Anti-human CD19 antibodies

NZ792461BActive Publication Date: 2026-07-28ELI LILLY & CO
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
NZ792461
Authority / Receiving Office
NZ · NZ
Patent Type
Patents
Current Assignee / Owner
Priority Date
2020-02-28
Filing Date
2021-02-22
Publication Date
2026-07-28
Estimated Expiration
2041-02-22

AI Technical Summary

Technical Problem

Existing anti-human CD19 antibodies, such as obexelimab, exhibit non-specific binding to other cell types, short half-life, and induce B cell depletion, leading to complications like immunocompromise and immune suppression.

Method used

Development of non-depleting anti-human CD19 antibodies with specific binding affinity to human B cells, low immunogenicity, and improved stability, solubility, and pharmacokinetic properties, utilizing optimized heavy and light chain variable regions and modified IgG1 or IgG4 isotype, which includes a S228P mutation, which reduces the IgG4 Fab-arm exchange in vivo.

Benefits of technology

The antibodies effectively inhibit B cell proliferation, activation, and differentiation without depleting B cells, offering therapeutic benefits for autoimmune diseases while avoiding long-term immune suppression and complications.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000056_0000
    Figure 00000056_0000
  • Figure 00000057_0000
    Figure 00000057_0000
  • Figure 00000058_0000
    Figure 00000058_0000
Patent Text Reader

Abstract

The present disclosure relates to antibodies that bind human CD19 (anti-human CD19 antibodies or anti-human CD19 antibodies), compositions comprising such anti-human CD19 antibodies, and methods of using such anti-human CD19 antibodies.
Need to check novelty before this filing date? Find Prior Art

