An anti_ITGA2 antibody drug conjugate

AE202602421AUndeterminedSHANGHAI ESCUGEN BIOTECHNOLOGY CO LTD +1
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
AE202602421
Authority / Receiving Office
AE · AE
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-01-19
Filing Date
2025-01-17

Smart Images

  • Figure ABST_ABST
    Figure ABST_ABST
Patent Text Reader

Abstract

The present application discloses an antibody drug conjugate, which comprises the structure of the following formula 1 wherein, Ab is an antibody or antibody fragment which targets ITGA2, and j is 1 to 8, preferably 4 to 8. The antibody-drug conjugate of the application has a high specificity binding ability to tumor cells expressing ITGA2 protein, thereby achieving an excellent killing effect on tumor cells.
Need to check novelty before this filing date? Find Prior Art

Description

ANANTIBODYDRUGCONJUGATE [1]. CROSS-REFERENCE TO RELATED APPLICATION[2]. This application claims the priority of PCT / CN2024 / 073169 filed on January 19, 2024 entitled by “AN ANTIBODY DRUG CONJUGATE”, the entirety of which is incorporated by reference herein.  [3]. FIELD OF THE INVENTION[4]. The present application relates to the field of biopharmaceutical technology, and in particular to an antibody drug conjugate.  [5]. BACKGROUND[6]. Malignant tumors, also known as cancer, have become the "number one killer" threatening the lives and health of people worldwide. The fundamental causes of high cancer mortality rates are the spread and metastasis of cancer cells, as well as the tendency for most patients to relapse and develop drug resistance after treatment. Existing clinical treatments, such as surgery, radiotherapy, and chemotherapy, have limited or only short-term effects on cancer cell metastasis, recurrence, and drug resistance, and cannot improve the long-term survival of patients. At present, surgical resection is effective for about 10-20% of early-stage patients, but is almost ineffective for patients who have spread and metastasized. Radiotherapy can only treat local lesions and is often used as preoperative and postoperative adjuvant treatment and as a radical treatment for a few types of cancer. Chemotherapy can be used for patients who have spread and metastasized, but due to its severe side effects and the tendency to develop short-term or long-term drug resistance, it can only have a significant short-term effect on about 20-30% of patients. Even when comprehensive treatment measures combining surgery, radiotherapy, and chemotherapy are employed, the long-term efficacy in terms of 5-year survival has remained stagnant at around 20-30% for many years. Approximately 70-80% of patients experience metastasis, recurrence, and drug resistance within 5 years after treatment and die within that period. Even among patients with early-stage cancer who show no signs of metastasis at the time of diagnosis, some still develop metastasis and relapse after treatment and eventually die.  [7]. SUMMARY OF THE INVENTION[8]. Currently, the identification of tumor-associated antigens and the subsequent delivery of drugs to tumor cells in the form of antibody drug conjugates is an effective method for treating tumors. This drug form combines the targeting ability of monoclonal antibodies to tumor cells with the potent tumor-killing advantages of small molecule cytotoxins. It can significantly reduce the toxic side effects of small molecule toxins and enhance drug efficacy, thereby offering significant therapeutic advantages.[9]. The applicant found that ITGA2 is a tumor cell-specific, overexpressed tumor-associated antigen, which is up-regulated in most solid tumors, especially in colorectal cancer, cholangiocarcinoma, pancreatic cancer, skin cancer, and other cancers. However, current antibodies that can target ITGA2 alone have poor inhibitory effects on the growth of tumor cells. Therefore, the applicant developed an antibody with a high specific binding ability to tumor cells expressing the ITGA2 protein, which can target ITGA2-positive tumor cells in the form of an antibody drug conjugate to achieve an excellent killing effect on the cells.

[10] . The embodiments of the invention are as follows:

[11] . 1. An antibody drug conjugate, which comprises the structure of the following formula 1: Formula 1

[12] . wherein Ab is an antibody or antibody fragment which targets ITGA2;

[13] . j is 1 to 8, preferably 4 to 8.

[14] . 2. The antibody drug conjugate according to item 1, wherein the antibody or antibody fragment which targets ITGA2 comprises three heavy chain complementarity determining regions (CDR-H1, CDR-H2 and CDR-H3) and three light chain complementarity determining regions (CDR-L1, CDR-L2 and CDR-L3), wherein:

[15] . the amino acid sequence of CDR-H1 is shown in SEQ ID NO: 1;

[16] . the amino acid sequence of CDR-H2 is shown in SEQ ID NO: 2;

[17] . the amino acid sequence of CDR-H3 is shown in SEQ ID NO: 3;

[18] . the amino acid sequence of CDR-L1 is shown in SEQ ID NO: 4;

[19] . the amino acid sequence of CDR-L2 is shown in SEQ ID NO: 5;

[20] . the amino acid sequence of CDR-L3 is shown in SEQ ID NO: 6.

