharide repeat units of the polysaccharide. In another embodiment, the covalent linkage between the carrier protein and the polysaccharide occurs at least once in every 15 saccharide repeat units of the polysaccharide. In a further embodiment, the covalent linkage between the carrier protein and the polysaccharide occurs at least once in every 25 saccharide repeat units of the polysaccharide. In a further embodiment, the covalent linkage between the carrier protein and the polysaccharide occurs at least once in every 50 saccharide repeat units of the polysaccharide. In yet a further embodiment, the covalent linkage between the carrier protein and the polysaccharide occurs at least once in every 100 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 5 to 10 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 2 to 7 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 6 to 11 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 9 to 14 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 10 to 20 saccharide repeat units of the polysaccharide. In other embodiments, the serotype 3 glycoconjugate of the invention comprises at least one covalent linkage between the carrier protein and the polysaccharide for every 4 to 25 saccharide repeat units of the polysaccharide. In frequent embodiments, the carrier protein is CRM197. In frequent embodiments, the carrier protein is SCP. In some embodiments, the carrier protein is CRM197and the covalent linkage between the CRM197 and the polysaccharide occurs at least once in every 4, 10, 15 or 25 saccharide repeat units of the polysaccharide. In frequent embodiments, the carrier protein is SCP and the covalent linkage between the SCP and the polysaccharide occurs at least once in every 4, 10, 15 or 25 saccharide repeat units of the polysaccharide. The serotype 3 glycoconjugates and immunogenic compositions of the invention may contain free saccharide that is not covalently conjugated to the carrier protein but is nevertheless present in the glycoconjugate composition. The free saccharide may be noncovalently associated with (i.e., noncovalently bound to, adsorbed to, or entrapped in or with) the glycoconjugate. In a preferred embodiment, the serotype 3 glycoconjugate comprises less than about 50% of free serotype 3 polysaccharide compared to the total amount of serotype 3 polysaccharide. In a preferred embodiment the serotype 3 glycoconjugate comprises less than about 40% of free serotype 3 polysaccharide compared to the total amount of serotype 3 polysaccharide. In a yet preferred embodiment, the serotype 3 glycoconjugate comprises less than about 25% of free serotype 3 polysaccharide compared to the total amount of serotype 3 polysaccharide. In an even preferred embodiment, the serotype 3 glycoconjugate comprises less than about 20% of free serotype 3 polysaccharide compared to the total amount of serotype 3 polysaccharide. In a yet preferred embodiment, the serotype 3 glycoconjugate comprises less than about 15% of free serotype 3 polysaccharide compared to the total amount of serotype 3 polysaccharide. The serotype 3 glycoconjugates may also be characterized by their molecular size distribution (Kd). Size exclusion chromatography media (CL-4B) can be used to determine the relative molecular size distribution of the conjugate. Size Exclusion Chromatography (SEC) is used in gravity fed columns to profile the molecular size distribution of conjugates. Large molecules excluded from the pores in the media elute more quickly than small molecules. Fraction collectors are used to collect the column eluate. The fractions are tested colorimetrically by saccharide assay. For the determination of Kd, columns are calibrated to establish the fraction at which molecules are fully excluded (V0), (Kd=0), and the fraction representing the maximum retention (Vi), (Kd=1). The fraction at which a specified sample attribute is reached (Ve), is related to Kd by the expression, Kd = (Ve- V0) / (Vi- V0). In a preferred embodiment, at least 30% of the serotype 3 glycoconjugate has a Kd below or equal to 0.3 in a CL-4B column. In a preferred embodiment, at least 40% of the glycoconjugate has a Kdbelow or equal to 0.3 in a CL-4B column. In a preferred embodiment, at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, or 85% of the serotype 3 glycoconjugate has a Kd below or equal to 0.3 in a CL-4B column. In a preferred embodiment, at least 60% of the serotype 3 glycoconjugate has a Kd below or equal to 0.3 in a CL-4B column. In a preferred embodiment, between 50% and 80% of the serotype 3 glycoconjugate has a Kd below or equal to 0.3 in a CL-4B column. In a preferred embodiment, between 65% and 80% of the serotype 3 glycoconjugate has a Kd below or equal to 0.3 in a CL-4B column. 1.3 Streptococcus pneumoniae serotype 3 glycoconjugates of the invention prepared using click chemistry In an embodiment, serotype 3 glycoconjugates of the present invention are prepared using click chemistry. The invnetion also relates to a method of making a serotype 3 glycoconjugate, as disclosed herein. According to the present invention, click chemistry comprises three steps, (a) reacting an isolated serotype 3 capsular polysaccharide with a carbonic acid derivative and an azido linker in an aprotic solvent to produce an activated azido polysaccharide (activation of the polysaccharide), (b) reacting a carrier protein with an agent bearing an N- Hydroxysuccinimide (NHS) moiety and an alkyne group where the NHS moiety reacts with the amino groups to form an amide linkage thereby obtaining an alkyne functionalized carrier protein (activation of the carrier protein), (c) reacting the activated azido polysaccharide of step (a) with the activated alkyne-carrier protein of step (b) by Cu+1mediated azide-alkyne cycloaddition reaction to form a glycoconjugate. Following step (a) the polysaccharide is said to be activated and is referred to herein as “activated polysaccharide” or “activated azido polysaccharide”. Following step (b) the carrier is said to be activated and is referred to as “activated carrier”. As mentioned above, before the activation (a), sizing of the polysaccharide to a target molecular weight (MW) range can be performed. Therefore, in an embodiment, the isolated polysaccharide is sized before activation with a carbonic acid derivative and an azido linker. In an embodiment, the isolated polysaccharide is sized to any of the target molecular weight (MW) range defined above. In an embodiment, said carbonic acid derivative is selected from the group consisting of 1,1’-carbonyldiimidazole (CDI), 1,1’-carbonyl-di-(1,2,4-triazole) (CDT), disuccinimidyl carbonate (DSC) and N-hydroxysuccinimidyl chloroformate. In an embodiment, said carbonic acid derivative is 1,1’-carbonyldiimidazole (CDI). In an embodiment, said carbonic acid derivative is 1,1'-Carbonyl-di-(1,2,4-triazole) (CDT). In another embodiment, said carbonic acid derivative is disuccinimidyl carbonate (DSC). In yet a further embodiment, said carbonic acid derivative is N-hydroxysuccinimidyl chloroformate. In an embodiment, said carbonic acid derivative is 1,1’-carbonyldiimidazole (CDI) or 1,1'- Carbonyl-di-(1,2,4-triazole) (CDT). Preferably, said carbonic acid derivative is 1,1’- carbonyldiimidazole (CDI). In an embodiment, said azido linker is a compound of formula (I), wherein X is selected from the group consisting of CH2(CH2)n, (CH2CH2O)mCH2CH2, NHCO(CH2)n, NHCO(CH2CH2O)mCH2CH2, OCH2(CH2)n and O(CH2CH2O)mCH2CH2; where n is selected from 1 to 10 and m is selected from 1 to 4. In an embodiment, said azido linker is a compound of formula (I), wherein X is CH2(CH2)n, and n is selected from 1 to 10. In an embodiment, n is selected from 1 to 5. In an embodiment, n is selected from 1 to 4. In an embodiment, n is selected from 1 to 3. In an embodiment, n is selected from 1 to 2. In a particular embodiment, n is 1. In another embodiment, n is 2. In yet another embodiment, n is 3. In yet a further embodiment, n is 4. In yet a further embodiment, n is 5. In yet a further embodiment, n is 6. In yet a further embodiment, n is 7. In yet a further embodiment, n is 8. In yet a further embodiment, n is 9. In yet a further embodiment, n is 10. In an embodiment, said azido linker is a compound of formula (I), wherein X is (CH2CH2O)mCH2CH2, wherein m is selected from 1 to 4. In an embodiment, m is selected from 1 to 3. In an embodiment, m is selected from 1 to 2. In a particular embodiment, m is 1. In another embodiment, m is 2. In yet another embodiment, m is 3. In yet a further embodiment, m is 4. In an embodiment, said azido linker is a compound of formula (I), whereinin X is NHCO(CH2)n, and n is selected from 1 to 10. In an embodiment, n is selected from 1 to 5. In an embodiment, n is selected from 1 to 4. In an embodiment, n is selected from 1 to 3. In an embodiment, n is selected from 1 to 2. In a particular embodiment, n is 1. In another embodiment, n is 2. In yet another embodiment, n is 3. In yet a further embodiment, n is 4. In yet a further embodiment, n is 5. In yet a further embodiment, n is 6. In yet a further embodiment, n is 7. In yet a further embodiment, n is 8. In yet a further embodiment, n is 9. In yet a further embodiment, n is 10. In an embodiment, said azido linker is a compound of formula (I), wherein X is NHCO(CH2CH2O)mCH2CH2, where m is selected from 1 to 4. In an embodiment, m is selected from 1 to 3. In an embodiment, m is selected from 1 to 2. In a particular embodiment, m is 1. In another embodiment, m is 2. In yet another embodiment, m is 3. In yet a further embodiment, m is 4. In an embodiment, said azido linker is a compound of formula (I), wherein X is OCH2(CH2)n, and n is selected from 1 to 10. In an embodiment, n is selected from 1 to 5. In an embodiment, n is selected from 1 to 4. In an embodiment, n is selected from 1 to 3. In an embodiment, n is selected from 1 to 2. In a particular embodiment, n is 1. In another embodiment, n is 2. In yet another embodiment, n is 3. In yet a further embodiment, n is 4. In yet a further embodiment, n is 5. In yet a further embodiment, n is 6. In yet a further embodiment, n is 7. In yet a further embodiment, n is 8. In yet a further embodiment, n is 9. In yet a further embodiment, n is 10. In an embodiment, said azido linker is a compound of formula (I), wherein X is O(CH2CH2O)mCH2CH2, where m is selected from 1 to 4. In an embodiment, m is selected from 1 to 3. In an embodiment, m is selected from 1 to 2. In a particular embodiment, m is 1. In another embodiment, m is 2. In yet another embodiment, m is 3. In yet a further embodiment, m is 4. In an embodiment, said azido linker is a compound of formula (II), In an embodiment, said azido linker is 3-azido-propylamine. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is an agent bearing an N-Hydroxysuccinimide (NHS) moiety and a terminal alkyne. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is an agent bearing an N-Hydroxysuccinimide (NHS) moiety and a cycloalkyne. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (III), where X is selected from the group consisting of CH2O(CH2)nCH2C=O and CH2O(CH2CH2O)m(CH2)nCH2C=O, where n is selected from 0 to 10 and m is selected from 0 to 4. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (III), wherein X is CH2O(CH2)nCH2C=O, where n is selected from 0 to 10. In an embodiment, n is selected from 0 to 5. In an embodiment, n is selected from 0 to 4. In an embodiment, n is selected from 0 to 3. In an embodiment, n is selected from 0 to 2. In a particular embodiment, n is 0. In a particular embodiment, n is 1. In another embodiment, n is 2. In yet another embodiment, n is 3. In yet a further embodiment, n is 4. In yet a further embodiment, n is 5. In yet a further embodiment, n is 6. In yet a further embodiment, n is 7. In yet a further embodiment, n is 8. In yet a further embodiment, n is 9. In yet a further embodiment, n is 10. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (III), wherein X is CH2O(CH2CH2O)m(CH2)nCH2C=O, where n is selected from 0 to 10 and m is selected from 0 to 4. In an embodiment, n is selected from 0 to 5. In an embodiment, n is selected from 0 to 4. In an embodiment, n is selected from 0 to 3. In an embodiment, n is selected from 0 to 2. In a particular embodiment, n is 0. In a particular embodiment, n is 1. In another embodiment, n is 2. In yet another embodiment, n is 3. In yet a further embodiment, n is 4. In yet a further embodiment, n is 5. In yet a further embodiment, n is 6. In yet a further embodiment, n is 7. In yet a further embodiment, n is 8. In yet a further embodiment, n is 9. In yet a further embodiment, n is 10. In an embodiment, m is selected from 0 to 3. In an embodiment, m is selected from 0 to 2. In a particular embodiment, m is 1. In a particular embodiment, m is 1. In another embodiment, m is 2. In yet another embodiment, m is 3. In yet a further embodiment, m is 4. In an embodiment, n is selected from 0 to 5 and m is selected from 0 to 3. In an embodiment, n is selected from 0 to 5 and m is selected from 0 to 2. In an embodiment, n is selected from 0 to 4 and m is selected from 0 to 3. In an embodiment, n is selected from 0 to 4 and m is selected from 0 to 2. In an embodiment, n is selected from 0 to 3 and m is selected from 0 to 3. In an embodiment, n is selected from 0 to 3 and m is selected from 0 to 2. In an embodiment, n is selected from 0 to 2 and m is selected from 0 to 3. In an embodiment, n is selected from 0 to 2 and m is selected from 0 to 2. In an embodiment, n is selected from 0 to 1 and m is selected from 0 to 3. In an embodiment, n is selected from 0 to 1 and m is selected from 0 to 2. In an embodiment, n is 0 and m is 0. In an embodiment, n is 1 and m is 0. In an embodiment, n is 2 and m is 0. In an embodiment, n is 3 and m is 0. In an embodiment, n is 4 and m is 0. In an embodiment, n is 5 and m is 0. In an embodiment, n is 6 and m is 0. In an embodiment, n is 7 and m is 0. In an embodiment, n is 8 and m is 0. In an embodiment, n is 9 and m is 0. In an embodiment, n is 10 and m is 0. In an embodiment, n is 0 and m is 1. In an embodiment, n is 1 and m is 1. In an embodiment, n is 2 and m is 1. In an embodiment, n is 3 and m is 1. In an embodiment, n is 4 and m is 1. In an embodiment, n is 5 and m is 1. In an embodiment, n is 6 and m is 1. In an embodiment, n is 7 and m is 1. In an embodiment, n is 8 and m is 1. In an embodiment, n is 9 and m is 1. In an embodiment, n is 10 and m is 1. In an embodiment, n is 0 and m is 2. In an embodiment, n is 1 and m is 2. In an embodiment, n is 2 and m is 2. In an embodiment, n is 3 and m is 2. In an embodiment, n is 4 and m is 2. In an embodiment, n is 5 and m is 2. In an embodiment, n is 6 and m is 2. In an embodiment, n is 7 and m is 2. In an embodiment, n is 8 and m is 2. In an embodiment, n is 9 and m is 2. In an embodiment, n is 10 and m is 2. In an embodiment, n is 0 and m is 3. In an embodiment, n is 1 and m is 3. In an embodiment, n is 2 and m is 3. In an embodiment, n is 3 and m is 3. In an embodiment, n is 4 and m is 3. In an embodiment, n is 5 and m is 3. In an embodiment, n is 6 and m is 3. In an embodiment, n is 7 and m is 3. In an embodiment, n is 8 and m is 3. In an embodiment, n is 9 and m is 3. In an embodiment, n is 10 and m is 3. In an embodiment, n is 0 and m is 4. In an embodiment, n is 1 and m is 4. In an embodiment, n is 2 and m is 4. In an embodiment, n is 3 and m is 4. In an embodiment, n is 4 and m is 4. In an embodiment, n is 5 and m is 4. In an embodiment, n is 6 and m is 4. In an embodiment, n is 7 and m is 4. In an embodiment, n is 8 and m is 4. In an embodiment, n is 9 and m is 4. In an embodiment, n is 10 and m is 4. In an embodiment, said agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (IV): In an embodiment, step a) comprises reacting the polysaccharide with a carbonic acid derivative followed by reacting the carbonic acid derivative-activated polysaccharide with an azido linker in an aprotic solvent to produce an activated azido polysaccharide. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.5-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.8-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 1-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 2-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 3-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 5-10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.5-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.8-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 1-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 2-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 3-5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.5-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.8-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 1-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 2-3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.5-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.8-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 1-2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.5-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.8-1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.4-0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.3-0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.01-0.3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.05-0.3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.1-0.3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative that is between 0.2-0.3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.01 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.05 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.08 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 0.5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 1 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 2 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 3 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 4 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 5 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 8 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In one embodiment step a) comprises reacting the polysaccharide with an amount of carbonic acid derivative of about 10 molar equivalent to the amount of serotype 3 capsular polysaccharide present in the reaction mixture. In an embodiment, at step a) the isolated polysaccharide is reacted with a carbonic acid derivative in an aprotic solvent. In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of dimethylsulphoxide (DMSO) or dimethylformamide (DMF). In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of dimethylformamide (DMF). In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of dimethylsulphoxide (DMSO). In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of dimethylacetamide. In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of N-methyl-2-pyrrolidone. In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of hexamethylphosphoramide (HMPA). In a preferred embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in a solution consisting essentially of dimethylsulphoxide (DMSO). In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in dimethylsulphoxide (DMSO) or dimethylformamide (DMF). In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in dimethylformamide (DMF). In one embodiment the isolated polysaccharide is reacted with a carbonic acid derivative in dimethylsulphoxide (DMSO). In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in dimethylacetamide. In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in N-methyl-2-pyrrolidone. In an embodiment, the isolated polysaccharide is reacted with a carbonic acid derivative in hexamethylphosphoramide (HMPA). In a preferred embodiment the isolated polysaccharide is reacted with CDI in dimethylsulphoxide (DMSO). In an embodiment the isolated polysaccharide is reacted with CDI in anhydrous DMSO. It has been surprisingly found that reacting the isolated polysaccharide with CDI in an environment with a moisture level of about 0.1% to 1% (v / v) allows to avoid side reactions. Therefore, in one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 0.8% (v / v)water.In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.1% to 0.2% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.2% to 1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.2% to 0.8% (v / v) water.In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.2% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.2% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.2% to 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.3% to 0.8% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.3% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising 0.3% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.2% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.6% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.7% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.8% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in an aprotic solvent comprising about 0.9% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 0.8% (v / v) water.In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.1% to 0.2% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.2% to 1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.2% to 0.8% (v / v) water.In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.2% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.2% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.2% to 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.3% to 0.8% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.3% to 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising 0.3% to 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.1% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.2% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.3% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.4% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.5% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.6% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.7% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.8% (v / v) water. In one embodiment the isolated polysaccharide is reacted with CDI in DMSO comprising about 0.9% (v / v) water. In one embodiment the free carbonic acid derivative is then quenched by the addition of water before the addition of the azido linker. Water can inactivate free CDI. Therefore, in an embodiment, carbonic acid derivative activation is followed by the addition of water. In an embodiment, water is added to bring the total water content in the mixture to between about 1% to about 10% (v / v). In an embodiment, water is added to bring the total water content in the mixture to between about 1.2% to about 8% (v / v). In an embodiment, water is added to bring the total water content in the mixture to between about 1.5% to about 5% (v / v). In an embodiment, water is added to bring the total water content in the mixture to between about 1.5% to about 3% (v / v). In an embodiment, water is added to bring the total water content in the mixture to between about 1.5% to about 2.5% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 1 % (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 1.2% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 1.4% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 1.5% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 2% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 2.5% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 3% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 5% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 7% (v / v). In an embodiment, water is added to bring the total water content in the mixture to about 10% (v / v). Once the polysaccharide has been reacted with carbonic acid derivative, and following an eventual quenching of carbonic acid derivative with water, the carbonic acid derivative- activated polysaccharide is reacted with an azido linker. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-10 molar equivalent to the amount of polysaccharide Repeat Unit of the activated polysaccharide (molar equivalent of RU). In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-2 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.01-0.1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-2 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.05-0.1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-2 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.1-0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-2 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 0.5-1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 1-2 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 2-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 2-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 2-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 2-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 2-3 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 3-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 3-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 3-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 3-4 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 4-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 4-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 4-5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 5-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 5-8 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is between 8-10 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 0.01 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 0.05 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 0.1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 3 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 4 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 8 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In one embodiment step a) further comprises reacting the carbonic acid derivative- activated polysaccharide with an amount of azido linker that is about 10 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In the above embodiements, said carbonic acid derivative is preferably CDI. In another embodiment, said carbonic acid derivative is CDT. In one embodiment the degree of activation of the activated polysaccharide following step a) is between 0.5 to 50%. The degree of activation of the azido polysaccharide being defined as the percentage of Repeating Unit linked to an azido linker. In one embodiment the degree of activation of the activated polysaccharide following step a) is between 1 to 30%. In another embodiment the degree of activation of the activated polysaccharide following step a) is between 2 to 25%. In another embodiment the degree of activation of the activated polysaccharide following step a) is between 3 to 20%. In another embodiment the degree of activation of the activated polysaccharide following step a) is between 3 to 15%. In another embodiment the degree of activation of the activated polysaccharide following step a) is between 4 to 15%. In an embodiment the degree of activation of the activated polysaccharide following step a) is between 1 to 6%. In an embodiment the degree of activation of the activated polysaccharide following step a) is between 3 to 6%. In an embodiment the degree of activation of the activated polysaccharide following step a) is between 10 to 15%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 1%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 2%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 3%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 4%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 5%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 6%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 7%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 8%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 9%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 10%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 11%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 12%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 13%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 14%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 15%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 16%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 17%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 18%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 19%. In an embodiment the degree of activation of the activated polysaccharide following step a) is about 20%. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2.5-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 3-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 5-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 7.5-10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2.5-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 3-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 5-7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2.5-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 3-5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2.5-3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 2-2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-2 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-2 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-2 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1.5-2 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-1.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-1.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 1-1.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-1 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.5-1 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-0.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 10 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 7.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 3 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 2.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 2 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 1.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 1 molar equivalent to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 0.5 molar equivalents to the lysines on the carrier. In one embodiment step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is about 0.1 molar equivalents to the lysines on the carrier. In one embodiment the degree of activation of the activated carrier following step b) is between 1 and 50. The degree of activation of the activated carrier being defined as the number of lysine residues in the carrier protein that become linked to the agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group . In an embodiment, the carrier protein is CRM197, which contains 39 lysine residues. In said embodiment the degree of activation of the activated carrier following step b) may be between 1 to 30. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is between 5 to 20. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is between 9 to 18. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is between 8 to 11. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is between 15 to 20. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 5. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 6. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 7. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 8. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 9. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 10. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 11. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 12. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 13. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 14. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 15. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 16. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 17. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 18. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 19. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 20. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 21. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 22. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 23. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 24. In another embodiment the degree of activation of the activated carrier (CRM197) following step b) is about 25. In an embodiment, the carrier protein is SCP or a fragment thereof. In said embodiment the degree of activation of the activated carrier following step b) may be between 1 to 50. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 5 to 50. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 7 to 45. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 5 to 15. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 20 to 30. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 30 to 50. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 30 to 40. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is between 10 to 40. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 5. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 7. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 10. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 13. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 15. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 20. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 26. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 30. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 35. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 37. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 40. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 45. In another embodiment the degree of activation of the activated carrier (SCP) following step b) is about 50. In an embodiment, the carrier protein is TT or a fragment thereof. In said embodiment the degree of activation of the activated carrier following step b) may be between 1 to 30. In another embodiment the degree of activation of the activated carrier (TT) following step b) is between 5 to 25. In another embodiment the degree of activation of the activated carrier (TT) following step b) is between 7 to 25. In another embodiment the degree of activation of the activated carrier (TT) following step b) is between 10 to 20. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 5. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 7. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 10. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 12. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 15. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 20. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 25. In another embodiment the degree of activation of the activated carrier (TT) following step b) is about 30. In an embodiment, the conjugation reaction c) is carried out in aqueous buffer. In an embodiment, the conjugation reaction c) is carried out in aqueous buffer in the presence of copper (I) as catalyst. In an embodiment, the conjugation reaction c) is carried out in aqueous buffer in the presence an oxidant and of copper (I) as catalyst. In a preferred embodiment, the conjugation reaction c) is carried out in aqueous buffer in the presence of copper (I) as catalyst and ascorbate as oxidant. In an embodiment, THPTA (tris(3- hydroxypropyltriazolylmethyl)amine) and aminoguanidine may be further added to protect the protein from side reactions. Therefore, in a preferred embodiment, the conjugation reaction c) is carried out in aqueous buffer in the presence of copper (I) as catalyst and ascorbate as oxidant, wherein the reaction mixture further comprises THPTA (tris(3- hydroxypropyltriazolylmethyl)amine) and aminoguanidine. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is between 0.1 and 3. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is between 0.5 and 2. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is between 0.6 and 1.5. In a preferred embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is between 0.8 and 1. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 0.5. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne- carrier at setp c) is about 0.6. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 0.7. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 0.8. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 0.9. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne- carrier at setp c) is about 1.1. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.2. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.3. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.4. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.5. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne- carrier at setp c) is about 1.6. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.7. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.8. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 1.9. In an embodiment the initial input ratio (weight by weight) of activated azido polysaccharide to activated alkyne-carrier at setp c) is about 2. Following the click conjugation reaction, there may remain unreacted azido groups in the conjugates, these may be capped using a suitable azido group capping agent. Therefore, in an embodiment, following step c), unreacted azido groups in the conjugates, are capped using a suitable azido group capping agent. In one embodiment this azido group capping agent is an agent bearing an alkyne group. In one embodiment this azido group capping agent is an agent bearing a terminal alkyne. In one embodiment this azido group capping agent is an agent bearing a cycloalkyne. In an embodiment, said azido group capping agent is a compound of formula (V), wherein X is (CH2)nwherein n is selected from 1 to 15. In one embodiment this azido group capping agent is propargyl alcohol. Therefore, in an embodiment, following step (c) the process further comprises a step of capping the unreacted azido groups remained in the conjugates with an azido group capping agent. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.05 to 20 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.1 to 15 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.5 to 10 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.5 to 5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.5 to 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.5 to 1 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 1 to 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is between 0.75 to 1.5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is about 1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is about 1.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is about 0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted azido groups is performed with an amount of capping agent that is about 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. Following the click conjugation reaction, unreacted alkyne groups may remain present in the conjugates, these may be capped using a suitable alkyne group capping agent. In one embodiment this alkyne group capping agent is an agent bearing an azido group. In an embodiment, said alkyne group capping agent is a compound of formula (VI), wherein X is (CH2)n wherein n is selected from 1 to 15. In one embodiment this alkyne group capping agent is 3-azido-1-propanol. Therefore, in an embodiment, following step (c) the process further comprises a step of capping the unreacted alkyne groups remained in the conjugates with an alkyne group capping agent. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.05 to 20 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.1 to 15 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.5 to 10 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.5 to 5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.5 to 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 0.5 to 1 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 1 to 5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 1 to 2 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that is between 1.5 to 2.5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 0.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 1 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 1.5 molar equivalent to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 2 molar equivalentS to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 2.5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. In an embodiment the capping of the unreacted alkyne groups is performed with an amount of capping agent that about 5 molar equivalents to the amount of polysaccharide repeat unit of the activated polysaccharide. Following conjugation to the carrier protein, the glycoconjugate can be purified (enriched with respect to the amount of saccharide-protein conjugate) by a variety of techniques known to the skilled person. These techniques include dialysis, concentration / diafiltration operations, tangential flow filtration precipitation / elution, column chromatography (DEAE or hydrophobic interaction chromatography), and depth filtration. Therefore, in one embodiment the process for producing the glycoconjugate of the present invention comprises the step of purifying the glycoconjugate after it is produced. In an aspect, the invention provides a serotype 3 glycoconjugate produced according to any of the methods disclosed herein. In an aspect, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII): wherein X is selected from the group consisting of CH2(CH2)n’, (CH2CH2O)mCH2CH2, NHCO(CH2)n’, NHCO(CH2CH2O)mCH2CH2, OCH2(CH2)n’ and O(CH2CH2O)mCH2CH2; where n’ is selected from 1 to 10 and m is selected from 1 to 4, and wherein X' is selected from the group consisting of CH2O(CH2)n’’CH2C=O, CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. Formula (VII) is a schematic representation of serotype 3 glycoconjugates of the invention. It should not be understood that a linkage is present at every repeating unit of the saccharide. Rather, a majority of the S. pneumoniae serotype 3 saccharide repeating unit remains unmodified and covalent linkages between the carrier protein and the saccharide is for a minority of the saccharide repeat units. Additionally, an individual carrier protein (CP) molecule may be linked to more than one S. pneumoniae serotype 3 saccharide molecule and an individual S. pneumoniae serotype 3 saccharide molecule can be linked to more than one individual carrier protein (CP) molecule. In a preferred embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is CH2(CH2)n’, where n’ is 2 and wherein X' is CH2O(CH2)n’’CH2C=O where n" is 1. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is CH2(CH2)n’, where n’ is selected from 1 to 10 and werein X' is CH2O(CH2)n’’CH2C=O where n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, n’ is 1 and n" is 0. In another embodiment, n’ is 2 and n" is 0. In yet another embodiment, n’ is 3 and n" is 0. In yet a further embodiment, n’ is 4 and n” is 0. In yet a further embodiment, n’ is 5 and n” is 0. In yet a further embodiment, n’ is 6 and n” is 0. In a particular embodiment, n’ is 1 and n" is 1. In another embodiment, n’ is 2 and n" is 1. In yet another embodiment, n’ is 3 and n" is 1. In yet a further embodiment, n’ is 4 and n” is 1. In yet a further embodiment, n’ is 5 and n” is 1. In yet a further embodiment, n’ is 6 and n” is 1. In a particular embodiment, n’ is 1 and n" is 2. In another embodiment, n’ is 2 and n" is 2. In yet another embodiment, n’ is 3 and n" is 2. In yet a further embodiment, n’ is 4 and n” is 2. In yet a further embodiment, n’ is 5 and n” is 2. In yet a further embodiment, n’ is 6 and n” is 2. In a particular embodiment, n’ is 1 and n" is 3. In another embodiment, n’ is 2 and n" is 3. In yet another embodiment, n’ is 3 and n" is 3. In yet a further embodiment, n’ is 4 and n” is 3. In yet a further embodiment, n’ is 5 and n” is 3. In yet a further embodiment, n’ is 6 and n” is 3. In a particular embodiment, n’ is 1 and n" is 4. In another embodiment, n’ is 2 and n" is 4. In yet another embodiment, n’ is 3 and n" is 4. In yet a further embodiment, n’ is 4 and n” is 4. In yet a further embodiment, n’ is 5 and n” is 4. In yet a further embodiment, n’ is 6 and n” is 4. In a particular embodiment, n’ is 1 and n" is 5. In another embodiment, n’ is 2 and n" is 5. In yet another embodiment, n’ is 3 and n" is 5. In yet a further embodiment, n’ is 4 and n” is 5. In yet a further embodiment, n’ is 5 and n” is 5. In yet a further embodiment, n’ is 6 and n” is 5. In a particular embodiment, n’ is 1 and n" is 6. In another embodiment, n’ is 2 and n" is 6. In yet another embodiment, n’ is 3 and n" is 6. In yet a further embodiment, n’ is 4 and n” is 6. In yet a further embodiment, n’ is 5 and n” is 6. In yet a further embodiment, n’ is 6 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is CH2(CH2)n’, where n’ is selected from 1 to 10 and werein CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 0. In another embodiment, n’ is 1, m’ is 1 and n" is 0. In another embodiment, n’ is 1, m’ is 2 and n" is 0. In another embodiment, n’ is 1, m’ is 3 and n" is 0. In another embodiment, n’ is 2, m’ is 0 and n" is 0. In another embodiment, n’ is 2, m’ is 1 and n" is 0. In another embodiment, n’ is 2, m’ is 2 and n" is 0. In another embodiment, n’ is 2, m’ is 3 and n" is 0. In yet another embodiment, n’ is 3, m’ is 0 and n" is 0. In yet another embodiment, n’ is 3, m’ is 1 and n" is 0. In yet another embodiment, n’ is 3, m’ is 2 and n" is 0. In yet another embodiment, n’ is 3, m’ is 3 and n" is 0. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 0.In yet a further embodiment, n’ is 5, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 0. In a particular embodiment, n’ is 1, m’ is 0 and n" is 1. In a particular embodiment, n’ is 1, m’ is 1 and n" is 1. In a particular embodiment, n’ is 1, m’ is 2 and n" is 1. In a particular embodiment, n’ is 1, m’ is 3 and n" is 1. In another embodiment, n’ is 2, m’ is 0 and n" is 1. In another embodiment, n’ is 2, m’ is 1 and n" is 1. In another embodiment, n’ is 2, m’ is 2 and n" is 1. In another embodiment, n’ is 2, m’ is 3 and n" is 1. In yet another embodiment, n’ is 3, m’ is 0 and n" is 1. In yet another embodiment, n’ is 3, m’ is 1 and n" is 1. In yet another embodiment, n’ is 3, m’ is 2 and n" is 1. In yet another embodiment, n’ is 3, m’ is 3 and n" is 1. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 2. In a particular embodiment, n’ is 1, m’ is 1 and n" is 2. In a particular embodiment, n’ is 1, m’ is 2 and n" is 2. In a particular embodiment, n’ is 1, m’ is 3 and n" is 2. In another embodiment, n’ is 2, m’ is 0 and n" is 2. In another embodiment, n’ is 2, m’ is 1 and n" is 2. In another embodiment, n’ is 2, m’ is 2 and n" is 2. In another embodiment, n’ is 2, m’ is 3 and n" is 2. In yet another embodiment, n’ is 3, m’ is 0 and n" is 2. In yet another embodiment, n’ is 3, m’ is 1 and n" is 2. In yet another embodiment, n’ is 3, m’ is 2 and n" is 2. In yet another embodiment, n’ is 3, m’ is 3 and n" is 2. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 2. In a particular embodiment, n’ is 1, m’ is 0 and n" is 3. In a particular embodiment, n’ is 1, m’ is 1 and n" is 3. In a particular embodiment, n’ is 1, m’ is 2 and n" is 3. In a particular embodiment, n’ is 1, m’ is 3 and n" is 3. In another embodiment, n’ is 2, m’ is 0 and n" is 3. In another embodiment, n’ is 2, m’ is 1 and n" is 3. In another embodiment, n’ is 2, m’ is 2 and n" is 3. In another embodiment, n’ is 2, m’ is 3 and n" is 3. In yet another embodiment, n’ is 3, m’ is 0 and n" is 3. In yet another embodiment, n’ is 3, m’ is 1 and n" is 3. In yet another embodiment, n’ is 3, m’ is 2 and n" is 3. In yet another embodiment, n’ is 3, m’ is 3 and n" is 3. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 3. In a particular embodiment, n’ is 1, m’ is 0 and n" is 4. In a particular embodiment, n’ is 1, m’ is 1 and n" is 4. In a particular embodiment, n’ is 1, m’ is 2 and n" is 4. In a particular embodiment, n’ is 1, m’ is 3 and n" is 4. In another embodiment, n’ is 2, m’ is 0 and n" is 4. In another embodiment, n’ is 2, m’ is 1 and n" is 4. In another embodiment, n’ is 2, m’ is 2 and n" is 4. In another embodiment, n’ is 2, m’ is 3 and n" is 4. In yet another embodiment, n’ is 3, m’ is 0 and n" is 4. In yet another embodiment, n’ is 3, m’ is 1 and n" is 4. In yet another embodiment, n’ is 3, m’ is 2 and n" is 4. In yet another embodiment, n’ is 3, m’ is 3 and n" is 4. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 4. In a particular embodiment, n’ is 1, m’ is 0 and n" is 5. In a particular embodiment, n’ is 1, m’ is 1 and n" is 5. In a particular embodiment, n’ is 1, m’ is 2 and n" is 5. In a particular embodiment, n’ is 1, m’ is 3 and n" is 5. In another embodiment, n’ is 2, m’ is 0 and n" is 5. In another embodiment, n’ is 2, m’ is 1 and n" is 5. In another embodiment, n’ is 2, m’ is 2 and n" is 5. In another embodiment, n’ is 2, m’ is 3 and n" is 5. In yet another embodiment, n’ is 3, m’ is 0 and n" is 5. In yet another embodiment, n’ is 3, m’ is 1 and n" is 5. In yet another embodiment, n’ is 3, m’ is 2 and n" is 5. In yet another embodiment, n’ is 3, m’ is 3 and n" is 5. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 5. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is (CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and werein X' is CH2O(CH2)n’’CH2C=O, where n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, m is 1 and n" is 0. In another embodiment, m is 2 and n" is 0. In yet another embodiment, m is 3 and n" is 0. In yet a further embodiment, m is 4 and n” is 0. In a particular embodiment, m is 1 and n" is 1. In another embodiment, m is 2 and n" is 1. In yet another embodiment, m is 3 and n" is 1. In yet a further embodiment, m is 4 and n” is 1. In a particular embodiment, m is 1 and n" is 2. In another embodiment, m is 2 and n" is 2. In yet another embodiment, m is 3 and n" is 2. In yet a further embodiment, m is 4 and n” is 2. In a particular embodiment, m is 1 and n" is 3. In another embodiment, m is 2 and n" is 3. In yet another embodiment, m is 3 and n" is 3. In yet a further embodiment, m is 4 and n” is 3. In a particular embodiment, m is 1 and n" is 4. In another embodiment, m is 2 and n" is 4. In yet another embodiment, m is 3 and n" is 4. In yet a further embodiment, m is 4 and n” is 4. In a particular embodiment, m is 1 and n" is 5. In another embodiment, m is 2 and n" is 5. In yet another embodiment, m is 3 and n" is 5. In yet a further embodiment, m is 4 and n” is 5. In a particular embodiment, m is 1 and n" is 6. In another embodiment, m is 2 and n" is 6. In yet another embodiment, m is 3 and n" is 6. In yet a further embodiment, m is 4 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is (CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and werein X' is CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, m is selected from 1 to 3, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, m is 1, m’ is 0 and n" is 0. In another embodiment, m is 1, m’ is 1 and n" is 0. In another embodiment, m is 1, m’ is 2 and n" is 0. In another embodiment, m is 1, m’ is 3 and n" is 0. In another embodiment, m is 2, m’ is 0 and n" is 0. In another embodiment, m is 2, m’ is 1 and n" is 0. In another embodiment, m is 2, m’ is 2 and n" is 0. In another embodiment, m is 2, m’ is 3 and n" is 0. In yet another embodiment, m is 3, m’ is 0 and n" is 0. In yet another embodiment, m is 3, m’ is 1 and n" is 0. In yet another embodiment, m is 3, m’ is 2 and n" is 0. In yet another embodiment, m is 3, m’ is 3 and n" is 0. In yet a further embodiment, m is 4, m’ is 0 and n” is 0. In yet a further embodiment, m is 4, m’ is 1 and n” is 0. In yet a further embodiment, m is 4, m’ is 2 and n” is 0. In yet a further embodiment, m is 4, m’ is 3 and n” is 0. In a particular embodiment, m is 1, m’ is 0 and n" is 1. In a particular embodiment, m is 1, m’ is 1 and n" is 1. In a particular embodiment, m is 1, m’ is 2 and n" is 1. In a particular embodiment, m is 1, m’ is 3 and n" is 1. In another embodiment, m is 2, m’ is 0 and n" is 1. In another embodiment, m is 2, m’ is 1 and n" is 1. In another embodiment, m is 2, m’ is 2 and n" is 1. In another embodiment, m is 2, m’ is 3 and n" is 1. In yet another embodiment, m is 3, m’ is 0 and n" is 1. In yet another embodiment, m is 3, m’ is 1 and n" is 1. In yet another embodiment, m is 3, m’ is 2 and n" is 1. In yet another embodiment, m is 3, m’ is 3 and n" is 1. In yet a further embodiment, m is 4, m’ is 0 and n” is 1. In yet a further embodiment, m is 4, m’ is 1 and n” is 1. In yet a further embodiment, m is 4, m’ is 2 and n” is 1. In yet a further embodiment, m is 4, m’ is 3 and n” is 1. In a particular embodiment, m is 1, m’ is 0 and n" is 2. In a particular embodiment, m is 1, m’ is 1 and n" is 2. In a particular embodiment, m is 1, m’ is 2 and n" is 2. In a particular embodiment, m is 1, m’ is 3 and n" is 2. In another embodiment, m is 2, m’ is 0 and n" is 2. In another embodiment, m is 2, m’ is 1 and n" is 2. In another embodiment, m is 2, m’ is 2 and n" is 2. In another embodiment, m is 2, m’ is 3 and n" is 2. In yet another embodiment, m is 3, m’ is 0 and n" is 2. In yet another embodiment, m is 3, m’ is 1 and n" is 2. In yet another embodiment, m is 3, m’ is 2 and n" is 2. In yet another embodiment, m is 3, m’ is 3 and n" is 2. In yet a further embodiment, m is 4, m’ is 0 and n” is 2. In yet a further embodiment, m is 4, m’ is 1 and n” is 2. In yet a further embodiment, m is 4, m’ is 2 and n” is 2. In yet a further embodiment, m is 4, m’ is 3 and n” is 2. In a particular embodiment, m is 1, m’ is 0 and n" is 3. In a particular embodiment, m is 1, m’ is 1 and n" is 3. In a particular embodiment, m is 1, m’ is 2 and n" is 3. In a particular embodiment, m is 1, m’ is 3 and n" is 3. In another embodiment, m is 2, m’ is 0 and n" is 3. In another embodiment, m is 2, m’ is 1 and n" is 3. In another embodiment, m is 2, m’ is 2 and n" is 3. In another embodiment, m is 2, m’ is 3 and n" is 3. In yet another embodiment, m is 3, m’ is 0 and n" is 3. In yet another embodiment, m is 3, m’ is 1 and n" is 3. In yet another embodiment, m is 3, m’ is 2 and n" is 3. In yet another embodiment, m is 3, m’ is 3 and n" is 3. In yet a further embodiment, m is 4, m’ is 0 and n” is 3. In yet a further embodiment, m is 4, m’ is 1 and n” is 3. In yet a further embodiment, m is 4, m’ is 2 and n” is 3. In yet a further embodiment, m is 4, m’ is 3 and n” is 3. In a particular embodiment, m is 1, m’ is 0 and n" is 4. In a particular embodiment, m is 1, m’ is 1 and n" is 4. In a particular embodiment, m is 1, m’ is 2 and n" is 4. In a particular embodiment, m is 1, m’ is 3 and n" is 4. In another embodiment, m is 2, m’ is 0 and n" is 4. In another embodiment, m is 2, m’ is 1 and n" is 4. In another embodiment, m is 2, m’ is 2 and n" is 4. In another embodiment, m is 2, m’ is 3 and n" is 4. In yet another embodiment, m is 3, m’ is 0 and n" is 4. In yet another embodiment, m is 3, m’ is 1 and n" is 4. In yet another embodiment, m is 3, m’ is 2 and n" is 4. In yet another embodiment, m is 3, m’ is 3 and n" is 4. In yet a further embodiment, m is 4, m’ is 0 and n” is 4. In yet a further embodiment, m is 4, m’ is 1 and n” is 4. In yet a further embodiment, m is 4, m’ is 2 and n” is 4. In yet a further embodiment, m is 4, m’ is 3 and n” is 4. In a particular embodiment, m is 1, m’ is 0 and n" is 5. In a particular embodiment, m is 1, m’ is 1 and n" is 5. In a particular embodiment, m is 1, m’ is 2 and n" is 5. In a particular embodiment, m is 1, m’ is 3 and n" is 5. In another embodiment, m is 2, m’ is 0 and n" is 5. In another embodiment, m is 2, m’ is 1 and n" is 5. In another embodiment, m is 2, m’ is 2 and n" is 5. In another embodiment, m is 2, m’ is 3 and n" is 5. In yet another embodiment, m is 3, m’ is 0 and n" is 5. In yet another embodiment, m is 3, m’ is 1 and n" is 5. In yet another embodiment, m is 3, m’ is 2 and n" is 5. In yet another embodiment, m is 3, m’ is 3 and n" is 5. In yet a further embodiment, m is 4, m’ is 0 and n” is 5. In yet a further embodiment, m is 4, m’ is 1 and n” is 5. In yet a further embodiment, m is 4, m’ is 2 and n” is 5. In yet a further embodiment, m is 4, m’ is 3 and n” is 5. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is NHCO(CH2)n’, where n’ is selected from 1 to 10 and werein X' is CH2O(CH2)n’’CH2C=O, where n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, n’ is 1 and n" is 0. In another embodiment, n’ is 2 and n" is 0. In yet another embodiment, n’ is 3 and n" is 0. In yet a further embodiment, n’ is 4 and n” is 0. In yet a further embodiment, n’ is 5 and n” is 0. In yet a further embodiment, n’ is 6 and n” is 0. In a particular embodiment, n’ is 1 and n" is 1. In another embodiment, n’ is 2 and n" is 1. In yet another embodiment, n’ is 3 and n" is 1. In yet a further embodiment, n’ is 4 and n” is 1. In yet a further embodiment, n’ is 5 and n” is 1. In yet a further embodiment, n’ is 6 and n” is 1. In a particular embodiment, n’ is 1 and n" is 2. In another embodiment, n’ is 2 and n" is 2. In yet another embodiment, n’ is 3 and n" is 2. In yet a further embodiment, n’ is 4 and n” is 2. In yet a further embodiment, n’ is 5 and n” is 2. In yet a further embodiment, n’ is 6 and n” is 2. In a particular embodiment, n’ is 1 and n" is 3. In another embodiment, n’ is 2 and n" is 3. In yet another embodiment, n’ is 3 and n" is 3. In yet a further embodiment, n’ is 4 and n” is 3. In yet a further embodiment, n’ is 5 and n” is 3. In yet a further embodiment, n’ is 6 and n” is 3. In a particular embodiment, n’ is 1 and n" is 4. In another embodiment, n’ is 2 and n" is 4. In yet another embodiment, n’ is 3 and n" is 4. In yet a further embodiment, n’ is 4 and n” is 4. In yet a further embodiment, n’ is 5 and n” is 4. In yet a further embodiment, n’ is 6 and n” is 4. In a particular embodiment, n’ is 1 and n" is 5. In another embodiment, n’ is 2 and n" is 5. In yet another embodiment, n’ is 3 and n" is 5. In yet a further embodiment, n’ is 4 and n” is 5. In yet a further embodiment, n’ is 5 and n” is 5. In yet a further embodiment, n’ is 6 and n” is 5. In a particular embodiment, n’ is 1 and n" is 6. In another embodiment, n’ is 2 and n" is 6. In yet another embodiment, n’ is 3 and n" is 6. In yet a further embodiment, n’ is 4 and n” is 6. In yet a further embodiment, n’ is 5 and n” is 6. In yet a further embodiment, n’ is 6 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is NHCO(CH2)n’, where n’ is selected from 1 to 10 and werein X' is CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 0. In another embodiment, n’ is 1, m’ is 1 and n" is 0. In another embodiment, n’ is 1, m’ is 2 and n" is 0. In another embodiment, n’ is 1, m’ is 3 and n" is 0. In another embodiment, n’ is 2, m’ is 0 and n" is 0. In another embodiment, n’ is 2, m’ is 1 and n" is 0. In another embodiment, n’ is 2, m’ is 2 and n" is 0. In another embodiment, n’ is 2, m’ is 3 and n" is 0. In yet another embodiment, n’ is 3, m’ is 0 and n" is 0. In yet another embodiment, n’ is 3, m’ is 1 and n" is 0. In yet another embodiment, n’ is 3, m’ is 2 and n" is 0. In yet another embodiment, n’ is 3, m’ is 3 and n" is 0. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 0.In yet a further embodiment, n’ is 5, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 0. In a particular embodiment, n’ is 1, m’ is 0 and n" is 1. In a particular embodiment, n’ is 1, m’ is 1 and n" is 1. In a particular embodiment, n’ is 1, m’ is 2 and n" is 1. In a particular embodiment, n’ is 1, m’ is 3 and n" is 1. In another embodiment, n’ is 2, m’ is 0 and n" is 1. In another embodiment, n’ is 2, m’ is 1 and n" is 1. In another embodiment, n’ is 2, m’ is 2 and n" is 1. In another embodiment, n’ is 2, m’ is 3 and n" is 1. In yet another embodiment, n’ is 3, m’ is 0 and n" is 1. In yet another embodiment, n’ is 3, m’ is 1 and n" is 1. In yet another embodiment, n’ is 3, m’ is 2 and n" is 1. In yet another embodiment, n’ is 3, m’ is 3 and n" is 1. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 2. In a particular embodiment, n’ is 1, m’ is 1 and n" is 2. In a particular embodiment, n’ is 1, m’ is 2 and n" is 2. In a particular embodiment, n’ is 1, m’ is 3 and n" is 2. In another embodiment, n’ is 2, m’ is 0 and n" is 2. In another embodiment, n’ is 2, m’ is 1 and n" is 2. In another embodiment, n’ is 2, m’ is 2 and n" is 2. In another embodiment, n’ is 2, m’ is 3 and n" is 2. In yet another embodiment, n’ is 3, m’ is 0 and n" is 2. In yet another embodiment, n’ is 3, m’ is 1 and n" is 2. In yet another embodiment, n’ is 3, m’ is 2 and n" is 2. In yet another embodiment, n’ is 3, m’ is 3 and n" is 2. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 2. In a particular embodiment, n’ is 1, m’ is 0 and n" is 3. In a particular embodiment, n’ is 1, m’ is 1 and n" is 3. In a particular embodiment, n’ is 1, m’ is 2 and n" is 3. In a particular embodiment, n’ is 1, m’ is 3 and n" is 3. In another embodiment, n’ is 2, m’ is 0 and n" is 3. In another embodiment, n’ is 2, m’ is 1 and n" is 3. In another embodiment, n’ is 2, m’ is 2 and n" is 3. In another embodiment, n’ is 2, m’ is 3 and n" is 3. In yet another embodiment, n’ is 3, m’ is 0 and n" is 3. In yet another embodiment, n’ is 3, m’ is 1 and n" is 3. In yet another embodiment, n’ is 3, m’ is 2 and n" is 3. In yet another embodiment, n’ is 3, m’ is 3 and n" is 3. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 3. In a particular embodiment, n’ is 1, m’ is 0 and n" is 4. In a particular embodiment, n’ is 1, m’ is 1 and n" is 4. In a particular embodiment, n’ is 1, m’ is 2 and n" is 4. In a particular embodiment, n’ is 1, m’ is 3 and n" is 4. In another embodiment, n’ is 2, m’ is 0 and n" is 4. In another embodiment, n’ is 2, m’ is 1 and n" is 4. In another embodiment, n’ is 2, m’ is 2 and n" is 4. In another embodiment, n’ is 2, m’ is 3 and n" is 4. In yet another embodiment, n’ is 3, m’ is 0 and n" is 4. In yet another embodiment, n’ is 3, m’ is 1 and n" is 4. In yet another embodiment, n’ is 3, m’ is 2 and n" is 4. In yet another embodiment, n’ is 3, m’ is 3 and n" is 4. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 4. In a particular embodiment, n’ is 1, m’ is 0 and n" is 5. In a particular embodiment, n’ is 1, m’ is 1 and n" is 5. In a particular embodiment, n’ is 1, m’ is 2 and n" is 5. In a particular embodiment, n’ is 1, m’ is 3 and n" is 5. In another embodiment, n’ is 2, m’ is 0 and n" is 5. In another embodiment, n’ is 2, m’ is 1 and n" is 5. In another embodiment, n’ is 2, m’ is 2 and n" is 5. In another embodiment, n’ is 2, m’ is 3 and n" is 5. In yet another embodiment, n’ is 3, m’ is 0 and n" is 5. In yet another embodiment, n’ is 3, m’ is 1 and n" is 5. In yet another embodiment, n’ is 3, m’ is 2 and n" is 5. In yet another embodiment, n’ is 3, m’ is 3 and n" is 5. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 5. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is NHCO(CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and werein X' is CH2O(CH2)n’’CH2C=O, where n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, m is 1 and n" is 0. In another embodiment, m is 2 and n" is 0. In yet another embodiment, m is 3 and n" is 0. In yet a further embodiment, m is 4 and n” is 0. In a particular embodiment, m is 1 and n" is 1. In another embodiment, m is 2 and n" is 1. In yet another embodiment, m is 3 and n" is 1. In yet a further embodiment, m is 4 and n” is 1. In a particular embodiment, m is 1 and n" is 2. In another embodiment, m is 2 and n" is 2. In yet another embodiment, m is 3 and n" is 2. In yet a further embodiment, m is 4 and n” is 2. In a particular embodiment, m is 1 and n" is 3. In another embodiment, m is 2 and n" is 3. In yet another embodiment, m is 3 and n" is 3. In yet a further embodiment, m is 4 and n” is 3. In a particular embodiment, m is 1 and n" is 4. In another embodiment, m is 2 and n" is 4. In yet another embodiment, m is 3 and n" is 4. In yet a further embodiment, m is 4 and n” is 4. In a particular embodiment, m is 1 and n" is 5. In another embodiment, m is 2 and n" is 5. In yet another embodiment, m is 3 and n" is 5. In yet a further embodiment, m is 4 and n” is 5. In a particular embodiment, m is 1 and n" is 6. In another embodiment, m is 2 and n" is 6. In yet another embodiment, m is 3 and n" is 6. In yet a further embodiment, m is 4 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is NHCO(CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and werein X' is CH2O(CH2CH2O)m’(CH2) n"C H2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, m is selected from 1 to 3, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, m is 1, m’ is 0 and n" is 0. In another embodiment, m is 1, m’ is 1 and n" is 0. In another embodiment, m is 1, m’ is 2 and n" is 0. In another embodiment, m is 1, m’ is 3 and n" is 0. In another embodiment, m is 2, m’ is 0 and n" is 0. In another embodiment, m is 2, m’ is 1 and n" is 0. In another embodiment, m is 2, m’ is 2 and n" is 0. In another embodiment, m is 2, m’ is 3 and n" is 0. In yet another embodiment, m is 3, m’ is 0 and n" is 0. In yet another embodiment, m is 3, m’ is 1 and n" is 0. In yet another embodiment, m is 3, m’ is 2 and n" is 0. In yet another embodiment, m is 3, m’ is 3 and n" is 0. In yet a further embodiment, m is 4, m’ is 0 and n” is 0. In yet a further embodiment, m is 4, m’ is 1 and n” is 0. In yet a further embodiment, m is 4, m’ is 2 and n” is 0. In yet a further embodiment, m is 4, m’ is 3 and n” is 0. In a particular embodiment, m is 1, m’ is 0 and n" is 1. In a particular embodiment, m is 1, m’ is 1 and n" is 1. In a particular embodiment, m is 1, m’ is 2 and n" is 1. In a particular embodiment, m is 1, m’ is 3 and n" is 1. In another embodiment, m is 2, m’ is 0 and n" is 1. In another embodiment, m is 2, m’ is 1 and n" is 1. In another embodiment, m is 2, m’ is 2 and n" is 1. In another embodiment, m is 2, m’ is 3 and n" is 1. In yet another embodiment, m is 3, m’ is 0 and n" is 1. In yet another embodiment, m is 3, m’ is 1 and n" is 1. In yet another embodiment, m is 3, m’ is 2 and n" is 1. In yet another embodiment, m is 3, m’ is 3 and n" is 1. In yet a further embodiment, m is 4, m’ is 0 and n” is 1. In yet a further embodiment, m is 4, m’ is 1 and n” is 1. In yet a further embodiment, m is 4, m’ is 2 and n” is 1. In yet a further embodiment, m is 4, m’ is 3 and n” is 1. In a particular embodiment, m is 1, m’ is 0 and n" is 2. In a particular embodiment, m is 1, m’ is 1 and n" is 2. In a particular embodiment, m is 1, m’ is 2 and n" is 2. In a particular embodiment, m is 1, m’ is 3 and n" is 2. In another embodiment, m is 2, m’ is 0 and n" is 2. In another embodiment, m is 2, m’ is 1 and n" is 2. In another embodiment, m is 2, m’ is 2 and n" is 2. In another embodiment, m is 2, m’ is 3 and n" is 2. In yet another embodiment, m is 3, m’ is 0 and n" is 2. In yet another embodiment, m is 3, m’ is 1 and n" is 2. In yet another embodiment, m is 3, m’ is 2 and n" is 2. In yet another embodiment, m is 3, m’ is 3 and n" is 2. In yet a further embodiment, m is 4, m’ is 0 and n” is 2. In yet a further embodiment, m is 4, m’ is 1 and n” is 2. In yet a further embodiment, m is 4, m’ is 2 and n” is 2. In yet a further embodiment, m is 4, m’ is 3 and n” is 2. In a particular embodiment, m is 1, m’ is 0 and n" is 3. In a particular embodiment, m is 1, m’ is 1 and n" is 3. In a particular embodiment, m is 1, m’ is 2 and n" is 3. In a particular embodiment, m is 1, m’ is 3 and n" is 3. In another embodiment, m is 2, m’ is 0 and n" is 3. In another embodiment, m is 2, m’ is 1 and n" is 3. In another embodiment, m is 2, m’ is 2 and n" is 3. In another embodiment, m is 2, m’ is 3 and n" is 3. In yet another embodiment, m is 3, m’ is 0 and n" is 3. In yet another embodiment, m is 3, m’ is 1 and n" is 3. In yet another embodiment, m is 3, m’ is 2 and n" is 3. In yet another embodiment, m is 3, m’ is 3 and n" is 3. In yet a further embodiment, m is 4, m’ is 0 and n” is 3. In yet a further embodiment, m is 4, m’ is 1 and n” is 3. In yet a further embodiment, m is 4, m’ is 2 and n” is 3. In yet a further embodiment, m is 4, m’ is 3 and n” is 3. In a particular embodiment, m is 1, m’ is 0 and n" is 4. In a particular embodiment, m is 1, m’ is 1 and n" is 4. In a particular embodiment, m is 1, m’ is 2 and n" is 4. In a particular embodiment, m is 1, m’ is 3 and n" is 4. In another embodiment, m is 2, m’ is 0 and n" is 4. In another embodiment, m is 2, m’ is 1 and n" is 4. In another embodiment, m is 2, m’ is 2 and n" is 4. In another embodiment, m is 2, m’ is 3 and n" is 4. In yet another embodiment, m is 3, m’ is 0 and n" is 4. In yet another embodiment, m is 3, m’ is 1 and n" is 4. In yet another embodiment, m is 3, m’ is 2 and n" is 4. In yet another embodiment, m is 3, m’ is 3 and n" is 4. In yet a further embodiment, m is 4, m’ is 0 and n” is 4. In yet a further embodiment, m is 4, m’ is 1 and n” is 4. In yet a further embodiment, m is 4, m’ is 2 and n” is 4. In yet a further embodiment, m is 4, m’ is 3 and n” is 4. In a particular embodiment, m is 1, m’ is 0 and n" is 5. In a particular embodiment, m is 1, m’ is 1 and n" is 5. In a particular embodiment, m is 1, m’ is 2 and n" is 5. In a particular embodiment, m is 1, m’ is 3 and n" is 5. In another embodiment, m is 2, m’ is 0 and n" is 5. In another embodiment, m is 2, m’ is 1 and n" is 5. In another embodiment, m is 2, m’ is 2 and n" is 5. In another embodiment, m is 2, m’ is 3 and n" is 5. In yet another embodiment, m is 3, m’ is 0 and n" is 5. In yet another embodiment, m is 3, m’ is 1 and n" is 5. In yet another embodiment, m is 3, m’ is 2 and n" is 5. In yet another embodiment, m is 3, m’ is 3 and n" is 5. In yet a further embodiment, m is 4, m’ is 0 and n” is 5. In yet a further embodiment, m is 4, m’ is 1 and n” is 5. In yet a further embodiment, m is 4, m’ is 2 and n” is 5. In yet a further embodiment, m is 4, m’ is 3 and n” is 5. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is OCH2(CH2)n’, where n’ is selected from 1 to 10 and werein X' is CH2O(CH2)n’’CH2C=O, where n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, n’ is 1 and n" is 0. In another embodiment, n’ is 2 and n" is 0. In yet another embodiment, n’ is 3 and n" is 0. In yet a further embodiment, n’ is 4 and n” is 0. In yet a further embodiment, n’ is 5 and n” is 0. In yet a further embodiment, n’ is 6 and n” is 0. In a particular embodiment, n’ is 1 and n" is 1. In another embodiment, n’ is 2 and n" is 1. In yet another embodiment, n’ is 3 and n" is 1. In yet a further embodiment, n’ is 4 and n” is 1. In yet a further embodiment, n’ is 5 and n” is 1. In yet a further embodiment, n’ is 6 and n” is 1. In a particular embodiment, n’ is 1 and n" is 2. In another embodiment, n’ is 2 and n" is 2. In yet another embodiment, n’ is 3 and n" is 2. In yet a further embodiment, n’ is 4 and n” is 2. In yet a further embodiment, n’ is 5 and n” is 2. In yet a further embodiment, n’ is 6 and n” is 2. In a particular embodiment, n’ is 1 and n" is 3. In another embodiment, n’ is 2 and n" is 3. In yet another embodiment, n’ is 3 and n" is 3. In yet a further embodiment, n’ is 4 and n” is 3. In yet a further embodiment, n’ is 5 and n” is 3. In yet a further embodiment, n’ is 6 and n” is 3. In a particular embodiment, n’ is 1 and n" is 4. In another embodiment, n’ is 2 and n" is 4. In yet another embodiment, n’ is 3 and n" is 4. In yet a further embodiment, n’ is 4 and n” is 4. In yet a further embodiment, n’ is 5 and n” is 4. In yet a further embodiment, n’ is 6 and n” is 4. In a particular embodiment, n’ is 1 and n" is 5. In another embodiment, n’ is 2 and n" is 5. In yet another embodiment, n’ is 3 and n" is 5. In yet a further embodiment, n’ is 4 and n” is 5. In yet a further embodiment, n’ is 5 and n” is 5. In yet a further embodiment, n’ is 6 and n” is 5. In a particular embodiment, n’ is 1 and n" is 6. In another embodiment, n’ is 2 and n" is 6. In yet another embodiment, n’ is 3 and n" is 6. In yet a further embodiment, n’ is 4 and n” is 6. In yet a further embodiment, n’ is 5 and n” is 6. In yet a further embodiment, n’ is 6 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is OCH2(CH2)n’, where n’ is selected from 1 to 10 and werein X' is CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, n’ is selected from 1 to 5, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, n’ is selected from 1 to 3, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, n’ is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 0. In another embodiment, n’ is 1, m’ is 1 and n" is 0. In another embodiment, n’ is 1, m’ is 2 and n" is 0. In another embodiment, n’ is 1, m’ is 3 and n" is 0. In another embodiment, n’ is 2, m’ is 0 and n" is 0. In another embodiment, n’ is 2, m’ is 1 and n" is 0. In another embodiment, n’ is 2, m’ is 2 and n" is 0. In another embodiment, n’ is 2, m’ is 3 and n" is 0. In yet another embodiment, n’ is 3, m’ is 0 and n" is 0. In yet another embodiment, n’ is 3, m’ is 1 and n" is 0. In yet another embodiment, n’ is 3, m’ is 2 and n" is 0. In yet another embodiment, n’ is 3, m’ is 3 and n" is 0. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 0.In yet a further embodiment, n’ is 5, m’ is 2 and n” is 0. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 0. In a particular embodiment, n’ is 1, m’ is 0 and n" is 1. In a particular embodiment, n’ is 1, m’ is 1 and n" is 1. In a particular embodiment, n’ is 1, m’ is 2 and n" is 1. In a particular embodiment, n’ is 1, m’ is 3 and n" is 1. In another embodiment, n’ is 2, m’ is 0 and n" is 1. In another embodiment, n’ is 2, m’ is 1 and n" is 1. In another embodiment, n’ is 2, m’ is 2 and n" is 1. In another embodiment, n’ is 2, m’ is 3 and n" is 1. In yet another embodiment, n’ is 3, m’ is 0 and n" is 1. In yet another embodiment, n’ is 3, m’ is 1 and n" is 1. In yet another embodiment, n’ is 3, m’ is 2 and n" is 1. In yet another embodiment, n’ is 3, m’ is 3 and n" is 1. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 1. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 1. In a particular embodiment, n’ is 1, m’ is 0 and n" is 2. In a particular embodiment, n’ is 1, m’ is 1 and n" is 2. In a particular embodiment, n’ is 1, m’ is 2 and n" is 2. In a particular embodiment, n’ is 1, m’ is 3 and n" is 2. In another embodiment, n’ is 2, m’ is 0 and n" is 2. In another embodiment, n’ is 2, m’ is 1 and n" is 2. In another embodiment, n’ is 2, m’ is 2 and n" is 2. In another embodiment, n’ is 2, m’ is 3 and n" is 2. In yet another embodiment, n’ is 3, m’ is 0 and n" is 2. In yet another embodiment, n’ is 3, m’ is 1 and n" is 2. In yet another embodiment, n’ is 3, m’ is 2 and n" is 2. In yet another embodiment, n’ is 3, m’ is 3 and n" is 2. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 2. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 2. In a particular embodiment, n’ is 1, m’ is 0 and n" is 3. In a particular embodiment, n’ is 1, m’ is 1 and n" is 3. In a particular embodiment, n’ is 1, m’ is 2 and n" is 3. In a particular embodiment, n’ is 1, m’ is 3 and n" is 3. In another embodiment, n’ is 2, m’ is 0 and n" is 3. In another embodiment, n’ is 2, m’ is 1 and n" is 3. In another embodiment, n’ is 2, m’ is 2 and n" is 3. In another embodiment, n’ is 2, m’ is 3 and n" is 3. In yet another embodiment, n’ is 3, m’ is 0 and n" is 3. In yet another embodiment, n’ is 3, m’ is 1 and n" is 3. In yet another embodiment, n’ is 3, m’ is 2 and n" is 3. In yet another embodiment, n’ is 3, m’ is 3 and n" is 3. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 3. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 3. In a particular embodiment, n’ is 1, m’ is 0 and n" is 4. In a particular embodiment, n’ is 1, m’ is 1 and n" is 4. In a particular embodiment, n’ is 1, m’ is 2 and n" is 4. In a particular embodiment, n’ is 1, m’ is 3 and n" is 4. In another embodiment, n’ is 2, m’ is 0 and n" is 4. In another embodiment, n’ is 2, m’ is 1 and n" is 4. In another embodiment, n’ is 2, m’ is 2 and n" is 4. In another embodiment, n’ is 2, m’ is 3 and n" is 4. In yet another embodiment, n’ is 3, m’ is 0 and n" is 4. In yet another embodiment, n’ is 3, m’ is 1 and n" is 4. In yet another embodiment, n’ is 3, m’ is 2 and n" is 4. In yet another embodiment, n’ is 3, m’ is 3 and n" is 4. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 4. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 4. In a particular embodiment, n’ is 1, m’ is 0 and n" is 5. In a particular embodiment, n’ is 1, m’ is 1 and n" is 5. In a particular embodiment, n’ is 1, m’ is 2 and n" is 5. In a particular embodiment, n’ is 1, m’ is 3 and n" is 5. In another embodiment, n’ is 2, m’ is 0 and n" is 5. In another embodiment, n’ is 2, m’ is 1 and n" is 5. In another embodiment, n’ is 2, m’ is 2 and n" is 5. In another embodiment, n’ is 2, m’ is 3 and n" is 5. In yet another embodiment, n’ is 3, m’ is 0 and n" is 5. In yet another embodiment, n’ is 3, m’ is 1 and n" is 5. In yet another embodiment, n’ is 3, m’ is 2 and n" is 5. In yet another embodiment, n’ is 3, m’ is 3 and n" is 5. In yet a further embodiment, n’ is 4, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 4, m’ is 3 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 0 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 1 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 2 and n” is 5. In yet a further embodiment, n’ is 5, m’ is 3 and n” is 5. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is O(CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and wherein X' is CH2O(CH2)n’’CH2C=O, where n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 3 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2 and n" is selected from 0 to 2. In a particular embodiment, m is 1 and n" is 0. In another embodiment, m is 2 and n" is 0. In yet another embodiment, m is 3 and n" is 0. In yet a further embodiment, m is 4 and n” is 0. In a particular embodiment, m is 1 and n" is 1. In another embodiment, m is 2 and n" is 1. In yet another embodiment, m is 3 and n" is 1. In yet a further embodiment, m is 4 and n” is 1. In a particular embodiment, m is 1 and n" is 2. In another embodiment, m is 2 and n" is 2. In yet another embodiment, m is 3 and n" is 2. In yet a further embodiment, m is 4 and n” is 2. In a particular embodiment, m is 1 and n" is 3. In another embodiment, m is 2 and n" is 3. In yet another embodiment, m is 3 and n" is 3. In yet a further embodiment, m is 4 and n” is 3. In a particular embodiment, m is 1 and n" is 4. In another embodiment, m is 2 and n" is 4. In yet another embodiment, m is 3 and n" is 4. In yet a further embodiment, m is 4 and n” is 4. In a particular embodiment, m is 1 and n" is 5. In another embodiment, m is 2 and n" is 5. In yet another embodiment, m is 3 and n" is 5. In yet a further embodiment, m is 4 and n” is 5. In a particular embodiment, m is 1 and n" is 6. In another embodiment, m is 2 and n" is 6. In yet another embodiment, m is 3 and n" is 6. In yet a further embodiment, m is 4 and n” is 6. In an embodiment, the invention provides a serotype 3 glycoconjugate comprising a serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is O(CH2CH2O)mCH2CH2, where m is selected from 1 to 4 and wherein X' is CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4. In an embodiment, m is selected from 1 to 3, m’ is selected from 0 to 4 and n" is selected from 0 to 10. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 4 and n" is selected from 0 to 5. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 3. In an embodiment, m is selected from 1 to 2, m’ is selected from 0 to 2 and n" is selected from 0 to 1. In a particular embodiment, m is 1, m’ is 0 and n" is 0. In another embodiment, m is 1, m’ is 1 and n" is 0. In another embodiment, m is 1, m’ is 2 and n" is 0. In another embodiment, m is 1, m’ is 3 and n" is 0. In another embodiment, m is 2, m’ is 0 and n" is 0. In another embodiment, m is 2, m’ is 1 and n" is 0. In another embodiment, m is 2, m’ is 2 and n" is 0. In another embodiment, m is 2, m’ is 3 and n" is 0. In yet another embodiment, m is 3, m’ is 0 and n" is 0. In yet another embodiment, m is 3, m’ is 1 and n" is 0. In yet another embodiment, m is 3, m’ is 2 and n" is 0. In yet another embodiment, m is 3, m’ is 3 and n" is 0. In yet a further embodiment, m is 4, m’ is 0 and n” is 0. In yet a further embodiment, m is 4, m’ is 1 and n” is 0. In yet a further embodiment, m is 4, m’ is 2 and n” is 0. In yet a further embodiment, m is 4, m’ is 3 and n” is 0. In a particular embodiment, m is 1, m’ is 0 and n" is 1. In a particular embodiment, m is 1, m’ is 1 and n" is 1. In a particular embodiment, m is 1, m’ is 2 and n" is 1. In a particular embodiment, m is 1, m’ is 3 and n" is 1. In another embodiment, m is 2, m’ is 0 and n" is 1. In another embodiment, m is 2, m’ is 1 and n" is 1. In another embodiment, m is 2, m’ is 2 and n" is 1. In another embodiment, m is 2, m’ is 3 and n" is 1. In yet another embodiment, m is 3, m’ is 0 and n" is 1. In yet another embodiment, m is 3, m’ is 1 and n" is 1. In yet another embodiment, m is 3, m’ is 2 and n" is 1. In yet another embodiment, m is 3, m’ is 3 and n" is 1. In yet a further embodiment, m is 4, m’ is 0 and n” is 1. In yet a further embodiment, m is 4, m’ is 1 and n” is 1. In yet a further embodiment, m is 4, m’ is 2 and n” is 1. In yet a further embodiment, m is 4, m’ is 3 and n” is 1. In a particular embodiment, m is 1, m’ is 0 and n" is 2. In a particular embodiment, m is 1, m’ is 1 and n" is 2. In a particular embodiment, m is 1, m’ is 2 and n" is 2. In a particular embodiment, m is 1, m’ is 3 and n" is 2. In another embodiment, m is 2, m’ is 0 and n" is 2. In another embodiment, m is 2, m’ is 1 and n" is 2. In another embodiment, m is 2, m’ is 2 and n" is 2. In another embodiment, m is 2, m’ is 3 and n" is 2. In yet another embodiment, m is 3, m’ is 0 and n" is 2. In yet another embodiment, m is 3, m’ is 1 and n" is 2. In yet another embodiment, m is 3, m’ is 2 and n" is 2. In yet another embodiment, m is 3, m’ is 3 and n" is 2. In yet a further embodiment, m is 4, m’ is 0 and n” is 2. In yet a further embodiment, m is 4, m’ is 1 and n” is 2. In yet a further embodiment, m is 4, m’ is 2 and n” is 2. In yet a further embodiment, m is 4, m’ is 3 and n” is 2. In a particular embodiment, m is 1, m’ is 0 and n" is 3. In a particular embodiment, m is 1, m’ is 1 and n" is 3. In a particular embodiment, m is 1, m’ is 2 and n" is 3. In a particular embodiment, m is 1, m’ is 3 and n" is 3. In another embodiment, m is 2, m’ is 0 and n" is 3. In another embodiment, m is 2, m’ is 1 and n" is 3. In another embodiment, m is 2, m’ is 2 and n" is 3. In another embodiment, m is 2, m’ is 3 and n" is 3. In yet another embodiment, m is 3, m’ is 0 and n" is 3. In yet another embodiment, m is 3, m’ is 1 and n" is 3. In yet another embodiment, m is 3, m’ is 2 and n" is 3. In yet another embodiment, m is 3, m’ is 3 and n" is 3. In yet a further embodiment, m is 4, m’ is 0 and n” is 3. In yet a further embodiment, m is 4, m’ is 1 and n” is 3. In yet a further embodiment, m is 4, m’ is 2 and n” is 3. In yet a further embodiment, m is 4, m’ is 3 and n” is 3. In a particular embodiment, m is 1, m’ is 0 and n" is 4. In a particular embodiment, m is 1, m’ is 1 and n" is 4. In a particular embodiment, m is 1, m’ is 2 and n" is 4. In a particular embodiment, m is 1, m’ is 3 and n" is 4. In another embodiment, m is 2, m’ is 0 and n" is 4. In another embodiment, m is 2, m’ is 1 and n" is 4. In another embodiment, m is 2, m’ is 2 and n" is 4. In another embodiment, m is 2, m’ is 3 and n" is 4. In yet another embodiment, m is 3, m’ is 0 and n" is 4. In yet another embodiment, m is 3, m’ is 1 and n" is 4. In yet another embodiment, m is 3, m’ is 2 and n" is 4. In yet another embodiment, m is 3, m’ is 3 and n" is 4. In yet a further embodiment, m is 4, m’ is 0 and n” is 4. In yet a further embodiment, m is 4, m’ is 1 and n” is 4. In yet a further embodiment, m is 4, m’ is 2 and n” is 4. In yet a further embodiment, m is 4, m’ is 3 and n” is 4. In a particular embodiment, m is 1, m’ is 0 and n" is 5. In a particular embodiment, m is 1, m’ is 1 and n" is 5. In a particular embodiment, m is 1, m’ is 2 and n" is 5. In a particular embodiment, m is 1, m’ is 3 and n" is 5. In another embodiment, m is 2, m’ is 0 and n" is 5. In another embodiment, m is 2, m’ is 1 and n" is 5. In another embodiment, m is 2, m’ is 2 and n" is 5. In another embodiment, m is 2, m’ is 3 and n" is 5. In yet another embodiment, m is 3, m’ is 0 and n" is 5. In yet another embodiment, m is 3, m’ is 1 and n" is 5. In yet another embodiment, m is 3, m’ is 2 and n" is 5. In yet another embodiment, m is 3, m’ is 3 and n" is 5. In yet a further embodiment, m is 4, m’ is 0 and n” is 5. In yet a further embodiment, m is 4, m’ is 1 and n” is 5. In yet a further embodiment, m is 4, m’ is 2 and n” is 5. In yet a further embodiment, m is 4, m’ is 3 and n” is 5. 1.6 Carrier protein of the Streptococcus pneumoniae serotype 3 glycoconjugates of the invention A component of the glycoconjugate is a carrier protein to which the purified polysaccharide is conjugated. The terms "protein carrier" or "carrier protein" or “carrier” may be used interchangeably herein. Carrier proteins should be amenable to standard conjugation procedures. In a preferred embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate is selected in the group consisting of: DT (Diphtheria toxoid), TT (tetanus toxoid) or fragment C of TT, CRM197(a nontoxic but antigenically identical variant of diphtheria toxin), other DT mutants (such as CRM176, CRM228, CRM45 (Uchida et al. (1973) J. Biol. Chem. 218:3838-3844), CRM9, CRM102, CRM103 or CRM107; and other mutations described by Nicholls and Youle in Genetically Engineered Toxins, Ed: Frankel, Maecel Dekker Inc. (1992); deletion or mutation of Glu-148 to Asp, Gln or Ser and / or Ala 158 to GIy and other mutations disclosed in U.S. Patent Nos.4,709,017 and 4,950,740; mutation of at least one or more residues Lys 516, Lys 526, Phe 530 and / or Lys 534 and other mutations disclosed in U.S. Patent Nos. 5,917,017 and 6,455,673; or fragment disclosed in U.S. Patent No. 5,843,711, pneumococcal pneumolysin (ply) (Kuo et al. (1995) Infect lmmun 63:2706-2713) including ply detoxified in some fashion, for example dPLY-GMBS (WO 2004 / 081515, WO 2006 / 032499) or dPLY-formol, PhtX, including PhtA, PhtB, PhtD, PhtE (sequences of PhtA, PhtB, PhtD or PhtE are disclosed in WO 00 / 37105 and WO 00 / 39299) and fusions of Pht proteins, for example PhtDE fusions, PhtBE fusions, Pht A-E (WO 01 / 98334, WO 03 / 054007, WO 2009 / 000826), OMPC (meningococcal outer membrane protein), which is usually extracted from Neisseria meningitidis serogroup B (EP0372501), PorB (from N. meningitidis), PD (Haemophilus influenzae protein D; see, e.g., EP0594610 B) or immunologically functional equivalents thereof, synthetic peptides (EP0378881, EP0427347), heat shock proteins (WO 93 / 17712, WO 94 / 03208), pertussis proteins (WO 98 / 58668, EP0471177), cytokines, lymphokines, growth factors or hormones (WO 91 / 01146), artificial proteins comprising multiple human CD4+ T cell epitopes from various pathogen derived antigens (Falugi et al. (2001) Eur J Immunol 31:3816-3824) such as N19 protein (Baraldoi et al. (2004) Infect lmmun 72:4884-4887) pneumococcal surface protein PspA (WO 02 / 091998), iron uptake proteins (WO 01 / 72337), toxin A or B of Clostridium difficile (WO 00 / 61761), transferrin binding proteins, pneumococcal adhesion protein (PsaA), recombinant Pseudomonas aeruginosa exotoxin A (in particular non-toxic mutants thereof (such as exotoxin A bearing a substution at glutamic acid 553 (Douglas et al. (1987) J. Bacteriol. 169(11):4967-4971)). Other proteins, such as ovalbumin, keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) or purified protein derivative of tuberculin (PPD) also can be used as carrier proteins. Other suitable carrier proteins include inactivated bacterial toxins such as cholera toxoid (e.g., as described in WO 2004 / 083251), Escherichia coli LT, E. coli ST, and exotoxin A from P. aeruginosa. Another suitable carrier protein is a C5a peptidase from Streptococcus (SCP). In a preferred embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is selected from the group consisting of TT, DT, DT mutants (such as CRM197), and a C5a peptidase from Streptococcus (SCP). In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate is DT (Diphtheria toxoid). In another embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate is TT (tetanus toxoid). In another embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate is PD (H. influenzae protein D; see, e.g., EP0594610 B). In a preferred embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate is CRM197or a C5a peptidase from Streptococcus (SCP). In a preferred embodiment, the serotype 3 capsular polysaccharide is conjugated to CRM197 protein. The CRM197 protein is a nontoxic form of diphtheria toxin but is immunologically indistinguishable from the diphtheria toxin. CRM197is produced by Corynebacterium diphtheriae infected by the nontoxigenic phage β197tox-created by nitrosoguanidine mutagenesis of the toxigenic corynephage beta (Uchida et al. (1971) Nature New Biology 233:8-11). The CRM197protein has the same molecular weight as the diphtheria toxin but differs therefrom by a single base change (guanine to adenine) in the structural gene. This single base change causes an amino acid substitution (glutamic acid for glycine) in the mature protein and eliminates the toxic properties of diphtheria toxin. The CRM197 protein is a safe and effective T-cell dependent carrier for saccharides. Further details about CRM197and production thereof can be found, e.g., in U.S. Patent No.5,614,382. In an embodiment, the serotype 3 capsular polysaccharide is conjugated to CRM197 protein. In an embodiment, the serotype 3 capsular polysaccharide is conjugated to CRM197protein or the A chain of CRM197(see CN103495161). In an embodiment, the serotype 3 capsular polysaccharide is conjugated the A chain of CRM197 obtained via expression by genetically recombinant E. coli (see CN103495161). In other preferred embodiments, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is SCP (Streptococcal C5a Peptidase). Two important species of β-hemolytic streptococci, Streptococcus pyogenes (group A Streptococcus, GAS) and Streptococcus agalactiae (group B Streptococcus, GBS), which cause a variety of serious human infections that range from mild cases of pharyngitis and impetigo to serious invasive diseases such as necrotizing fasciitis (GAS) and neonatal sepsis (GBS) have developed a way to defeat this immune response. All human isolates of β-hemolytic streptococci, including GAS and GBS, produce a highly conserved cell- wall protein SCP (Streptococcal C5a Peptidase) that specifically inactivates C5a. The scp genes from GAS and GBS encode a polypeptide containing between 1,134 and 1,181 amino acids (Brown et al., PNAS, 2005, vol.102, no.51 pages 18391–18396). The first 31 residues are the export signal presequence and are removed upon passing through the cytoplasmic membrane. The next 68 residues serve as a pro-sequence and must be removed to produce active SCP. The next 10 residues can be removed without loss of protease activity. At the other end, starting with Lys-1034, are four consecutive 17-residue motifs followed by a cell sorting and cell-wall attachment signal. This combined signal is composed of a 20-residue hydrophilic sequence containing an LPTTND sequence, a 17- residue hydrophobic sequence, and a short basic carboxyl terminus. SCP can be divided in domains (see figure 1B of Brown et al., PNAS, 2005, vol.102, no. 51 pages 18391–18396). These domains are the Pre / Pro domain (which comprises the export signal presequence (commonly the first 31 residues) and the pro-sequence (commonly the next 68 residues)), the protease domain (which is splitted in two part (protease part 1 commonly residues 89–333 / 334 and protease domain part 2 and commonly residues 467 / 468–583 / 584), the protease-associated domain (PA domain) (commonly residues 333 / 334–467 / 468), three fibronectin type III (Fn) domains (Fn1, commonly residues 583 / 584–712 / 713; Fn2, commonly residues 712 / 713–928 / 929 / 930; commonly Fn3, residues 929 / 930-1029 / 1030 / 1031) and a cell wall anchor domain (commonly redisues 1029 / 1030 / 1031 to the C-terminus). In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an SCP from GBS (SCPB). An exemple of SCPB is provided at SEQ. ID.NO: 3 of WO97 / 26008. See also SEQ ID NO: 3 of WO00 / 34487. In another preferred embodiments, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an SCP from GAS (SCPA). Examples of SCPA can be found at SEQ.ID.No.1 and SEQ.ID.No.2 of WO97 / 26008. See also SEQ ID NO: 1, 2 and 23 of WO00 / 34487. In a preferred embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP. In other preferred embodiments, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP from GBS (SCPB). In another preferred embodiments, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP from GAS (SCPA). In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is a fragment of an SCP. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is a fragment of an SCPA. Preferably, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is a fragment of an SCPB. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is a fragment of an SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is a fragment of an SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP which comprises the protease domain, the protease-associated domain (PA domain) and two of the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP. In an embodiment, said enzymatically inactive fragment of SCP comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCPA. In an embodiment, said enzymatically inactive fragment of an SCPA comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In a preferred embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPB. Preferably, said enzymatically inactive fragment of SCPB comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain. In an embodiment, the enzymatic activity of SCP is inactivated by replacing at least one amino acid of the wild type sequence. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. The numbers indicate the amino acid residue position in the peptidase according to the numbering of SEQ ID NO: 1 of WO00 / 34487. Therefore, in an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPA where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPB where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPA which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPB which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least one amino acid of the wild type sequence. Preferably, said replacement of at least one amino acid is in the protease domain. In an embodiment, said replacement of at least one amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acid is in part 2 of the protease domain. In an embodiment, said replacement is selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said replacement is D130A. In another embodiment, said replacement is H193A. In another embodiment, said replacement is N295A. In yet another embodiment, said replacement is S512A. In an embodiment, the enzymatic activity of SCP is inactivated by replacing at least two amino acids of the wild type sequence. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. In an embodiment, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. Therefore, in an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acid is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPA where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acid is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPB where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acid is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acid is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acid is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPA which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acids is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPB which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least two amino acids of the wild type sequence. Preferably, said replacement of at least two amino acids is in the protease domain. In an embodiment, said replacement of at least two amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least two amino acids is in part 2 of the protease domain. In an embodiment, said at least two amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least two amino acids replacements are D130A and H193A. In an embodiment, said at least two amino acids replacements are D130A and N295A. Preferably, said at least two amino acids replacements are D130A and S512A. In an embodiment, said at least two amino acids replacements are H193A and N295A. In an embodiment, said at least two amino acids replacements are H193A and S512A. In an embodiment, said at least two amino acids replacements are N295A and S512A. In an embodiment, the enzymatic activity of SCP is inactivated by replacing at least three amino acids of the wild type sequence. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. Therefore, in an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acid is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPA where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acid is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPB where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acid is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acid is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acid is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPA which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acids is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPB which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least three amino acids of the wild type sequence. Preferably, said replacement of at least three amino acids is in the protease domain. In an embodiment, said replacement of at least three amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least three amino acids is in part 2 of the protease domain. In an embodiment, said at least three amino acids replacements are selected from the group consisting of D130A, H193A, N295A and S512A. In an embodiment, said at least three amino acids replacements are D130A, H193A and N295A. In an embodiment, said at least three amino acids replacements are D130A, H193A and S512A. In an embodiment, said at least three amino acids replacements are D130A, N295A and S512A. In an embodiment, said at least three amino acids replacements are H193A, N295A and S512A. In an embodiment, the enzymatic activity of SCP is inactivated by replacing at least four amino acids of the wild type sequence. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A. Therefore, in an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCP where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acid is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acid is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPA where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acid is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive SCPB where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acid is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of an SCP where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acid is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acid is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPA which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least one amino acids is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In an embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCPB which comprises the protease domain, the protease-associated domain (PA domain) and the three fibronectin type III (Fn) domains but does not comprise the export signal presequence, the pro-sequence and the cell wall anchor domain, where said inactivation is accomplished by replacing at least four amino acids of the wild type sequence. Preferably, said replacement of at least four amino acids is in the protease domain. In an embodiment, said replacement of at least four amino acids is in part 1 of the protease domain. In an embodiment, said replacement of at least four amino acids is in part 2 of the protease domain. In an embodiment, said at least four amino acids replacements are D130A, H193A, N295A and S512A In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which consists of SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP which consists of SEQ ID NO: 42. SEQ ID NO: 41 : MAKTADTPATSKATIRDLNDPSQVKTLQEKAGKGAGTVVAVIAAGFDKNH EAWRLTDKAKARYQSKEDLEKAKKEHGITYGEWVNDKVAYYHDYSKDGKT AVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLLLMRVEIVNGLAD YARNYAQAIRDAINLGAKVINMSFGNAALAYANLPDETKKAFDYAKSKGV SIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAADSTLTVASYSPDKQL TETVTVKTADQQDKEMPVLSTNRFEPNKAYDYAYANRGTKEDDFKDVKGK IALIERGDIDFKDKIAKAKKAGAVGVLIYDNQDKGFPIELPNVDQMPAAF ISRKDGLLLKDNPQKTITFNATPKVLPTASGTKLSRFSSWGLTADGNIKP DIAAPGQDILSSVANNKYAKLSGTAMSAPLVAGIMGLLQEQYETQYPDMT PSERLDLAKKVLMSSATALYDEDEKAYFSPRQQGAGAVDAKKASAATMYV TDKDNTSSKVHLNNVSDKFEVTVTVHNKSDKPQELYYQATVQTDKVDGKH FALAPKALYETSWQKITIPANSSKQVTVPIDASRFSKDLLAQMKNGYFLE GFVRFKQDPKKEELMSIPYIGFRGDFGNLSALEKPIYDSKDGSSYYHEAN SDAKDQLDGDGLQFYALKNNFTALTTESNPWTIIKAVKEGVENIEDIESS EITETIFAGTFAKQDDDSHYYIHRHANGKPYAAISPNGDGNRDYVQFQGT FLRNAKNLVAEVLDKEGNVVWTSEVTEQVVKNYNNDLASTLGSTRFEKTR WDGKDKDGKVVANGTYTYRVRYTPISSGAKEQHTDFDVIVDNTTPEVATS ATFSTEDRRLTLASKPKTSQPVYRERIAYTYMDEDLPTTEYISPNEDGTF TLPEEAETMEGATVPLKMSDFTYVVEDMAGNITYTPVTKLLEGHSNKPEQ SEQ ID NO: 41 is 950 amino acids long. SEQ ID NO: 42 : AKTADTPATSKATIRDLNDPSQVKTLQEKAGKGAGTVVAVIAAGFDKNH EAWRLTDKAKARYQSKEDLEKAKKEHGITYGEWVNDKVAYYHDYSKDGKT AVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLLLMRVEIVNGLAD YARNYAQAIRDAINLGAKVINMSFGNAALAYANLPDETKKAFDYAKSKGV SIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAADSTLTVASYSPDKQL TETVTVKTADQQDKEMPVLSTNRFEPNKAYDYAYANRGTKEDDFKDVKGK IALIERGDIDFKDKIAKAKKAGAVGVLIYDNQDKGFPIELPNVDQMPAAF ISRKDGLLLKDNPQKTITFNATPKVLPTASGTKLSRFSSWGLTADGNIKP DIAAPGQDILSSVANNKYAKLSGTAMSAPLVAGIMGLLQEQYETQYPDMT PSERLDLAKKVLMSSATALYDEDEKAYFSPRQQGAGAVDAKKASAATMYV TDKDNTSSKVHLNNVSDKFEVTVTVHNKSDKPQELYYQATVQTDKVDGKH FALAPKALYETSWQKITIPANSSKQVTVPIDASRFSKDLLAQMKNGYFLE GFVRFKQDPKKEELMSIPYIGFRGDFGNLSALEKPIYDSKDGSSYYHEAN SDAKDQLDGDGLQFYALKNNFTALTTESNPWTIIKAVKEGVENIEDIESS EITETIFAGTFAKQDDDSHYYIHRHANGKPYAAISPNGDGNRDYVQFQGT FLRNAKNLVAEVLDKEGNVVWTSEVTEQVVKNYNNDLASTLGSTRFEKTR WDGKDKDGKVVANGTYTYRVRYTPISSGAKEQHTDFDVIVDNTTPEVATS ATFSTEDRRLTLASKPKTSQPVYRERIAYTYMDEDLPTTEYISPNEDGTF TLPEEAETMEGATVPLKMSDFTYVVEDMAGNITYTPVTKLLEGHSNKPEQ SEQ ID NO: 42 is 949 amino acids long. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 90% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 95% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.5% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.8% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.85% identity with SEQ ID NO: 41. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 90% identity with SEQ ID NO: 42. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 95% identity with SEQ ID NO: 42. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99% identity with SEQ ID NO: 42. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.5% identity with SEQ ID NO: 42. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.8% identity with SEQ ID NO: 42. In a particular embodiment, the carrier protein of the serotype 3 capsular polysaccharide glycoconjugate of the invention is an enzymatically inactive fragment of SCP consisting of a polypeptide having at least 99.85% identity with SEQ ID NO: 42. 2 Immunogenic compositions 2.1 Combinations of glycoconjugates of the invention In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and comprising from 1 to 25 different glycoconjugates. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and comprising from 1 to 25 glycoconjugates from different serotypes of S. pneumoniae (1 to 25 pneumococcal conjugates). In one embodiment the invention relates to an immunogenic composition comprising glycoconjugates from 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 different serotypes of S. pneumoniae. In one embodiment the immunogenic composition comprises glycoconjugates from 16 or 20 different serotypes of S. pneumoniae. In an embodiment the immunogenic composition is a 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20-valent pneumococcal conjugate compositions. In an embodiment the immunogenic composition is a 14, 15, 16, 17, 18 or 19-valent pneumococcal conjugate compositions. In an embodiment the immunogenic composition is a 16-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 19-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 20-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 21, 22, 23, 24 or 25-valent pneumococcal conjugate compositions. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 23-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 24-valent pneumococcal conjugate composition. In an embodiment the immunogenic composition is a 25-valent pneumococcal conjugate composition. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 4, 6B, 9V, 14, 18C, 19F and 23F. In an embodiment said immunogenic composition comprises in addition glycoconjugates from S. pneumoniae serotypes 1, 5 and 7F. In an embodiment any of the immunogenic compositions above comprises in addition glycoconjugates from S. pneumoniae serotypes 6A and 19A. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotype 22F and 33F. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotypes 8, 10A, 11A, 12F and 15B. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotype 2. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotypes 9N. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotypes 17F. In an embodiment any of the immunogenic compositions above comprise in addition a glycoconjugates from S. pneumoniae serotypes 20. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 4, 6B, 9V, 14, 18C, 19F and 23F. In an embodiment the immunogenic composition is an 8-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6B, 7F, 9V, 14, 18C, 19F and 23F. In an embodiment the immunogenic composition is an 11-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 9V, 14, 18C, 19A, 19F and 23F. In an embodiment the immunogenic composition is a 13-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 9V, 14, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 15-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 20-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 2, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 9N, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 2, 4, 5, 6A, 6B, 7F, 8, 9V, 9N, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 2, 4, 5, 6A, 6B, 7F, 8, 9V, 9N, 10A, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 23-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 2, 4, 5, 6A, 6B, 7F, 8, 9V, 9N, 10A, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 20, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 24-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23A, 23F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23B, 23F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F, 24F and 33F. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F, 33F and 35B. In an embodiment the immunogenic composition is a 21-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23A, 23F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23B, 23F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23F, 24F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23F, 33F and 35B. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23A, 23B, 23F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23A, 23F, 24F and 33F. In an embodiment the immunogenic composition is a 22-valent pneumococcal conjugate compositions. In an embodiment the invention relates to an immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of the invention and further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, ...