Description

ANTI-HUMAN CD19 ANTIBODIESFIELD OF THE INVENTIONThe present disclosure relates to antibodies that bind human CD19 (“anti-human CD19 antibodies” or “anti-CD19 antibodies”), compositions comprising such anti-human CD19 antibodies, and methods of using such anti-human CD19 antibodies.BACKGROUNDB cells can produce antibodies against various antigens and thus play an important role in the humoral immune response. Additionally, B cells also function as antigen presenting cells (APC) and secrete cytokines. B cells express B cell receptor (BCR) on their cell membranes; and BCR allows the B cell to bind a specific antigen, against which it will initiate an antibody response. Dysregulation of B cells is associated with a variety of disorders.Human B-lymphocyte antigen CD19 (also known as Cluster of Differentiation 19, B-lymphocyte surface antigen B4, T-Cell Surface Antigen Leu-12, or CVID3) is a transmembrane protein widely expressed during all phases of B cell development until its terminal differentiation into plasma cells. Thus, human CD19 is a pan-B cell marker. CD19 is found in association with CD21, a complement receptor, and with CD81, a member of the tetraspan family (Carter, et al., Immunol. Res. 26: 45-54, 2002). CD19 is a co-receptor for the BCR and acts as an adaptor protein to recruit cytoplasmic signaling proteins to the BCR complex. CD19 is required for normal B cell function and is involved in diverse B cell responses, including B cell survival, proliferation, activation, and differentiation.Anti-human CD19 antibodies have been described previously and are being tested in clinical trials. Many known anti-human CD19 antibodies are B cell-depleting antibodies; for example, inebilizumab (also known as MEDI-551) and tafasitamab (also known as MOR208 or XmAb5574) in Phase III clinical trials, loncastuximab in Phase II clinical trial, 4G7SDIE and DI-B4 in Phase I clinical trial, were all reported to be B cell-depleting antibodies (Cree, et al., Lancet. 394(10206):1352-1363, 2019; Kellner, et al., Leukemia. 27(7):1595-1598, 2013; Kaplon, et al., MAbs. 12(1): 1703531, 2020; Seidel, et al., Mol. Ther. 24(9):1634-43, 2016; WO2007076950).Obexelimab (also known as XmAb5871) is an Fc-engineered antibody that binds both CD19 and FcYRIIb, and inhibits B cell function by engaging the inhibitory FcYRIIb receptor signaling (Szili, et al., MAbs. 6(4): 991-999, 2014). However, high affinity binding of obexelimab to FcYRIIb could lead to non-specific binding to other cell types. In human patients, obexelimab was reported to have a short half-life, with T1 / 2 of 3.5 ± 1.0 days; and reduce peripheral human B cell counts, with a mean reduction of about 30-40% of the baseline level (Jaraczewska-Baumann, et al., European League Against Rheumatism (EULAR) 2015 Annual Meeting Poster: A Phase 1b / 2a Study of the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of XmAb®5871 in Patients with Rheumatoid Arthritis, June 12, 2015, available at https: / / investors.xencor.com / static-files / 0017dcf1-deb2-46eb-93ff-90ba164ec50c).Therefore, there remains a need for alternative anti-human CD19 antibodies that specifically bind and inhibit human B cells, without depleting them, for treating B cell associated disorders.DETAILED DESCRIPTIONProvided herein are antibodies that bind human CD19 and inhibit B cell responses (e.g., proliferation, activation, and differentiation) without depleting the B cells (i.e., “non-depleting anti-human CD19 antibodies”). Such non-depleting anti-human CD19 antibodies can be used to treat B cell associated disorders, e.g., autoimmune diseases, without destroying those important immune cells, and thus avoid problematic concurrent immunocompromise, long-term immune suppression, and other complications resulting from B cell depletion. The anti-human CD19 antibodies provided herein have one or more of the following properties: 1) bind human CD19 (and sometimes cynomolgus monkey CD19) with desirable binding affinities and / or association and dissociation rates, 2) bind human B cells specifically and inhibit primary human B cell proliferation, activation and / or differentiation, 3) do not deplete human B cells, 4) being internalized into human B cells, 5) low immunogenicity risk, 6) low hydrophobicity, and / or 7) good stability, solubility, viscosity, and pharmacokinetic characteristics for development and use in the treatment of autoimmune disorders. As described below, in a side-by-side comparison, one such anti-human CD19 antibody CB3f is shown to bind human B cells with high specificity in a whole blood assay, whereas obexelimab shows non-specific binding to human neutrophils in addition to B cell binding. Since neutrophil is the most abundant type of white blood cells inhuman, the nonspecific binding to neutrophils might explain the short half-life of obexelimab observed in human patients. Additionally, in an in vitro B cell apoptosis assay, obexilimab is shown to induce primary human B cell apoptosis in a dose-dependent manner, whereas the antihuman CD19 antibody CB3f does not induce apoptosis of primary human B cells in the same assay.In one aspect, provided herein are novel non-depleting anti-human CD19 antibodies. In some embodiments, the anti-human CD19 antibodies are fully human antibodies.In some embodiments, provided herein are antibodies that bind human CD19, wherein the antibodies comprise a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises heavy chain complementarity determining regions (HCDR) HCDR1, HCDR2, and HCDR3, and the VL comprises light chain complementarity determining regions (LCDR) LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 29, the HCDR2 comprises SEQ ID NO: 30, the HCDR3 comprises SEQ ID NO: 31, the LCDR1 comprises SEQ ID NO: 32, the LCDR2 comprises SEQ ID NO: 33, and the LCDR3 comprises SEQ ID NO: 34. In some embodiments, the anti-human CD19 antibodies comprise a VH comprising SEQ ID NO: 37 and a VL comprising SEQ ID NO: 41.In some embodiments, the anti-human CD19 antibody has a human IgG1 or IgG4 isotype. In some embodiments, the anti-human CD19 antibody has a human IgG4 isotype. In some embodiments, the anti-human CD19 antibody has a modified human IgG4 hinge region comprising a S228P mutation (according to the EU Index Numbering), which reduces the IgG4 Fab-arm exchange in vivo (see Labrijn, et al., Nat. Biotechnol. 2009, 27(8):767). In some embodiments, the anti-human CD19 antibody has a human IgG1 isotype. In some embodiments, the anti-human CD19 antibody has a modified human IgG1 Fc region that has reduced or eliminated Fc effector functions such as antibody-dependent cell cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). Such an antibody is termed an “IgG1-effector null” antibody.In some embodiments, the anti-human CD19 antibody has a human IgG4 isotype. For example, in some embodiments, the antibody comprises a heavy chain (HC) comprising SEQ ID NO: 35 and a light chain (LC) comprising SEQ ID NO: 39. In some embodiments, the antibody has a human IgG1 isotype. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 50 and a LC comprising SEQ ID NO: 39. In some embodiments, theantibody is an IgG1-effector null antibody. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 52 and a LC comprising SEQ ID NO: 39.In some embodiments, provided herein are antibody fragments (e.g., Fab or scFv) that bind human CD19, wherein the antibody fragments comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 29, the HCDR2 comprises SEQ ID NO: 30, the HCDR3 comprises SEQ ID NO: 31, the LCDR1 comprises SEQ ID NO: 32, the LCDR2 comprises SEQ ID NO: 33, and the LCDR3 comprises SEQ ID NO: 34. In some embodiments, the antibody fragments comprise a VH comprising SEQ ID NO: 37 and a VL comprising SEQ ID NO: 41.Provided herein are also antibodies that bind human CD19, wherein the antibodies comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 29, the HCDR2 comprises SEQ ID NO: 30, the HCDR3 comprises SEQ ID NO: 31, the LCDR1 comprises SEQ ID NO: 43, the LCDR2 comprises SEQ ID NO: 44, and the LCDR3 comprises SEQ ID NO: 45. In some embodiments, the anti-human CD19 antibodies comprise a VH comprising SEQ ID NO: 37 and a VL comprising SEQ ID NO: 48. In some embodiments, the antibody has a human IgG4 isotype. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 35 and a LC comprising SEQ ID NO: 46. In some embodiments, the antibody has a human IgG1 isotype. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 50 and a LC comprising SEQ ID NO: 46. In some embodiments, the antibody is an IgG1-effector null antibody. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 52 and a LC comprising SEQ ID NO: 46.In some embodiments, provided herein are antibody fragments (e.g., Fab or scFv) that bind human CD19, wherein the antibody fragments comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 29, the HCDR2 comprises SEQ ID NO: 30, the HCDR3 comprises SEQ ID NO: 31, the LCDR1 comprises SEQ ID NO: 43, the LCDR2 comprises SEQ ID NO: 44, and the LCDR3 comprises SEQ ID NO: 45. In some embodiments,the antibody fragments comprise a VH comprising SEQ ID NO: 37 and a VL comprising SEQ ID NO: 48.Also provided herein are antibodies that bind human CD19, wherein the antibodies comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 15, the HCDR2 comprises SEQ ID NO: 16, the HCDR3 comprises SEQ ID NO: 17, the LCDR1 comprises SEQ ID NO: 18, the LCDR2 comprises SEQ ID NO: 19, and the LCDR3 comprises SEQ ID NO: 20. In some embodiments, the anti-human CD19 antibodies comprise a VH comprising SEQ ID NO: 23 and a VL comprising SEQ ID NO: 27. In some embodiments, the antibody has a human IgG4 isotype. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 21 and a LC comprising SEQ ID NO: 25. In some embodiments, the antibody has a human IgG1 isotype. In some embodiments, the antibody is an IgG1-effector null antibody. For example, in some embodiments, the antibody comprises a HC comprising SEQ ID NO: 54 and a LC comprising SEQ ID NO: 25.In some embodiments, provided herein are antibody fragments (e.g., Fab or scFv) that bind human CD19, wherein the antibody fragments comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 15, the HCDR2 comprises SEQ ID NO: 16, the HCDR3 comprises SEQ ID NO: 17, the LCDR1 comprises SEQ ID NO: 18, the LCDR2 comprises SEQ ID NO: 19, and the LCDR3 comprises SEQ ID NO: 20. In some embodiments, the antibody fragments comprise a VH comprising SEQ ID NO: 23 and a VL comprising SEQ ID NO: 27.Also provided herein are antibodies that bind human CD19, wherein the antibodies comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 1, the HCDR2 comprises SEQ ID NO: 2, the HCDR3 comprises SEQ ID NO: 3, the LCDR1 comprises SEQ ID NO: 4, the LCDR2 comprises SEQ ID NO: 5, and the LCDR3 comprises SEQ ID NO: 6. In some embodiments, the anti-human CD19 antibodies comprise a VH comprising SEQ ID NO: 9 and a VL comprising SEQ ID NO: 13. In some embodiments, the antibody comprises a HC comprising SEQ ID NO: 7 and a LC comprising SEQ ID NO: 11.In some embodiments, provided herein are antibody fragments (e.g., Fab or scFv) that bind human CD19, wherein the antibody fragments comprise a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 1, the HCDR2 comprises SEQ ID NO: 2, the HCDR3 comprises SEQ ID NO: 3, the LCDR1 comprises SEQ ID NO: 4, the LCDR2 comprises SEQ ID NO: 5, and the LCDR3 comprises SEQ ID NO: 6. In some embodiments, the antibody fragments comprise a VH comprising SEQ ID NO: 9 and a VL comprising SEQ ID NO: 13.In another aspect, provided herein are nucleic acids encoding a heavy chain or light chain, or a VH or VL, of the novel anti-human CD19 antibodies described herein, and vectors comprising such nucleic acids.In some embodiments, provided herein are nucleic acids encoding a heavy chain or light chain of the anti-human CD19 antibodies described herein. In some embodiments, provided herein are nucleic acids comprising a sequence encoding SEQ ID NO: 35, 52, 50, 39, 46, 21, 54, 25, 7 or 11. In some embodiments, provided herein are nucleic acids comprising a sequence encoding an antibody heavy chain that comprises SEQ ID NO: 35, 52, 50, 21, 54, or 7. For example, the nucleic acid can comprise a sequence selected from SEQ ID NO: 36, 53, 51, 22, 55, or 8. In some embodiments, provided herein are nucleic acids comprising a sequence encoding an antibody light chain that comprises SEQ ID NO: 39, 46, 25, or 11. For example, the nucleic acid can comprise a sequence selected from SEQ ID NO: 40, 47, 26, or 12.Also provided herein are nucleic acids encoding a VH or VL of the anti-human CD19 antibodies described herein. In some embodiments, provided herein are nucleic acids comprising a sequence encoding SEQ ID NO: 37, 23, 27, 9, 41, 48, 13. In some embodiments, provided herein are nucleic acids comprising a sequence encoding an antibody VH that comprises SEQ ID NO: 37, 23, 27, 9. For example, the nucleic acid can comprise a sequence selected from SEQ ID NO: 38, 24, 28, 10. In some embodiments, provided herein are nucleic acids comprising a sequence encoding an antibody VL that comprises SEQ ID NO: 41, 48, 13. For example, the nucleic acid can comprise a sequence selected from SEQ ID NO: 42, 49, 14.Provided herein are also vectors comprising a nucleic acid sequence encoding an antibody heavy chain or light chain. For example, such vectors can comprise a nucleic acid sequence encoding SEQ ID NO: 35, 52, 50, 39, 46, 21, 54, 25, 7, or 11. In some embodiments, the vector comprises SEQ ID NO: 36, 53, 51, 40, 47, 22, 55, 26, 8, or 12.Provided herein are also vectors comprising a nucleic acid sequence encoding an antibody VH or VL. For example, such vectors can comprise a nucleic acid sequence encoding SEQ ID NO: 37, 23, 27, 9, 41, 48, or 13. In some embodiments, the vector comprises SEQ ID NO: 38, 24, 28, 10, 42, 49, or 14.Provided herein are also vectors comprising a first nucleic acid sequence encoding an antibody heavy chain and a second nucleic acid sequence encoding an antibody light chain. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 35, 50, or 52, and a second nucleic acid sequence encoding SEQ ID NO: 39 or 46. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second nucleic acid sequence encoding SEQ ID NO: 25.In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 35 and a second nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 52 and a second nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 50 and a second nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 35 and a second nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 52 and a second nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 50 and a second nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 21 and a second nucleic acid sequence encoding SEQ ID NO: 25. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 54 and a second nucleic acid sequence encoding SEQ ID NO: 25. In some embodiments, the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 7 and a second nucleic acid sequence encoding SEQ ID NO: 11.Also provided are compositions comprising a first vector comprising a nucleic acid sequence encoding an antibody heavy chain, and a second vector comprising a nucleic acid sequence encoding an antibody light chain. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35, 52, or 50, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39 or 46. In someembodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25.In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 52 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 50 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 52 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 50 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 46. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 21 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 54 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25. In some embodiments, the composition comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 7 and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 11.Nucleic acids of the present disclosure may be expressed in a host cell, for example, after the nucleic acids have been operably linked to an expression control sequence. Expression control sequences capable of expression of nucleic acids to which they are operably linked are well known in the art. An expression vector may include a sequence that encodes one or more signal peptides that facilitate secretion of the polypeptide(s) from a host cell. Expression vectors containing a nucleic acid of interest (e.g., a nucleic acid encoding a heavy chain or light chain of an antibody) may be transferred into a host cell by well-known methods, e.g., stable or transienttransfection, transformation, transduction or infection. Additionally, expression vectors may contain one or more selection markers, e.g., tetracycline, neomycin, and dihydrofolate reductase, to aide in detection of host cells transformed with the desired nucleic acid sequences.In another aspect, provided herein are cells, e.g., host cells, comprising the nucleic acids, vectors, or nucleic acid compositions described herein. A host cell may be a cell stably or transiently transfected, transformed, transduced or infected with one or more expression vectors expressing all or a portion of an antibody described herein. In some embodiments, a host cell may be stably or transiently transfected, transformed, transduced or infected with an expression vector expressing HC and LC polypeptides of an antibody of the present disclosure. In some embodiments, a host cell may be stably or transiently transfected, transformed, transduced or infected with a first vector expressing HC polypeptides and a second vector expressing LC polypeptides of an antibody described herein. Such host cells, e.g., mammalian host cells, can express the anti-human CD19 antibodies described herein. Mammalian host cells known to be capable of expressing antibodies include CHO cells, HEK293 cells, COS cells, and NS0 cells.In some embodiments, the cell, e.g., host cell, comprises a vector comprising a first nucleic acid sequence encoding SEQ ID NO: 35, 50, or 52, and a second nucleic acid sequence encoding SEQ ID NO: 39 or 46. In some embodiments, the cell, e.g., host cell, comprises a vector comprising a first nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second nucleic acid sequence encoding SEQ ID NO: 25.In some embodiments, the cell, e.g., host cell, comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35, 52, or 50, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39 or 46. In some embodiments, the cell, e.g., host cell, comprises a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25.The present disclosure further provides a process for producing an anti-human CD19 antibody described herein by culturing the host cell described above, e.g., a mammalian host cell, under conditions such that the antibody is expressed and recovering the expressed antibody from the culture medium. The culture medium, into which an antibody has been secreted, may be purified by conventional techniques. Various methods of protein purification may be employed, and such methods are known in the art and described, for example, in Deutscher, Methods inEnzymology 182: 83-89 (1990) and Scopes, Protein Purification: Principles and Practice, 3rd Edition, Springer, NY (1994).Also provided are antibodies produced by any of the processes described herein.In another aspect, provided herein are pharmaceutical compositions comprising an antibody, nucleic acid, or vector described herein. Such pharmaceutical compositions can also comprise one or more pharmaceutically acceptable excipient, diluent or carrier. Pharmaceutical compositions can be prepared by methods well known in the art (e.g., Remington: The Science and Practice of Pharmacy, 22nd ed. (2012), A. Loyd et al., Pharmaceutical Press).The anti-human CD19 antibodies, nucleic acids, vectors, or pharmaceutical compositions described herein can be used for treating B cell associated disorders. Because of their critical role in regulating the immune system, dysregulation of B cells is associated with a variety of disorders. B cell associated disorders include autoimmune diseases, which are caused by activation of self-reactive B cells and T cells, and lymphomas and leukemias, which are caused by excessive and / or uncontrolled B cell proliferation. Examples of B cell associated autoimmune diseases include rheumatoid arthritis, systemic lupus erythematosus, multiple sclerosis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, Type 1 diabetes, Pemphigus vulgaris, Neuromyelitis optica, ANCA vasculitis (anti-neutrophil cytoplasmic antibody-associated vasculitis), Myasthenia gravis.Given the anti-human CD19 antibodies described herein do not deplete B cells, they offer advantages over the B cell depleting antibodies for treating autoimmune diseases and can avoid problematic concurrent immunocompromise, long-term immune suppression, and other complications resulting from B cell depletion. As shown below, the anti-human CD19 antibodies described herein are internalized in primary human B cells. Thus, the anti-human CD19 antibodies described herein can also be used to deliver other therapeutic agents into human B cells.In some embodiments, provided herein are methods of treating a B cell associated disorder, e.g., an autoimmune disease, in a subject (e.g., a human patient) in need thereof, by administering to the subject a therapeutically effective amount of an anti-human CD19 antibody, a nucleic acid encoding such an anti-human CD19 antibody, a vector comprising such a nucleic acid, or a pharmaceutical composition comprising such an anti-human CD19 antibody, nucleic acid or vector, as described herein. The antibodies, nucleic acids, vectors, or pharmaceuticalcompositions described herein may be administered by parenteral routes (e.g., subcutaneous and intravenous). In some embodiments, the B cell associated disorder is selected from systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, Type 1 diabetes, Pemphigus vulgaris, Neuromyelitis optica, ANCA vasculitis, Myasthenia gravis.Also provided are anti-human CD19 antibodies, nucleic acids, vectors, or pharmaceutical compositions described herein for use in therapy. Furthermore, the present disclosure also provides anti-human CD19 antibodies, nucleic acids, vectors, or pharmaceutical compositions described herein for use in the treatment of a B cell associated disorder, e.g., e.g., an autoimmune disease, e.g., systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, Type 1 diabetes, Pemphigus vulgaris, Neuromyelitis optica, ANCA vasculitis, Myasthenia gravis.Provided herein are also use of the anti-human CD19 antibodies, nucleic acids, vectors, or pharmaceutical compositions described herein in the manufacture of a medicament for the treatment of a B cell associated disorder, e.g., an autoimmune disease, e.g., systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, or Type 1 diabetes, Pemphigus vulgaris, Neuromyelitis optica, ANCA vasculitis, Myasthenia gravis.As used herein, the term “a,” “an,” “the” and similar terms used in the context of the present disclosure (especially in the context of the claims) are to be construed to cover both the singular and plural unless otherwise indicated herein or clearly contradicted by the context.The term “antibody,” as used herein, refers to an immunoglobulin molecule that binds an antigen. Embodiments of an antibody include a monoclonal antibody, polyclonal antibody, human antibody, humanized antibody, chimeric antibody, or conjugated antibody. The antibodies can be of any class (e.g., IgG, IgE, IgM, IgD, IgA) and any subclass (e.g., IgG1, IgG2, IgG3, IgG4).An exemplary antibody is an immunoglobulin G (IgG) type antibody comprised of four polypeptide chains: two heavy chains (HC) and two light chains (LC) that are cross-linked via inter-chain disulfide bonds. The amino-terminal portion of each of the four polypeptide chains includes a variable region of about 100-125 or more amino acids primarily responsible for antigen recognition. The carboxyl-terminal portion of each of the four polypeptide chainscontains a constant region primarily responsible for effector function. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region. Each light chain is comprised of a light chain variable region (VL) and a light chain constant region. The IgG isotype may be further divided into subclasses (e.g., IgG1, IgG2, IgG3, and IgG4).The VH and VL regions can be further subdivided into regions of hyper-variability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). The CDRs are exposed on the surface of the protein and are important regions of the antibody for antigen binding specificity. Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Herein, the three CDRs of the heavy chain are referred to as “HCDR1, HCDR2, and HCDR3” and the three CDRs of the light chain are referred to as “LCDR1, LCDR2 and LCDR3”. The CDRs contain most of the residues that form specific interactions with the antigen. Assignment of amino acid residues to the CDRs may be done according to the well-known schemes, including those described in Kabat (Kabat et al., “Sequences of Proteins of Immunological Interest,” National Institutes of Health, Bethesda, Md. (1991)), Chothia (Chothia et al., “Canonical structures for the hypervariable regions of immunoglobulins”, Journal of Molecular Biology, 196, 901-917 (1987); Al-Lazikani et al., “Standard conformations for the canonical structures of immunoglobulins”, Journal of Molecular Biology, 273, 927-948 (1997)), North (North et al., “A New Clustering of Antibody CDR Loop Conformations”, Journal of Molecular Biology, 406, 228-256 (2011)), or IMGT (the international ImMunoGeneTics database available on at www.imgt.org; see Lefranc et al., Nucleic Acids Res. 1999; 27:209-212). The North CDR definitions are used for the anti-human CD19 antibodies described herein.Exemplary embodiments of antibodies of the present disclosure also include antibody fragments or antigen-binding fragments, which comprise at least a portion of an antibody retaining the ability to specifically interact with an antigen such as Fab, Fab’, F(ab’)2, Fv fragments, scFv, scFab, disulfide-linked Fvs (sdFv), a Fd fragment and linear antibodies.The terms “bind” and “binds” as used herein are intended to mean, unless indicated otherwise, the ability of a protein or molecule to form a chemical bond or attractive interaction with another protein or molecule, which results in proximity of the two proteins or molecules as determined by common methods known in the art.The term “CD19” as used herein, unless stated otherwise, refers to human B-lymphocyte antigen CD19 (also known as Cluster of Differentiation 19, B-lymphocyte surface antigen B4, T-Cell Surface Antigen Leu-12, or CVID3). The amino acid sequence of human CD19 is known in the art, e.g., NCBI Reference Sequence NP_001171569.1 (isoform 1, SEQ ID NO: 56) or NP_001761.3 (isoform 2, SEQ ID NO: 57). Isoform 2 is a splice variant of isoform 1 and is one amino acid shorter than isoform 1 in the intracellular domain. The term “CD19” is used herein to refer collectively to all known human CD19 isoforms and polymorphic forms.The term “Fc region” as used herein refers to a region of an antibody, which comprises the CH2 and CH3 domains of the antibody heavy chain. Optionally, the Fc region may include a portion of the hinge region or the entire hinge region of the antibody heavy chain.The term “non-depleting antibody” as used herein refers to an antibody that does not significantly reduce B cell numbers in a subject after treatment, as compared to the B cell numbers before the treatment. B cell number can be measured using well-known assays such as those described in the Examples. A non-depleting antibody typically does not induce antibody dependent cellular cytotoxicity (ADCC), antibody dependent cellular phagocytosis (ADCP), complement dependent cellular cytotoxicity (CDC), or apoptosis of the B cells.The terms “nucleic acid” or “polynucleotide”, as used interchangeably herein, refer to polymers of nucleotides, including single-stranded and / or double-stranded nucleotide-containing molecules, such as DNA, cDNA and RNA molecules, incorporating native, modified, and / or analogs of, nucleotides. Polynucleotides of the present disclosure may also include substrates incorporated therein, for example, by DNA or RNA polymerase or a synthetic reaction.The term “subject”, as used herein, refers to a mammal, including, but are not limited to, a human, chimpanzee, ape, monkey, cattle, horse, sheep, goat, swine, rabbit, dog, cat, rat, mouse, guinea pig, and the like. Preferably the subject is a human.The term “therapeutically effective amount,” as used herein, refers to an amount of a protein or nucleic acid or vector or composition that will elicit the biological or medical response of a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, slow or delay disease progression, or prevent a disease, etc. In a non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of a protein or nucleic acid or vector or composition that, when administered to a subject, is effectiveto at least partially alleviate, inhibit, prevent and / or ameliorate a condition, or a disorder or a disease.As used herein, “treatment” or “treating” refers to all processes wherein there may be a slowing, controlling, delaying or stopping of the progression of the disorders or disease disclosed herein, or ameliorating disorder or disease symptoms, but does not necessarily indicate a total elimination of all disorder or disease symptoms. Treatment includes administration of a protein or nucleic acid or vector or composition for treatment of a disease or condition in a patient, particularly in a human.BRIEF DESCRIPTION OF THE DRAWINGSFIGs. 1A-1B show the surface hydrophobicity profiles of the anti-human CD19 parental antibody C323 (FIG. 1A) and the optimized anti-human CD19 antibody CB3f (FIG. 1B).FIG. 2 shows the binding of anti-human CD19 antibodies to human CD19 in an ELISA assay.FIG. 3 shows the inhibition of primary B cell proliferation by the anti-human CD19 mAb CB3f.FIG. 4 shows the inhibition of B cell activation in whole blood by the anti-human CD19 mAb CB3f.FIG. 5 shows the inhibition of B cell differentiation into plasmablasts by the anti-human CD19 mAb CB3f.FIGs. 6A-6B show the anti-human CD19 mAb CB3f lacks CDC (FIG. 6A) and ADCC (FIG. 6B) activities.FIG. 7 shows binding specificity of anti-human CD19 mAb CB3f and obexelimab to cells in human whole blood.FIG. 8 shows difference in the induction of B cell apoptosis by obexilimab and antihuman CD19 mAb CB3f.FIGs. 9A-9B show the reduction of human IgM in NSG mice treated with anti-human CD19 mAb CB3f on Day 6 (FIG. 9A) and Day 10 (FIG. 9B) after treatment.FIG. 10 shows the reduction of CD86 expression on human B cells in NSG mice treated with anti-human CD19 mAb CB3f.FIG. 11 shows the frequency of B cells in NSG mice treated with anti-human CD19 mAbCB3f.FIG. 12 shows the internalization of anti-human CD19 mAb1 (CB3f) and anti-human CD19 mAb2 (C323.C1) in primary human B cells.FIGs. 13A-13B show comparison of the efficacy of a non-depleting CD19 surrogate Ab and a depleting CD20 surrogate Ab in the mouse collagen-induced arthritis (CIA) model.FIG.13A shows treatment with the non-depleting CD19 surrogate Ab in semi-established mode reduced clinical score greater than the depleting CD20 surrogate Ab in the mouse CIA model. Clinical scores of mice between Day 21 and Day 42 of the study (n = 12 / group except n = 5 for Isotype control treated no disease control group). Symbols represent mean of group and error bars represent standard error of the mean (SEM). Animals were dosed starting Day 19.FIG.13B shows treatment with the non-depleting CD19 surrogate Ab reduced clinical score AUC (Days 24 to 42) greater than the depleting CD20 surrogate Ab in the mouse CIA model. Clinical score AUCs of mice between Day 24 and Day 42 of the study (n = 12 / group except n = 5 for isotype control treated no disease control group). Bars represent mean of group and error bars represent standard error of the mean (SEM). Mice were dosed starting Day 19. Bars that do not share a common letter are significantly different from each other (p<.05 one-way analysis of variance (ANOVA) Tukey’s post-hoc).FIG. 14 shows treatment with the non-depleting CD19 surrogate Ab in semi-therapeutic mode delayed and reduced incidence of diabetes greater than the depleting CD20 surrogate Ab in the NOD model of Type 1 diabetes. Incidence of diabetes (mice with blood glucose levels above 240 mg / dl were considered as diabetic>. n = 10 / group except n = 9 for untreated group). Animals were dosed starting at 12 weeks of age.FIG. 15 shows treatment with the non-depleting CD19 surrogate Ab in semi-therapeutic mode reduced clinical score greater than the depleting CD20 surrogate Ab in the mouse EAE model. Clinical scores of mice between Day 6 and Day 42 of the study (n = 12 / group). Symbols represent mean of group and error bars represent standard error of the mean (SEM). Animals were dosed starting Day 6. * p<0.05 vs same day isotype control.EXAMPLESThe following examples are offered to illustrate, but not to limit, the claimed invention.Example 1. Generation of antibodies that bind human CD19 (anti-human CD19 antibodies).Anti-human CD19 antibody C323 is discovered from a phage display library using cellbased panning against human embryonic kidney (HEK) cells co-transfected with human CD19 (SEQ ID NO: 56) and its co-receptor CD21. A negative panning against parental HEK-293 cells is used to remove non-specific cell binders. CD19-specific binding is confirmed using CD19 extracellular domain (ECD) protein by ELISA. Following conversion to IgG format and purification, cell binding is confirmed using Daudi human Burkitt's lymphoma cell line and isolated primary human B cells by FACS.Hydrophobic interaction chromatography (HIC) is a technique for separation of proteins commonly used for characterization of antibody variants; and the retention time to the HIC column of a protein of interest reflects its overall hydrophobicity (J Pharm Biomed Anal. 2016 130:3-18). C323 is deemed to be hydrophobic due to prolonged HIC column retention time. Antibody hydrophobicity can cause manufacture problems such as poor expression and protein aggregation. Targeted and random mutagenesis is used to enhance the biophysical properties of C323 and increase its affinity and potency. A homology model of the variable region of the C323 anti-human CD19 parental mAb is created. A spatial aggregation propensity algorithm is then applied to the model to identify surface exposed hydrophobic patches. This process identifies eight surface-exposed hydrophobic residues within LCDR1, HCDR2 and HCDR3: LCDR1: Y31, Y32; HCDR2: I52, I53 and F54; HCDR3: F97, Y99 and Y100a (Kabat numbering) (FIG. 1A). These residues are targeted for mutagenesis. Libraries are created to include more hydrophilic (polar or charged) amino acids using VVK codon-based mutagenic oligonucleotides and incorporated using Kunkel mutagenesis into an uracil-containing single-stranded DNA template encoding the original C323 parental antibody with the selected CDR sequences deleted. Phage-expressed Fabs are screened using biotinylated human CD19 ECD antigen. Affinity neutral mutations identified in this manner are DNA sequenced and unique clones expressed as periplasmic Fab in E.coli and analyzed by titration ELISA. This process identified three affinity neutral but more hydrophilic amino acid substitutions: LCDR1: Y31H, HCDR2: F54Y and HCDR3: Y99K (Kabat numbering).In parallel, optimization to increase affinity is done using NNK codon-based mutagenic oligonucleotides targeting all six CDRs and incorporated using Kunkel mutagenesis into anuracil-containing single-stranded DNA template with the selected CDRs deleted. Screening of phage-expressed Fab variants is done by capture-lift (Anal Biochem. 1998 256(2):169-77) and ELISA using a biotinylated human CD19 ECD antigen. In this manner, CDR substitutions leading to increased affinity are identified: HCDR1: F29I, I34Y; HCDR2: G55D, HCDR3: G100bA; LCDR1: G27aK, A34H, LCDR2: S52R, A55P, LCDR3: N93Q (Kabat numbering) and combined, leading to the generation of C323.C1.The three hydrophilic substitutions described above (Y31H, F54Y and Y99K) are added to C323.C1, generating a Fab template that is used for a final round of CDR randomization using NNK codon-based mutagenesis. Beneficial CDR mutations are combined in a library allowing all the beneficial mutations to be randomly combined or back-mutated to wild type sequence. This process identifies a high-affinity variant termed CB3. CB3 contains additional CDR residue substitutions: HCDR1: G27H, HCDR2: G50D, I53A, D55G, T56S, A57P; LCDR1: K27aH, H34A, LCDR3: L95Q (Kabat numbering).Using CB3 as a template, additional CDR changes are made to revert specific residues to human IGKV3-20 germline identity. One residue in LCDR1: N29S and five residues in LCDR2: A50G, T51A, R52S, T53S, P55A are simultaneously reverted with minimal impact on the antibody’s functions. This resulted in a final molecule called CB3f.Several versions of the CB3f are generated, including (1) an IgG4 isotype comprising a HC of SEQ ID NO: 35 and a LC of SEQ ID NO: 39; (2) an IgG1 isotype comprising a HC of SEQ ID NO: 50 and a LC of SEQ ID NO: 39, and (3) an IgG1 effector null antibody comprising a HC of SEQ ID NO: 52 and a LC of SEQ ID NO: 39. Unless otherwise specified, “CB3f” refers to the IgG4 isotype comprising a HC of SEQ ID NO: 35 and a LC of SEQ ID NO: 39.FIGs.1A-1B show the improved surface hydrophobicity profile of CB3f compared to the parental antibody C323. The retention time of CB3f on a HIC column was reduced more than two folds when compared to the parental antibody C323. At the same time, the CB3f antibody titer from a transient CHO expression has increased more than two fold when compared to the parental C323 antibody titer.FIG. 2 shows the improved binding to human CD19 by the affinity engineered antibodies CB3 and CB3f, when compared to C323 and C323.C1, in an ELISA assay. The ELISA assay is performed as follows. A 96 well microtiter plate is coated overnight at 4°C using 50 ^L / well of goat anti-human kappa polyclonal antibody diluted to 5 ^g / mL in phosphate buffered saline(PBS). Following overnight incubation, the plate is aspirated and blocked using 200 ^L of casein buffer for 1 hour at room temperature. The plate is washed three times using PBST (PBS with 0.1% Tween). The anti-human CD19 antibodies are diluted to 5 ^g / mL in PBS casein and 50 ^L added to each column of the anti-human kappa coated casein blocked plate for 1 hour at 37°C. The plate is washed three times using PBST. Biotinylated human CD19 extracellular domain protein is serially diluted from 20 ^g / mL to 9 ng / mL and 50 ^L added to the plates and incubated for 1 hour at 37°C. The plate is washed three times using PBST and then transferred to a beaker containing 1 liter of PBST and incubated with stirring overnight (approx. 16 hr) at 37°C. The wash buffer is aspirated and 50 ^L of neutravidin alkaline phosphatase-conjugate diluted 1:1000 in casein buffer is added and incubated for 1 hour at 37°C. The plate is washed three times using PBS 0.1% Tween. Fifty ^L of AMP-PMP substrate diluted 1:35 in deionized water is added and the absorbance at 560 nm read on a Spectramax plate reader.As shown below, CB3f shows high affinity binding to human CD19 expressing CHO cells and has unexpectedly acquired binding to cynomolgus monkey CD19 expressing CHO cells. CB3f has 92% and 96% identity to human IGHV1-69 and IGKV3-20 germlines, respectively. Hence the anti-human CD19 antibody CB3f has high affinity, low hydrophobicity, and high percentage of human germline identity, i.e., low immunogenicity risk.The anti-human CD19 antibodies described herein, including but not limited to, CB3f, can be expressed in a mammalian cell line such as HEK293 or CHO, either transiently or stably transfected with an expression system for secreting the antibody using an optimal predetermined HC:LC vector ratio or a single vector system encoding both HCs and LC. Clarified media, into which the antibody has been secreted, can be purified using the commonly used techniques. The purity of the antibody, after these chromatography steps, may achieve a value greater than 99.0% (monomer).Example 2. Characterization of the anti-human CD19 antibodies.Binding Affinity to CD19The solution-phase equilibrium binding affinities of the anti-human CD19 mAb CB3f to membrane-bound human CD19 and cynomolgus monkey CD19 stably expressed on CHO cells are measured by an MSD solution equilibrium titration (MSD-SET) assay at 37°C. Additionally,the monovalent affinity and kinetics of CB3f Fab fragment binding to CD19 are measured by surface plasmon resonance (SPR) at 37°C.An MSD SI6000 instrument (Meso Scale Discovery, Rockville, MD) is used for reading MSD plates. MSD assay plates are prepared as follows. A multi-array 96-well plate (Meso Scale Discovery, P / N L15XA-3) is coated overnight at 4°C with a 1 pg / mL solution of a goat anti-human Fc capture antibody (Jackson ImmunoResearch, P / N 109-005-098) in PBS. Plates are washed 3X in TBS + 0.1% Tween-20 (TBST) following coating.CHO cells stably expressing human and cynomolgus monkey CD19 cells are fixed in 1% paraformaldehyde in PBS for 5 minutes at room temperature. Paraformaldehyde is removed by washing with PBS, and the cells are stored at 4°C in 1% Blocker A (diluted from 3% Blocker A, Meso Scale Discovery, P / N R93AA-1) with 0.05% (w / v) sodium azide.For the human CD19 affinity measurement, samples are prepared in duplicates with a fixed antibody concentration of 400 pM, 80 pM, 16 pM and 3.2 pM. For the cynomolgus monkey CD19 affinity measurement, samples are prepared in duplicates with a fixed antibody concentration of 10 nM, 2 nM, 400 pM, and 80 pM. Fixed human CD19 CHO cells are pelleted by centrifugation and resuspended in 3% Blocker A solution at 22 x 106 cells / mL. Fixed cynomolgus monkey CD19 CHO cells are pelleted by centrifugation and resuspended in 3% Blocker A solution at 200 x 106 cells / mL. The cells are serially diluted 2.5-fold in a conical-bottom 96-well plate in 3% Blocker A down to approximately 900 cells / mL for human CD19 and 8,400 cell / mL for cynomolgus monkey CD19 for a total of 12 cell dilutions each. These are mixed 1:1 with previously prepared antibody dilutions. For human CD19, the final antibody concentrations are 200 pM, 40 pM, 8 pM and 1.6 pM, and the final cell dilutions of 11 x 106 cells / mL down to approximately 450 cells / mL. For cynomolgus monkey CD19, the final antibody concentrations are 5 nM, 1 nM, 200 pM and 40 pM, and the final cell dilutions of 100 x 106 cells / mL down to approximately 4,200 cells / mL. The plate is incubated on a plate shaker at 37°C for 3-4 days for human CD19 and 2 days for cynomolgus monkey CD19 to allow binding to reach equilibrium.Following incubation, cells are pelleted by centrifugation. One hundred microliters of the clarified supernatant from the plate is transferred to the prepared MSD plate and incubated on a plate shaker at room temperature for 60 minutes. Following incubation, the plate is washed 3X with TBST, then 100 pL of 1 pg / mL biotinylated goat anti-human IgG primary antibody(Southern Biotech, Catalog 2010-08) in 1% Blocker A is added to all wells. This is incubated on a plate shaker at room temperature for 60 minutes. The plate was washed 3X with TBST, then 100 pL of 1pg / mL SULFO-TAG streptavidin (Meso Scale Discovery, P / N R32AD-1) in 1% Blocker A was added to all wells. This was incubated on a plate shaker at room temperature for 60 minutes. The plate is washed 3x with TBST, then 1X Read Buffer T (Meso Scale Discovery, P / NR92TC-1) is added immediately before reading the plate. Dissociation constant (KD) and a least common multiplier (LCM) to account for unknown antigen concentrations on cells are globally fit from the MSD-SET data to an equilibrium binding equation (see Darling and Brault, 2005, Kinetic Exclusion Assay Technology: Characterization of Molecular Interactions. Assay and Drug Development Technologies 2: 647-657) using non-linear regression in GraphPad Prism.Biacore T200 instrument (GE Healthcare Life Sciences), reagents, and Biacore T200 Evaluation Software Ver 3.1 are used for the surface plasmon resonance analysis of human, mouse and cynomolgus monkey CD19 binding to the Fab fragment of CB3f. Recombinant CD19-Fc proteins are purchased from R&D Systems. A protein A sensor chip (GE protein A chip P / N 2912755) is used. Running buffer is 1X HBS-EP+ (Teknova P / N H8022), and running temperature is 37°C.CD19 Fc fusion proteins are diluted to 3 pg / mL in running buffer, and approximately 60 RU each of human, cynomolgus monkey, and mouse proteins are captured in flow cells (Fc) 2, 3 and 4, respectively. CB3f Fab fragment is diluted to 1000 nM in running buffer and then 5-fold serially diluted in running buffer to 1.6 nM for a total of 5 dilutions. Fab or buffer blank is injected at 50 pL / min for 300 seconds followed by a 900 second dissociation phase. Regeneration is performed by injecting 10 mM glycine pH 1.5 for 30 seconds at 50 pL / min over all Fc. Reference-subtracted data is collected as Fc2-Fc1, Fc3-Fc1 and Fc4-Fc1, and then reference-subtracted data is blank subtracted. The on-rate (kon) and off-rate (koff) are fit using the “1:1 Binding” model. The affinity (KD) is calculated from the binding kinetics according to the relationship: KD = koff / kon.CB3f binds to human and cynomolgus monkey CD19 expressed on CHO cells with an affinity (KD) of 3.35 pM and 45.2 pM, respectively (Table 1).The Fab fragment of CB3f binds to human CD19 with an on-rate (kon) of 3.20 x 106 M-1s-1, an off-rate (koff) of 2.35 x 10-4 s-1, and an affinity (KD) of 76.8 pM (Table 2). The Fabfragment of CB3f binds to cynomolgus monkey CD19 with an on-rate (kon) of 1.04 x 106 M-1s-1, an off-rate (koff) of 9.78 x 10-2 s-1, and an affinity (KD) of 94.5 nM (Table 2). No binding to mouse CD19 is observed at 1^M Fab concentration.Table 1: In vitro binding of CB3f to fixed CHO cells expressing either human or cynomolgus monkey CD19.[Measured by MSD-SET at 37°C. Results are reported as the geometric mean of the KD from 3 independent replicates. Error estimate is calculated as geometric mean x standard deviation log10 KD x ln 10]Species mAb Affinity (pM) Human CD19 3.35 ± 0.56 Cynomolgus monkey CD19 45.2 ± 2.8 Table 2: In vitro binding parameters of the Fab fragment of CB3f to human, cynomolgus monkey, and mouse CD19 Fc fusion proteins.