Claims

Claims 1. A method of making a Streptococcus pneumoniae serotype 3 glycoconjugate, comprising the steps of: (a) reacting an isolated Streptococcus pneumoniae serotype 3 capsular polysaccharide with a carbonic acid derivative and an azido linker in an aprotic solvent to produce an activated azido polysaccharide, (b) reacting a carrier protein with an agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group where the NHS moiety reacts with the amino groups to form an amide linkage thereby obtaining an alkyne functionalized carrier protein, (c) reacting the activated azido polysaccharide of step (a) with the activated alkyne-carrier protein of step (b) by Cu+1mediated azide-alkyne cycloaddition reaction to form a glycoconjugate.

2. The method of claim 1 wherein, the isolated polysaccharide is sized before the activation step (a).

3. The method of claim 2 wherein, the isolated serotype 3 capsular polysaccharide is sized to a weight average molecular weight between 100 kDa and 200 kDa.

4. The method of any one of claims 1-3 wherein, said carbonic acid derivative is 1,1’- carbonyldiimidazole (CDI), 1,1’-carbonyl-di-(1,2,4-triazole) (CDT), disuccinimidyl carbonate (DSC) or N-hydroxysuccinimidyl chloroformate.

5. The method of any one of claims 1-4 wherein said azido linker is a compound of formula (I), wherein X is selected from the group consisting of CH2(CH2)n, (CH2CH2O)mCH2CH2, NHCO(CH2)n, NHCO(CH2CH2O)mCH2CH2, OCH2(CH2)n and O(CH2CH2O)mCH2CH2; where n is selected from 1 to 10 and m is selected from 1 to 4.

6. The method of any one of claims 1-4 wherein said azido linker is a compound of formula (II),7. The method of any one of claims 1-6 wherein, said agent bearing an N- Hydroxysuccinimide (NHS) moiety and an alkyne group is an agent bearing an N- Hydroxysuccinimide (NHS) moiety and a terminal alkyne.

8. The method of any one of claims 1-6 wherein, said agent bearing an N- Hydroxysuccinimide (NHS) moiety and an alkyne group is an agent bearing an N- Hydroxysuccinimide (NHS) moiety and a cycloalkyne.

9. The method of any one of claims 1-6 wherein, said agent bearing an N- Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (III),where X is selected from the group consisting of CH2O(CH2)nCH2C=O and CH2O(CH2CH2O)m(CH2)nCH2C=O, where n is selected from 0 to 10 and m is selected from 0 to 4.

10. The method of any one of claims 1-9 wherein, said agent bearing an N- Hydroxysuccinimide (NHS) moiety and an alkyne group is a compound of formula (IV):

11. The method of any one of claims 1-10 wherein step a) further comprises reacting the carbonic acid derivative-activated polysaccharide with an amount of azido linker that is between 0.01-10 molar equivalent to the amount of polysaccharide Repeat Unit of the activated polysaccharide.

12. The method of any one of claims 1-11 wherein step b) comprises reacting the carrier protein with an amount of agent bearing an N-Hydroxysuccinimide (NHS) moiety and an alkyne group that is 0.1-10 molar equivalents to the lysines on the carrier.

13. The method of any one of claims 1-12 wherein the conjugation reaction c) is carried out in aqueous buffer in the presence of copper (I) as catalyst.

14. The method of any one of claims 1-13 wherein following step c), the method further comprises a step of capping the unreacted azido groups remained in the conjugate with an azido group capping agent.

15. The method of any one of claims 1-14 wherein following step c), the method further comprises a step of capping the unreacted alkyne groups remained in the conjugate with an alkyne group capping agent.

16. The method of any one of claims 1-15 wherein the method further comprises the step of purifying the glycoconjugate after it is produced.

17. A Streptococcus pneumoniae serotype 3 glycoconjugate produced according to any one of the methods of claims 1 to 16.

18. A Streptococcus pneumoniae serotype 3 glycoconjugate comprising a Streptococcus pneumoniae serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII):wherein X is selected from the group consisting of CH2(CH2)n’, (CH2CH2O)mCH2CH2, NHCO(CH2)n’, NHCO(CH2CH2O)mCH2CH2, OCH2(CH2)n’ and O(CH2CH2O)mCH2CH2; where n’ is selected from 1 to 10 and m is selected from 1 to 4, and wherein X' is selected from the group consisting of CH2O(CH2)n’’CH2C=O, CH2O(CH2CH2O)m’(CH2)n’’CH2C=O, where n" is selected from 0 to 10 and m’ is selected from 0 to 4.

19. A Streptococcus pneumoniae serotype 3 glycoconjugate comprising a Streptococcus pneumoniae serotype 3 saccharide covalently conjugated to a carrier protein (CP) through a spacer and having the general formula (VII), wherein X is CH2(CH2)n’, where n’ is 2 and wherein X' is CH2O(CH2)n’’CH2C=O where n" is 1.

20. The serotype 3 glycoconjugate of any one of claims 17 to 19 comprising a serotype 3 capsular polysaccharide wherein the weight average molecular weight (Mw) of said polysaccharide before conjugation is between 75 kDa and 200 kDa.

21. The serotype 3 glycoconjugate of any one of claims 17 to 20 having a weight average molecular weight (Mw) of between 1,000 kDa and 4,000 kDa.

22. The serotype 3 glycoconjugate of any one of claims 17 to 21 wherein said carrier protein is CRM197.

23. The serotype 3 glycoconjugate of any one of claims 17 to 21 wherein said carrier protein is SCP.

24. An immunogenic composition comprising a Streptococcus pneumoniae serotype 3 glycoconjugate of any one of claims 17 to 23.

25. The immunogenic composition of claim 24 comprising from 1 to 25 glycoconjugates from different serotypes of S. pneumoniae.

26. The immunogenic composition of claim 24 further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15B, 18C, 19A, 19F, 22F, 23F and 33F, wherein said immunogenic composition is a 20-valent pneumococcal conjugate composition.

27. The immunogenic composition of claim 24 further comprising glycoconjugates from S. pneumoniae serotypes 1, 4, 5, 6A, 6B, 7F, 8, 9V, 10A, 11A, 12F, 14, 15A, 15B, 18C, 19A, 19F, 22F, 23A, 23B, 23F, 24F, 33F and 35B, wherein said immunogenic composition is a 25-valent pneumococcal conjugate composition.