[Measured by Surface Plasmon Resonance (SPR) at 37°C. Results are reported as the mean ±standard deviation of 3 independent replicates.]Species Fab On-Rate (kon) (M-1s-1 x 106) Fab Off-Rate (koff) (s-1 x 10-4) Fab Affinity (Kd) (pM) Human CD19 3.20 ± 1.15 2.35 ± 0.37 76.8 ± 16.0 Cynomolgus monkey CD19 1.04 ± 0.03 978 ± 79 94,500 ± 7,900 Mouse CD19 No binding observed at 1 uM Fab concentration StabilityStability of CB3f is assessed at a high concentration (approximately 100 mg / mL) in 5 mM histidine buffer (pH 6.0) with excipients. Concentrated samples are incubated for a period of 4 weeks at 5°C and 35°C. Following incubation, samples are analyzed for the percentage of high molecular weight (%HMW) with size exclusion chromatography (SEC), for fragmentation by capillary electrophoresis (CE-SDS), and for chemical modification (for example deamidation, isomerization, or oxidation) by LC-MS peptide mapping. After 4 weeks at 35°C, CB3f exhibits A%HMW of 0.5%, A%fragments of 0.6%, and no CDR chemical modifications greater than 0.2%.Freeze / thaw stability under the same conditions is evaluated using a 3 repeated slow, controlled temperature cycle which mimics the freeze / thaw conditions of large volumes of bulkdrug substance placed at -70°C. CB3f exhibits A%HMW of 1.9% as measured by SEC after the 3 freeze-thaw cycles. Other excipients can further reduce %HMW growth (data unshown).These results indicate CB3f possesses good physical and chemical stabilities.SolubilitySolubility is assessed by concentrating 100mg of CB3f with a 30 kDa molecular weight cut-off centrifugal filter (for example, Amicon U.C. filters, Millipore, catalog # UFC903024) to a volume of approximately 0.5 mL. The final concentration of the sample is measured by UV absorbance at 280 nm using a Solo VPE spectrophotometer (C Technologies, Inc).CB3f displays a solubility of greater than or equal to 183 mg / mL in 5 mM histidine pH 6 buffer and greater than or equal to 170 mg / mL in PBS (phosphate-buffered saline) pH 7.4. These results indicate that CB3f exhibits high solubility.ViscosityViscosity of CB3f is analyzed at 15°C at an approximate concentration of 125 mg / mL in 5 mM histidine at pH 6.0 with different excipients. Viscosity measurements are made with a VROC Initium (RheoSense). CB3f exhibited viscosities of 14.2 cP at 131 mg / mL in 5mM histidine at pH 6 + 280mM mannitol, 9.5 cP in 5mM histidine at pH 6.0 + 150 mM sodium chloride, and 6.1 cP viscosity in 5mM histidine pH 6.0 + 280 mM arginine. These results indicate that CB3f exhibits low viscosity, which could enable high concentration dosing. Pharmacokinetics (PK)PK properties of CB3f is studied in cynomolgus monkeys following a single subcutaneous administration of 0.03, 0.3, 1 and 10 mg / kg of CB3f, or a single intravenous bolus administration of 1 mg / kg of CB3f. CB3f shows linear PK over the subcutaneous dose range examined, with the terminal half-life (T1 / 2) ranging from 182 to 301 hours. The T1 / 2 after a single intravenous bolus administration of 1 mg / kg of CB3f is 324 hours.It has been reported that obexelimab has an average T1 / 2 of 3.5 ± 1.0 days, which equal to 60-108 hours (Jaraczewska-Baumann, et al., European League Against Rheumatism (EULAR) 2015 Annual Meeting Poster: A Phase 1b / 2a Study of the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of XmAb®5871 in Patients with Rheumatoid Arthritis, June 12, 2015, available at https: / / investors.xencor.com / static-files / 0017dcf1-deb2-46eb-93ff-90ba164ec50c). Therefore, CB3f has a better T1 / 2 than obexelimab.Example 3. In vitro functional characterization of the anti-human CD19 antibodies. In vitro inhibition of B cell proliferation by the anti-human CD19 mAb CB3f.The ability of the anti-human CD19 mAb CB3f to inhibit proliferation of primary human B cells is tested in an in vitro B cell proliferation assay.Primary human B cells are isolated from healthy donor PBMCs by negative selection using a B cell isolation kit (Stemcell Technologies). Human primary B cells are re-suspended at 1 x 106 cells / mL and cultured at 37°C in polystyrene 96-well, u-bottom plates in complete medium (RPMI-1640 containing 10% Fetal bovine serum, 1x MEM- nonessential amino acids, 1 mM Sodium Pyruvate, 1x Penicillin-Streptomycin Solution (all from Corning) and 1x Glutamax (Gibco), 0.1% p-mercaptoethanol (Life Technologies). Cells are pre-treated with antihuman CD19 antibody for 1 hour and stimulated with mouse anti-human IgM (2^g / mL-Southern Biotech) plus rabbit anti-mouse IgG (12^g / mL-Thermo Fisher) for 2 days at 370 and 5% CO2. Cells are then pulsed with [3H]-thymidine (1^Ci thymidine / well, PerkinElmer, Boston, MA) for 18 hours of cell culture. The level of incorporation of [3H]-thymidine is measured by 2450 Microplate Counter (MicroBeta2 serial number: 5129186, PerkinElmer, Boston, MA) and expressed as a cell count per minute (c.c.p.m).The anti-human CD19 mAb CB3f inhibits the proliferation of primary human B cells in a dose dependent manner, while the isotype control does not demonstrate inhibition at any tested concentration (FIG. 3). The inhibitory function of CB3f is tested using B cells obtained from 12 different donors, and the average IC50 for CB3f is 0.007 nM (Table 3). The data show that the anti-human CD19 mAb CB3f can inhibit proliferation of primary human B cells in a dose dependent manner, while B cell proliferation is not affected by the isotype control antibody. Table 3. Inhibition of primary B cell proliferation by the anti-human CD19 mAb CB3fIC50 Values (nM) Donor 1 0.006 Donor 2 0.009 Donor 3 0.003 Donor 4 0.006 Donor 5 0.004 Donor 6 0.003 Donor 7 0.003 Donor 8 0.005 Donor 9 0.005 Donor 10 0.028 Donor 11 0.004 Donor 12 0.005 Average 0.007 In vitro inhibition of B cell activation in human whole bloodThe ability of the anti-human CD19 mAb CB3f to inhibit activation of primary human B cells in whole blood is tested in an in vitro whole blood activation assay.EDTA treated human whole blood (Healthy donors, TSRI Normal Blood Donor Services, San Diego, CA) is cultured in polystyrene 96-well, u-bottom plates and pre-incubated with CB3f or the isotype control antibody for 30 minutes to one hour at 37 °C and 5% CO2. 7 nM of each antibody is used as the highest concentration with 4 fold dilution and 12 points titration in complete medium (RPMI-1640 containing 10% fetal bovine serum, 1x MEM- nonessential amino acids, 1mM sodium pyruvate, 1x penicillin-streptomycin Solution (all from Corning) and 1x Glutamax (Gibco), 0.1% p-mercaptoethanol (Life Technologies). Whole blood is stimulated with 2.5 ^g / mL of TLR9 ligand for 24 hours at 37 °C and 5% CO2 (CpG ODN 7909 (InvivoGen, San Diego, CA)). B cell activation profile is measured by flow cytometry and data is analyzed using FlowJo software.Flow cytometry is performed as follows. Treated and activated human whole blood is lysed with RBC lysis buffer (Fisherscientific, USA). Cells are stained with the appropriate combination of fluorochrome-conjugated antibodies for 30 min at 4°C to identify B cell activation markers: CD69 BV605 (cat #310938) from BioLegend. Cells are also stained with CD3 FITC (cat # 300306), CD19 APC (cat # 363006) all from BioLegend, CD20 PerCP-Cy5.5 (cat # 560736) from BD Pharminogen and fixable viability dye eFluor™ 780 (eBioscience). At least 25,000-50,000 events gated on living cells are analyzed for each sample. Samples are acquired on a BD Fortessa X-20 and results are analyzed using FlowJo Software.The anti-human CD19 mAb CB3f inhibits activation of primary human B cells in a dose dependent manner, which is measured by the reduction of CD69+ B cells. The assay is performed using blood obtained from three different donors and representative results are shown in FIG. 4. The average IC50 for CB3f in this assay is 0.008 nM (Table 4). The isotype control antibody did not demonstrate inhibition of CD69 expression at any tested concentration. The data show that anti-human CD19 mAb CB3f can inhibit activation of primary human B cells in whole blood in a dose dependent manner, while B cell activation is not affected by the isotype control antibody.Table 4. Inhibition of B cell activation in whole blood by anti-human CD19 mAb CB3fIC50 Values (nM) Donor 1 0.015 Donor 2 0.0006 Donor 3 0.008 Average 0.008 In vitro inhibition of B cell differentiation into plasmablastsMemory human B cells are isolated from healthy donor PBMCs using a Memory B cell Isolation Kit (Miltenyi Biotec). Human primary memory B cells are re-suspended at 1 x 106 cells / mL and cultured at 37 °C in polystyrene 96-well, u-bottom plates in complete medium (RPMI-1640 containing 10% fetal bovine serum, 1x MEM- nonessential amino acids, 1mM sodium pyruvate, 1x penicillin-streptomycin solution (all from Corning) and 1x Glutamax (Gibco), 0.1% p—mercaptoethanol (Life Technologies). Cells are pre-treated with anti-human CD19 mAb CB3f for 1 hour and stimulated with 50 ng / mL anti-CD40, 200 ng / mL BAFF, 1 ng / mL IL-2, 100 ng / mL IL-21 (all from R&D) for 5 days. Cells are washed and stained with the appropriate combination of fluorochrome-conjugated antibodies for 30 min at 4 °C to identify differentiation of memory B cells into plasmablasts: CD38 PE, CD3 FITC (cat # 300306), CD19 APC (cat # 363006) all from BioLegend, CD20 PerCP-Cy5.5 (cat. # 560736) from BD Pharminogen and fixable viability dye eFluor™ 780, eBioscience. At least 25,000-50,000 events gated on living cells are analyzed for each sample. Samples are acquired on a BD Fortessa X-20 and results are analyzed using FLowJo Software. Percent of plasmablasts is defined as % of CD38bright / CD20low B cells.The anti-human CD19 mAb CB3f inhibits differentiation of primary human memory B cells into plasmablasts in a dose dependent manner (FIG. 5). The experiment is repeated three times and the representative data is shown. The isotype control antibody does not demonstrate inhibition of plasmablast differentiation at any tested concentration. The data show that the CB3f can inhibit differentiation of primary human memory B cells into plasmablasts in a dose dependent manner, while the differentiation is not affected by the isotype control antibody. CD19 mAb CB3f is a non-depleting mAb and lacks activity in in vitro CDC and ADCC assays.The anti-human CD19 mAb CB3f is a B cell inhibitory antibody, which is designed to inhibit B cell function without causing B cell depletion. In vitro assays are performed to confirm CB3f lacks Complement-Dependent Cytotoxicity (CDC) and Antibody-Dependent Cellular Cytotoxicity (ADCC) activities, which imply that it does not have depleting function.Wil2-s cell line expressing CD19 and CD20 are used as target cells, and Jurkat cell lines expressing functional FcYRIIIa (V158)-NFAT-Luc (Eli Lilly and Company) are used as the effector cell line. CB3f is tested and an IgG1 antibody that is a known potent inducer of ADCC and CDC is used as a positive control.CB3f is serially-diluted in triplicates starting at 10 pg / mL and 1 pg / mL test concentrations for the CDC and ADCC assay, respectively. 50 pL / well test compound or assay buffer are added to 96-well plate (Costar 3916). Wil2-s cells are diluted to a concentration of 1x106 cells / mL and added 50 pL / well to plate. CDC and ADCC plates are incubated for 1 hour at 37°C. Next, Jurkat V158 cells are diluted to a concentration of 3x106 cells / mL and added 50 pL / well for ADCC plate, or 50 pL / well of pre-diluted complement from human serum (Quidel A113) for CDC plate. CDC plates are incubated at 37°C for 2 hours followed by addition of 100 pL / well Cell-Titre Glo (Promega G7571). The ADCC plates are incubated at 37°C for 4 hours followed by addition of 100 pL / well ONE-Glo (Promega E8130). The contents of the plates are mixed using a plate shaker at low speed, and luminescence signal is read on an Envision 11 multi-mode plate reader using 0.2 cps integration. Data is analyzed using GraphPad Prism v8.2.The results of the CDC and ADCC assays are shown in FIGs. 6A-6B (representative results from three independent plate runs). All response levels are classified relative to the positive control IgG1 antibody. The anti-human CD19 mAb CB3f has no CDC activity (FIG. 6A) nor ADCC activity (FIG. 6B) at the indicated concentrations.Specificity of anti-human CD19 mAb binding to B cells in human whole blood.The anti-human CD19 mAb CB3f is a B cell inhibitory antibody, which acts by suppressing B cell function. Obexelimab is an antibody that binds both CD19 and FcYRIIb. However, high affinity binding of obexelimab to FcYRIIb could lead to binding to other cell types in a CD19-independent manner. Therefore, the binding specificity of obexelimab and antihuman CD19 mAb CB3f is compared using a human whole blood binding assay.EDTA treated human whole blood (Healthy donors, TSRI Normal Blood Donor Services, San Diego, CA) is plated in polystyrene 96-well and stained with different concentration of Alexa Flour® 647 conjugated CB3f, Alexa Flour® 647 conjugated and Alexa Flour® 647 conjugated isotype control plus appropriate combination of fluorochrome-conjugated extracellular antibodies to detect lymphocyte / granulocyte population. 7 nM of each antibody is used as the highest concentration with 3-fold dilution and 8 points titration in DPBS 1x no Ca2+, no Mg2+ (Dulbecco’s Phosphate-Buffered Saline) supplemented with 2% of Fetal Bovine Serum (FBS-heat inactivated) both from Corning®. The cocktail includes CD20 PerCP-Cy5.5 (cat # 560736), CD45 BV421 (cat # 563879), CD66 FITC (cat # 555724) all from BD Biosciences. CD3 BV605 (cat # 317322), CD11b PE-Cy7 (cat # 101216) all from BioLegend and fixable viability dye eFluor™ 780, (cat # 65-0865-14) from eBioscience. Whole blood plus antibodies are stained for 30 min at 4°C in the dark. Dead cells are excluded by viability dye and at least 25,000-50,000 events gated on living cells are analyzed. Samples are acquired on BD Fortessa X-20 and results are analyzed using FlowJo Software.Flow cytometry analysis demonstrates that CB3f binds exclusively to B cells in human whole blood at all tested concentrations (FIG. 7). Obexelimab shows binding to human B cells as well as a population of CD20-negative cells (i.e., non-B cells), which express CD66 and CD11b and thus are identified as neutrophils (FIG. 7). Therefore, the data indicate the anti-human CD19 mAb CB3f has highly specific binding to human B cells in human whole blood, whereas obexelimab shows non-specific binding to human neutrophils in addition to B cell binding. Since neutrophil is the most abundant type of white blood cells in human, the nonspecific binding to neutrophils might explain the short half-life of obexelimab observed in human patients. The experiment is repeated using blood from four different donors, representative results are shown in FIG. 7.In vitro apoptosis assay.As described above, obexilimab was shown to reduce B cell counts in human patients during clinical studies (Jaraczewska-Baumann, et al., EULAR 2015 Annual Meeting Poster: A Phase 1b / 2a Study of the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of XmAb®5871 in Patients with Rheumatoid Arthritis, June 12, 2015).The ability of the anti-human CD19 mAb CB3f and obexilimab to induce apoptosis of primary human B cells is tested using an in vitro B cell apoptosis assay. Human primary B cells are isolated from healthy donor PBMCs by negative selection using B cell isolation kit (Stemcell Technologies). Human primary B cells are re-suspended at 1 x 106 cells / mL and cultured at 37 °C in polystyrene 96-well, u-bottom plates in complete medium (RPMI-1640 containing 10% Fetal bovine serum, 1x MEM- nonessential amino acids, 1mM sodium pyruvate, 1x penicillinstreptomycin solution (all from Corning) and 1x Glutamax (Gibco), 0.1% p—mercaptoethanol (Life Technologies). Cell are treated with indicated concentrations of CB3f, obexilimab, or an isotype control antibody for 24 hours at 37 °C and 5% CO2. B cell apoptosis is measured by flow cytometry using Annexin V staining in combination with viability dye. Cells are stained with the appropriate combination of fluorochrome-conjugated antibodies for 30 min at 4 °Cto identify B cell activation markers: CD19 APC (Biolegend), CD20 PerCP-Cy5.5 (BD Pharminogen), Annexin V (Invitrogen) and fixable viability dye eFluor™ 780 (eBioscience). Apoptotic cells are defined as live Annexin V+ cells. Samples are acquired on a BD Fortessa X-20 and results are analyzed using FlowJo Software.The experiment is repeated using B cells obtained from three different donors and representative data is shown in FIG. 8. Obexilimab induces B cell apoptosis in a dose-dependent manner (FIG. 8), which may explain the reduction of B cell counts in human patients observed in the clinical studies. In contrast, CB3f induces very little to no apoptosis of human B cells when compared to the isotype control (FIG. 8). The data indicates that, in contrast to obexilimab, the anti-human CD19 mAb CB3f does not induce apoptosis of primary human B cells ex vivo, suggesting a different mechanism of action for CB3f. This data further indicates that the antihuman CD19 mAb CB3f acts by inhibiting B cell function without depleting B cells or significantly reducing B cell numbers.Example 4. In vivo functional characterization of the anti-human CD19 antibodies.Female NSG mice (NOD.Cg-Prkdcscid Il2rgtm1Wjl / SzJ, JAX Labs, Stock # 05557) are housed 3 per cage at 72° C under a 12 hour light:dark cycle and allowed food and water ad libitum (n=33). Human peripheral blood mononuclear cells (PBMCs) are isolated from LRS tubes obtained the San Diego Blood Bank (San Diego CA) using SepMate 50 Ficol preparation tubes according to the manufacturer’s instructions (StemCell Technologies, Vancouver, BC). Freshly isolated PBMCs are suspended in PBS at 1.2 e8 cells / mL and mice are engrafted with 100 ^L PBMCs suspension intravenously on day 0 (1.2e7 / mouse, n=29); 4 mice are not administered PBMCs as non-engrafted controls. On Day 1, mice are divided into 3 weight matched groups and dosed with human IgG4 isotype control or CB3f at 0.01 or 1.0 mg / kg subcutaneously (200 ^L / mouse, n= 10, 10, and 9 respectively). Dosing continues once weekly for the remainder of the experiment. Health checks and body weight measurements are performed routinely. Blood is collected by tail snip into heparin coated capillary tubes on Days 6 and 10. On Day 15, blood is collected by cardiac puncture under isoflurane anesthesia into EDTA tubes for FACS analysis and clarified by centrifugation for plasma analyses. Spleens are harvested and processed to single cell suspensions for FACS analyses.Mice are weighed in a BSL2 hood and assessed for clinical signs of distress 2-3 times / week. Clinical signs common to this model are scruffy hair, hunched body, wasting, and labored breathing or movement. Body weight change is calculated as a percentage of their baseline weight: (Day (x) weight / Day 0 weight)*100.Blood from the cardiac puncture is collected into EDTA coated tubes, clarified by centrifugation, and the resultant plasma is stored at -80°C for future processing. Plasma IgM levels are measured using the Mesoscale Discovery Human Isotyping panel (Rockville Maryland) according to the manufacturer’s instructions.Single cell suspensions of mouse spleens are used for FACS analysis. Cells are plated in 96-well plates and stained with the appropriate combination of fluorochrome-conjugated antibodies for 30 min at 4°C to identify B cell activation markers: hCD45-BV421, CD86 BV650, CD3 APC, CD19 FTIC all from BioLegend, CD20 PerCP-Cy5.5 and fixable viability dye eFluor™ 780. At least 250,000 events gated on living cells are analyzed for each sample. Samples are acquired on a BD Fortessa X-20 and results are analyzed using FlowJo Software. Data is graphed and statistics are calculated using Prism Software (GraphPad, San Diego, CA). Differences in weights between groups are determined by 2-way RM-ANOVA with Tukey’spost hoc test. Differences in plasma IgM levels are determined by 1-way ANOVA with Tukey’s post hoc test and considered significant if p < 0.05.Injection of human PBMCs into NSG mice results in marked engraftment of functional B cells as measured by secretion of human IgM into the periphery. Human IgM in the IgG4 isotype control treated animals increases rapidly from non-detectable to 1.3 ± 0.1 and 48.8 ± 6.2 ^g / mL at Days 6 and 10 post engraftments, respectively. CB3f dosed at 0.01 and 1.0 mg / kg / wk significantly attenuates the secretion of IgM by 60% and 78% on Day 6 as shown in FIGs. 9A-9B (p< 0.01 for both doses). A 57% reduction in circulating IgM is also observed on Day 10 with the 1.0 mg / kg / wk dose of CB3f (p <0.05). Mouse weights are not different between groups, nor does any mouse display signs of GvHD.Activation of human B cells in NSG mice is measured by the expression of activation marker CD86. As demonstrated in FIG. 10, treatment with anti-human CD19 mAb CB3f reduces the expression of CD86 on human B cells in a dose-dependent manner.Treatment with CB3f causes mild reduction in the percentage of splenic B cells, which is probably due to reduced B cell activation and proliferation. Despite this fact, B cells are present in spleens in mostly unaltered numbers (>50% of splenocytes), indicating non-depleting nature of the anti-human CD19 mAb CB3f (FIG. 11).Example 5. Internalization of the anti-human CD19 antibodies in primary human B cellsPeripheral blood mononuclear cells (PBMCs) are collected from LRS-WBC of healthy volunteers using standard density gradient centrifugation method. Human primary B cells are isolated from healthy donor PBMCs by negative selection using B cell isolation kit. For the internalization study, B cells are resuspended at 4x106cells / mL and 50 ^L is added to each well in a 96 well plate. A labeled F(ab’)2 targeting human Ig Fcy fragment (F(ab’)2-TAMRA-QSY7) is used as a probe to track internalization. The test antibody is incubated with probe at 4 °C for 30 minutes to form complex and 50 ^L is added to the B cells in each well. The final concentration of the test antibody is 2 ^g / mL. Cells are incubated for 24 h at 37 °C in a CO2 incubator. Cells are then washed twice with 2% FBS PBS and resuspeneded in 2% FBS PBS with a viability dye (SYTOX Green, Invitrogen). Data is collected on a BD Fortessa X-20 and analyzed in FlowJo.Both anti-human CD19 mAb1 (CB3f) and anti-human CD19 mAb2 (C323.C1) demonstrate internalization in primary human B cells at 24 hours (FIG. 12). An IgG1 effector null isotype control antibody is used as a negative control and does not show any significant internalization as demonstrated by low percentage of TAMRA+ cells (FIG. 12). A positive control IgG4 mAb demonstrates internalization comparable to the tested anti-human CD19 mAbs (FIG. 12).Example 6. Comparison of the efficacy of a non-depleting anti-mouse CD19 surrogate antibody with a B cell depleting anti-mouse CD20 surrogate antibody in animal modelsIn vivo efficacy of a non-depleting CD19 surrogate antibody and a B cell depleting CD20 surrogate antibody in a mouse CIA modelIn this study, a non-depleting anti-mouse CD19 surrogate antibody (CD19 surrogate Ab) and a B cell depleting anti-mouse CD20 surrogate antibody (CD20 surrogate Ab) were tested along with an isotype control antibody in a mouse collagen-induced arthritis (CIA) model in a semi-established disease mode (i.e., the antibody was introduced after the induction of the disease but before animals developed any detectable clinical score).Isotype control treated mice immunized with collagen and complete Freund’s adjuvant (CFA) developed observable signs of joint inflammation starting on Day 25, while isotype treated non-diseased mice had no observable joint inflammation throughout the study (FIG. 13A). Treatment starting on Day 19 with the CD20 surrogate Ab (10 mg / kg SC, once weekly) ameliorated average clinical score, whereas the CD19 surrogate Ab (5 mg / kg SC, twice weekly) reduced average clinical scores even more (FIG. 13A). The CD20 surrogate Ab did not significantly reduce clinical score AUC compared to isotype control (FIG. 13B). On the other hand, the CD19 surrogate Ab significantly reduced clinical score AUC compared to both isotype control and the CD20 surrogate Ab (FIG. 13B). These results suggest that the CD19 surrogate Ab can reduce disease severity greater than the CD20 surrogate Ab as assessed by clinical score AUC in the CIA model of mouse arthritis conducted in semi-established mode.In vivo efficacy of the non-depleting CD19 surrogate Ab and the B cell depleting CD20 surrogate Ab in a mouse NOD model of type 1 diabetes.The NOD / ShiLtJ mouse strain (commonly called Non-Obese Diabetic) is a polygenic model for autoimmune type 1 diabetes (T1D). Diabetes in NOD mice is characterized byhyperglycemia and insulitis, a leukocytic infiltration of the pancreatic islets. Prevalence of disease is highest in female mice.In this study, the non-depleting CD19 surrogate Ab was tested along with a depleting CD20 surrogate Ab in the mouse NOD model of Type 1 diabetes in a semi-therapeutic disease mode (i.e., the antibody was introduced just before the control animals started to develop clinical score).Female NOD-LTJ mice were left untreated, dosed with 5 mg / kg / BIW of the CD19 surrogate Ab, or the CD20 surrogate Ab starting at 12 weeks of age. All mice were tested weekly for blood glucose using an Accu Check Aviva blood glucose meter (Roche cat# 06870287001) and test strips (Roche cat# 06908373001 lot# 497064). Mice with blood glucose levels above 240 mg / dl were considered as diabetic. Untreated mice developed diabetes starting of 14 weeks of age. Treatment with the CD20 surrogate Ab (5 mg / kg SC, twice weekly) demonstrated very mild protection from the disease progression, whereas the CD19 surrogate Ab (5 mg / kg SC, twice weekly) delayed and reduced the incidence of diabetes (FIG. 14). These results suggest that the non-depleting CD19 surrogate Ab can delay and reduce the incidence of type 1 diabetes in NOD mice greater than the depleting anti-CD20 surrogate Ab.In vivo efficacy of the non-depleting CD19 surrogate Ab and the B cell depleting CD20 surrogate Ab in a mouse EAE modelMouse experimental autoimmune encephalomyelitis (EAE) has been widely used as model of inflammatory neurodegenerative and demyelinating diseases, such as multiple sclerosis (MS).In this study, the non-depleting anti-CD19 surrogate Ab was tested along with the depleting CD20 surrogate Ab in proteolipid protein (PLP) induced remitting-relapsing (RR) demyelinating EAE model in a semi-therapeutic disease mode (i.e., the antibody was introduced after the induction of the disease, but before animals started developing any detectable clinical score).Female 9-10 weeks old SJL mice (Jackson Labs), with a mean body weight of 18-21g were used for the study. Mice were immunized with Hooke Kit™ PLP139-151 / CFA Emulsion (catalog number EK-0120, Hooke Laboratories, Lawrence MA), and 75 ng pertussis toxin (PTX). Animals were randomized based on body weight into study groups with 15 mice in eachgroup. The non-depleting CD19 surrogate Ab, the depleting CD20 surrogate Ab or isotype mouse IgG1 control of 5 mg / kg was given subcutaneously twice a week starting on day 8. EAE score was collected daily with scale 0-6 in 0.5 unit increments. Mice were sacrificed on day 42.Treatment with the non-depleting CD19 surrogate Ab significantly reduces EAE score on day 35-41 compared to isotype control; with a 51% decrease in EAE score on the final day (FIG. 15). Treatment with the depleting CD20 surrogate Ab did not demonstrate significant reduction of disease score over isotype control at any tested time points (FIG. 15). These results suggest that the non-depleting CD19 surrogate Ab can reduce disease severity greater than the depleting CD20 surrogate Ab as assessed by clinical score in the EAE model of multiple sclerosis in semi-therapeutic mode of treatment.SEQUENCE LISTINGC323 SEQ ID NO: 1 C323 HCDR1 (North)KASGGTFSSYAISSEQ ID NO: 2 C323 HCDR2 (North)GIIPIFGTANSEQ ID NO: 3 C323 HCDR3 (North)AREDFGYNYGMDVSEQ ID NO: 4 C323 LCDR1 (North)RASQGVNSYYLASEQ ID NO: 5 C323 LCDR2 (North)YATSTRATSEQ ID NO: 6 C323 LCDR3 (North)QHYGNSLFTSEQ ID NO: 7 C323 HC IgG4-S228PQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTAN YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGYNYGMDVWGQGTTV TVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPS QEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGSEQ ID NO: 8 C323 HC IgG4-S228P DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTAC AGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCA CGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTAT TACTGTGCGAGAGAGGACTTCGGCTACAATTACGGCATGGACGTCTGGGGCCAAGG GACCACGGTCACCGTCTCCTCAGCTTCTACCAAGGGCCCATCGGTCTTCCCGCTAGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGG ACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGC GTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTG GTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCAACGTAGATCA CAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGTCCAAATATGGTCCCCCAT GCCCACCCTGCCCAGCACCTGAGTTTCTGGGGGGACCATCAGTCTTCCTGTTCCCCC CAAAACCCAAGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTG GTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGT GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTA CAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCA AAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAG GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAG CGACATCGCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGTG GACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTSEQ ID NO: 9 C323 HC Variable Region (VH)QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTAN YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGYNYGMDVWGQGTTV TVSSSEQ ID NO: 10 C323 HC VH DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTAC AGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCA CGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTAT TACTGTGCGAGAGAGGACTTCGGCTACAATTACGGCATGGACGTCTGGGGCCAAGG GACCACGGTCACCGTCTCCTCASEQ ID NO: 11 C323 LCEIVLTQSPGTLSLSPGERATLSCRASQGVNSYYLAWYQQKPGQAPRLLMYATSTRATGI PDRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGNSLFTFGPGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECSEQ ID NO: 12 C323 LC DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGGGTGTTAACAGCTACTACTTAGCCTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATGTATGCTACATCCACCAGGGCCACT GGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATC AGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTAACTCA CTATTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGGACCGTGGCTGCACC ATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTT GTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGG ACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAA GAGCTTCAACAGGGGAGAGTGCSEQ ID NO: 13 C323 LC Variable Region (VL)EIVLTQSPGTLSLSPGERATLSCRASQGVNSYYLAWYQQKPGQAPRLLMYATSTRATGI PDRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGNSLFTFGPGTKVEIKSEQ ID NO: 14 C323 LC VL DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGGGTGTTAACAGCTACTACTTAGCCTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATGTATGCTACATCCACCAGGGCCACT GGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATC AGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTAACTCA CTATTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAAC323.C1 SEQ ID NO: 15 C323.C1 HCDR1 (North)KASGGTISSYAYSSEQ ID NO: 16 C323.C1 HCDR2 (North)GIIPIFDTANSEQ ID NO: 17 C323.C1 HCDR3 (North)AREDFGYNYAMDVSEQ ID NO: 18 C323.C1 LCDR1 (North)RASQKVNSYYLHSEQ ID NO: 19 C323.C1 LCDR2 (North)YATRTRPTSEQ ID NO: 20 C323.C1 LCDR3 (North)QHYGQSLFTSEQ ID NO: 21 C323.C1 HC IgG4-S228PQVQLVQSGAEVKKPGSSVKVSCKASGGTISSYAYSWVRQAPGQGLEWMGGIIPIFDTAN YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGYNYAMDVWGQGTLV TVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPS QEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGSEQ ID NO:22 C323.C1 HC IgG4-S228P DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGAGGCACCATTAGCAGCTATGCTTACAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGACA CAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCC ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA TTACTGTGCGAGAGAGGACTTCGGCTACAATTACGCGATGGACGTCTGGGGCCAAG GGACCCTTGTCACCGTCTCCTCAGCTTCTACCAAGGGCCCATCGGTCTTCCCGCTAG CGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAG GACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGG CGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT GGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCAACGTAGATC ACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTTCTGGGGGGACCATCAGTCTTCCTGTTCCCC CCAAAACCCAAGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTG GTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGT GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTA CAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCA AAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAG GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAG CGACATCGCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGTG GACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTSEQ ID NO: 23 C323.C1 VHQVQLVQSGAEVKKPGSSVKVSCKASGGTISSYAYSWVRQAPGQGLEWMGGIIPIFDTAN YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGYNYAMDVWGQGTLV TVSSSEQ ID NO: 24 C323.C1 VH DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGAGGCACCATTAGCAGCTATGCTTACAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGACA CAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCC ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA TTACTGTGCGAGAGAGGACTTCGGCTACAATTACGCGATGGACGTCTGGGGCCAAG GGACCCTTGTCACCGTCTCCTCASEQ ID NO: 25 C323.C1 LCEIVLTQSPGTLSLSPGERATLSCRASQKVNSYYLHWYQQKPGQAPRLLIYATRTRPTGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSLFTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECSEQ ID NO: 26 C323.C1 LC DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAAAGTTAACAGCTACTACTTACATTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGCTACAAGAACCAGGCCAAC TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCAT CAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTC ACTATTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACGGACCGTGGCTGCAC CATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGT TGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGG ATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAA AGAGCTTCAACAGGGGAGAGTGCSEQ ID NO: 27 C323.C1 VLEIVLTQSPGTLSLSPGERATLSCRASQKVNSYYLHWYQQKPGQAPRLLIYATRTRPTGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSLFTFGQGTKVEIKSEQ ID NO: 28 C323.C1 VL DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGAAAGTTAACAGCTACTACTTACATTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGCTACAAGAACCAGGCCAAC TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCAT CAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTC ACTATTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACB3f SEQ ID NO: 29 CB3f / CB3 HCDR1 (North)KASGHTISSYAYSSEQ ID NO: 30 CB3f / CB3 HCDR2 (North)DIIPAYGSPNSEQ ID NO: 31 CB3f / CB3 HCDR3 (North)AREDFGKNYAMDVSEQ ID NO: 32 CB3f LCDR1 (North)RASQHVSSHYLASEQ ID NO: 33 CB3f LCDR2 (North)YGASSRATSEQ ID NO: 34 CB3f LCDR3 (North)QHYGQSQFTSEQ ID NO: 35 CB3f / CB3 HC IgG4-S228PQVQLVQSGAEVKKPGSSVKVSCKASGHTISSYAYSWVRQAPGQGLEWMGDIIPAYGSP NYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGKNYAMDVWGQGTL VTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPP SQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTV DKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGSEQ ID NO: 36 CB3f / CB3 HC IgG4-S228P DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGACATACCATTAGCAGCTATGCTTACAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGACATCATCCCTGCCTATGGCT CACCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCC ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA TTACTGTGCGAGAGAGGACTTCGGCAAGAATTACGCGATGGACGTCTGGGGCCAAG GGACCCTTGTCACCGTCTCCTCAGCTTCTACCAAGGGCCCATCGGTCTTCCCGCTAG CGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAG GACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGG CGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT GGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCAACGTAGATC ACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGTCCAAATATGGTCCCCCA TGCCCACCCTGCCCAGCACCTGAGTTTCTGGGGGGACCATCAGTCTTCCTGTTCCCC CCAAAACCCAAGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTG GTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGT GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCA AAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAG GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAG CGACATCGCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGTG GACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTSEQ ID NO: 37 CB3f / CB3 VHQVQLVQSGAEVKKPGSSVKVSCKASGHTISSYAYSWVRQAPGQGLEWMGDIIPAYGSP NYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGKNYAMDVWGQGTL VTVSSSEQ ID NO: 38 CB3f / CB3 VH DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGACATACCATTAGCAGCTATGCTTACAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGACATCATCCCTGCCTATGGCT CACCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCC ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA TTACTGTGCGAGAGAGGACTTCGGCAAGAATTACGCGATGGACGTCTGGGGCCAAG GGACCCTTGTCACCGTCTCCTCASEQ ID NO: 39 CB3f LCEIVLTQSPGTLSLSPGERATLSCRASQHVSSHYLAWYQQKPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSQFTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECSEQ ID NO: 40 CB3f LC DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGCATGTTAGCAGCCACTACTTAGCTTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACT GGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATC AGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTCA CAGTTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACGGACCGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTT GTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGG ACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAA CACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAA GAGCTTCAACAGGGGAGAGTGCSEQ ID NO: 41 CB3f VLEIVLTQSPGTLSLSPGERATLSCRASQHVSSHYLAWYQQKPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSQFTFGQGTKVEIKSEQ ID NO: 42 CB3f VL DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGCATGTTAGCAGCCACTACTTAGCTTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACT GGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATC AGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTCA CAGTTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACB3 (LC only; HC identical to CB3f) SEQ ID NO: 43 CB3 LCDR1 (North)RASQHVNSHYLASEQ ID NO: 44 CB3 LCDR2 (North)YATRTRPTSEQ ID NO: 45 CB3 LCDR3 (North)QHYGQSQFTSEQ ID NO: 46 CB3 LCEIVLTQSPGTLSLSPGERATLSCRASQHVNSHYLAWYQQKPGQAPRLLIYATRTRPTGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSQFTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECSEQ ID NO: 47 CB3 LC DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGCATGTTAACAGCCACTACTTAGCTTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGCTACAAGAACCAGGCCAAC TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCAT CAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTC ACAGTTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACGGACCGTGGCTGCAC CATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGT TGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGG ATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAA AGAGCTTCAACAGGGGAGAGTGCSEQ ID NO: 48 CB3 VLEIVLTQSPGTLSLSPGERATLSCRASQHVNSHYLAWYQQKPGQAPRLLIYATRTRPTGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGQSQFTFGQGTKVEIKSEQ ID NO: 49 CB3 VL DNAGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCC ACCCTCTCCTGCAGGGCCAGTCAGCATGTTAACAGCCACTACTTAGCTTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGCTACAAGAACCAGGCCAAC TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCAT CAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCACTATGGTCAGTC ACAGTTCACTTTCGGCCAGGGGACCAAGGTGGAGATCAAACB3f / CB3-IgG1SEQ ID NO: 50 CB3f / CB3 IgG1 HCQVQLVQSGAEVKKPGSSVKVSCKASGHTISSYAYSWVRQAPGQGLEWMGDIIPAYGSP NYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGKNYAMDVWGQGTL VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGSEQ ID NO: 51 CB3f / CB3 IgG1 HC DNACAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAA GGTCTCCTGCAAGGCTTCTGGACATACCATTAGCAGCTATGCTTACAGCTGGGTGCG ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGACATCATCCCTGCCTATGGCT CACCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCC ACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTA TTACTGTGCGAGAGAGGACTTCGGCAAGAATTACGCGATGGACGTCTGGGGCCAAG GGACCCTTGTCACCGTCTCCTCAGCTTCTACCAAGGGCCCATCGGTCTTCCCGCTAG CACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAG GACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGG CGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT GGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCA CAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAA CTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCC TCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACAT GCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTG GACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACA GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACC ATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATC CCGGGACGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCT ATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTAC AAGACCACGCCCCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTC ACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCA TGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCCGGGTCB3f / CB3-IgG1 effector nullSEQ ID NO: 52 CB3f / CB3 IgG1-effector null HC (LC identical to CB3f / CB3) (changes from IgG1 WT underlined)QVQLVQSGAEVKKPGSSVKVSCKASGHTISSYAYSWVRQAPGQGLEWMGDIIPAYGSP NYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGKNYAMDVWGQGTL VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSEQ ID NO: 53 CB3f / CB3 IgG1-effector null HC DNA (LC identical to CB3f / CB3)CAGGTGCAACTTGTCCAAAGCGGAGCTGAGGTTAAGAAACCAGGTTCATCTGTGAA GGTGTCATGTAAGGCAAGCGGCCACACCATTTCATCTTACGCATACTCCTGGGTTCG ACAAGCTCCAGGCCAGGGATTGGAATGGATGGGAGACATAATCCCAGCATACGGAT CACCTAACTACGCACAGAAGTTTCAGGGGAGAGTGACAATTACAGCCGACGAGTCT ACTAGCACTGCTTACATGGAGTTGTCTTCACTTCGGTCAGAGGATACAGCAGTTTAC TATTGTGCCAGGGAGGATTTCGGGAAAAATTATGCTATGGATGTATGGGGTCAGGG CACCCTGGTTACTGTATCATCTGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGC ACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGG ACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGC GTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTG GTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCAC AAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAAC TCACACATGCCCACCGTGCCCAGCACCTGAAGCCGCCGGGGGACCGTCAGTCTTCCT CTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATG CGTGGTGGTGTCCGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTATGTGG ACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAG CACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAAGACTGGCTGAATGGCAA GGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCC CGGGAGGAGATGACCAAGAACCAAGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTA TCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACA AGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATTCCAAGCTCAC CGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATG AGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGCAAAC323.C1-IgG1 effector nullSEQ ID NO: 54 C323.C1 IgG1-effector null HC (LC identical to CB3.C1) (changes from IgG1 WT underlined)QVQLVQSGAEVKKPGSSVKVSCKASGGTISSYAYSWVRQAPGQGLEWMGGIIPIFDTAN YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREDFGYNYAMDVWGQGTLV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE AAGGPSVFLFPPKPKDTLMISRTPEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSEQ ID NO: 55 C323.C1 IgG1-effector null HC DNACAGGTTCAGCTCGTGCAAAGTGGAGCTGAGGTGAAAAAACCTGGTTCTAGCGTCAA GGTCTCTTGTAAGGCCTCTGGGGGCACTATAAGCTCTTATGCTTATAGTTGGGTGCG CCAGGCCCCAGGACAGGGCTTGGAATGGATGGGCGGCATAATACCCATATTCGACA CAGCCAACTACGCTCAAAAATTTCAGGGGAGAGTGACTATAACTGCAGACGAGAGC ACTAGCACCGCTTACATGGAGTTGAGTAGTCTCCGCAGTGAAGACACAGCCGTCTAT TATTGCGCTAGGGAGGACTTTGGTTACAACTACGCCATGGATGTCTGGGGCCAGGGT ACTTTGGTCACCGTATCTAGTGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCA CCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGA CTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGT GCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGT GACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACA AGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACT CACACATGCCCACCGTGCCCAGCACCTGAAGCCGCCGGGGGACCGTCAGTCTTCCTC TTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGC GTGGTGGTGTCCGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTATGTGGA CGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGC ACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAAGACTGGCTGAATGGCAAG GAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCAT CTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCC GGGAGGAGATGACCAAGAACCAAGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACA AGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATTCCAAGCTCAC CGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATG AGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGCAAASEQ ID NO: 56 Human CD19 isoform 1 (NCBI Reference Sequence: NP_001171569.1)MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSG ELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRD SLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPAR DMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVS AVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLS LPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEP DSEEDSEFYENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPV ARTMDFLSPHGSAWDPSREATSLAGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADS YENMDNPDGPDPAWGGGGRMGTWSTRSEQ ID NO: 57 Human CD19 isoform 2 (NCBI Reference Sequence: NP_001761.3)MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSG ELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRD SLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPAR DMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVS AVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLS LPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEP DSEEDSEFYENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPV ARTMDFLSPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSY ENMDNPDGPDPAWGGGGRMGTWSTR

Claims

WE CLAIM:

1. An antibody that binds human CD19, wherein the antibody comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises heavy chain complementarity determining regions HCDR1, HCDR2, and HCDR3, and the VL comprises light chain complementarity determining regions LCDR1, LCDR2, and LCDR3, whereinthe HCDR1 comprises SEQ ID NO: 29,the HCDR2 comprises SEQ ID NO: 30,the HCDR3 comprises SEQ ID NO: 31,the LCDR1 comprises SEQ ID NO: 32,the LCDR2 comprises SEQ ID NO: 33, andthe LCDR3 comprises SEQ ID NO: 34.

2. The antibody of claim 1, wherein the VH comprises SEQ ID NO: 37 and the VL comprises SEQ ID NO: 41.

3. The antibody of claim 1 or 2, wherein the antibody comprises a heavy chain (HC) comprising SEQ ID NO: 35 and a light chain (LC) comprising SEQ ID NO: 39.

4. The antibody of claim 1 or 2, wherein the antibody comprises a HC comprising SEQ ID NO: 52 and a LC comprising SEQ ID NO: 39.

5. An antibody that binds human CD19, wherein the antibody comprises a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, whereinthe HCDR1 comprises SEQ ID NO: 29,the HCDR2 comprises SEQ ID NO: 30,the HCDR3 comprises SEQ ID NO: 31,the LCDR1 comprises SEQ ID NO: 43,the LCDR2 comprises SEQ ID NO: 44, andthe LCDR3 comprises SEQ ID NO: 45.

6. The antibody of claim 5, wherein the VH comprises SEQ ID NO: 37 and the VL comprises SEQ ID NO: 48.

7. The antibody of claim 5 or 6, wherein the antibody comprises a HC comprising SEQ ID NO: 35 and a LC comprising SEQ ID NO: 46.

8. The antibody of claim 5 or 6, wherein the antibody comprises a HC comprising SEQ ID NO: 52 and a LC comprising SEQ ID NO: 46.

9. An antibody that binds human CD19, wherein the antibody comprises a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, whereinthe HCDR1 comprises SEQ ID NO: 15,the HCDR2 comprises SEQ ID NO: 16,the HCDR3 comprises SEQ ID NO: 17,the LCDR1 comprises SEQ ID NO: 18,the LCDR2 comprises SEQ ID NO: 19, andthe LCDR3 comprises SEQ ID NO: 20.

10. The antibody of claim 9, wherein the VH comprises SEQ ID NO: 23 and the VL comprises SEQ ID NO: 27.

11. The antibody of claim 9 or 10, wherein the antibody comprises a HC comprising SEQ ID NO: 21 and a LC comprising SEQ ID NO: 25.

12. The antibody of claim 9 or 10, wherein the antibody comprises a HC comprising SEQ ID NO: 54 and a LC comprising SEQ ID NO: 25.

13. The antibody of any one of claims 1-12, wherein the antibody is a non-depleting antibody.

14. A nucleic acid comprising a sequence encoding SEQ ID NO: 35, 52, 39, 46, 21, 54, or 25.

15. A vector comprising the nucleic acid of claim 14.

16. The vector of claim 15, wherein the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 35 or 52, and a second nucleic acid sequence encoding SEQ ID NO: 39 or 46.

17. The vector of claim 15, wherein the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second nucleic acid sequence encoding SEQ ID NO: 25.

18. A composition comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35 or 52, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39 or 46.

19. A composition comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25.

20. An isolated cell comprising the vector of claim 16 or 17.

21. An isolated cell comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 35 or 52, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 39 or 46.

22. An isolated cell comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 21 or 54, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 25.

23. The cell of any one of claims 20-22, wherein the cell is a mammalian cell.

24. A process of producing an antibody comprising culturing the cell of any one of claims 20-23 under conditions such that the antibody is expressed and recovering the expressed antibody from the culture medium.

25. An antibody produced by the process of claim 24.

26. A pharmaceutical composition comprising the antibody of any one of claims 1-13 or 25, and a pharmaceutically acceptable excipient, diluent or carrier.

27. The antibody of any one of claims 1-13 or 25 for use in therapy.

28. The antibody of any one of claims 1-13 or 25, or the pharmaceutical composition of claim 26, for use in the treatment of a B cell associated disorder.

29. The antibody or pharmaceutical composition of claim 28, wherein the B cell associated disorder is an autoimmune disease.

30. The antibody or pharmaceutical composition of claim 28, wherein the B cell associated disorder is selected from systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, Type 1 diabetes, pemphigus vulgaris, neuromyelitis optica, ANCA vasculitis, or myasthenia gravis.

31. Use of the antibody of any one of claims 1-13 or 25, in the manufacture of a medicament for the treatment of a B cell associated disorder.

32. The use of claim 31, wherein the B cell associated disorder is an autoimmune disease.

33. The use of claim 31, wherein the B cell associated disorder is selected from systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, idiopathic thrombocytopenia purpura, Type 1 diabetes, pemphigus vulgaris, neuromyelitis optica, ANCA vasculitis, or myasthenia gravis.