[21] . 3. The antibody drug conjugate according to item 1, wherein the antibody or antibody fragment which targets ITGA2 comprises a heavy chain variable region and a light chain variable region, wherein, the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO: 7 or has at least 90 %, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 7;

[22] . the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 8 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 8.

[23] . 4. The antibody drug conjugate according to any one of items 1 to 3, wherein the Ab is an antibody which targets ITGA2, and the heavy chain of the antibody is an IgG1 subtype or an IgG1 subtype with mutations, and the light chain of the antibody is of the Kappa type.

[24] . 5. The antibody drug conjugate according to item 4, wherein the antibody which targets ITGA2 comprises a heavy chain and a light chain, wherein,

[25] . the amino acid sequence of the heavy chain is shown in SEQ ID NO: 9 or SEQ ID NO: 11 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 11;

[26] . the amino acid sequence of the light chain is shown in SEQ ID NO: 10 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity with the amino acid sequence of SEQ ID NO: 10.

[27] . 6. A method for preparing an antibody drug conjugate, which comprises the following steps:

[28] . providing LD-38;

[29] . constructing an antibody or an antibody fragment Ab which targets ITGA2;

[30] . conjugating LD-38 with the antibody or antibody fragment Ab which targets ITGA2 to obtain an antibody drug conjugate;

[31] . the structure of LD-38 is;

[32] . wherein, the antibody or antibody fragment Ab which targets ITGA2 is the one as defined in items 2-6 .

[33] . 7. A pharmaceutical composition, which comprises the antibody drug conjugate of any one of items 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereoisomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs, or solvates (e.g., hydrate) thereof.

[34] . 8. Use of the antibody drug conjugate according to any one of items 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in the preparation of a medicament for the treatment and / or prevention of tumors.

[35] . 9. The use according to item 8, wherein the tumors are selected from the group consisting of solid tumors, hematological tumors and metastatic, refractory or recurrent lesions of cancer.

[36] . 10. The use according to item 8, wherein the tumors are selected from the group consisting of esophageal cancer, gastrointestinal cancer, pancreatic cancer, thyroid cancer, colorectal cancer, renal cancer, lung cancer (eg non-small cell lung cancer), liver cancer, stomach cancer, gastric adenocarcinoma, gastroesophageal junction (GEJ) adenocarcinoma, head and neck cancer, bladder cancer, breast cancer, uterine cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, germ cell cancer, bone cancer, skin cancer, thymic cancer, cholangiocarcinoma, gallbladder cancer, melanoma, mesothelioma, lymphoma, myeloma (such as multiple myeloma), sarcoma, glioblastoma, and leukemia.

[37] . 11. Use of the antibody drug conjugate according to any one of items 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in combination with other therapeutic drugs in the preparation of a medicament for the treatment and / or prevention of tumors.

[38] . 12. The use according to item 11, wherein the other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.

[39] . 13. The antibody drug conjugate according to any one of items 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof, for use in the treatment and / or prevention of tumors.

[40] . 14. The antibody drug conjugate according to any one of items 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in combination with other therapeutic drugs for use in the treatment and / or prevention of tumors.

[41] . 15. The use according to item 14, wherein the other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.

[42] . The antibody drug conjugate of the application has high a specificity binding ability to tumor cells expressing the ITGA2 protein, thereby achieving an excellent killing effect on cells.  

[43] . BRIEF DESCRIPTIONOF FIGURES

[44] . Figure 1 is the SEC analysis of A36-LD-38, A36mut-LD-38 and IgG-LD-38 ADC prepared in Example 2.

[45] . Figure 2 is the SEC analysis of A36-Dxd, A36mut-Dxd and IgG-Dxd ADC prepared in Example 3.

[46] . Figure 3 shows the binding experimental results of the A36 antibody and the ADC to ITGA2 at the cellular level in Example 4.

[47] . Figure 4 shows the endocytosis experiment results of the A36 antibody in Example 5.

[48] . Figure 5 shows the efficacy results of the A36-LD-38 ADC on human cholangiocarcinoma line HuCCT1 CDX model in Example 8.

[49] . Figure 6 shows the efficacy results of the A36-LD-38 ADC on the human pancreatic cancer cell line BxPC-3 CDX model in Example 9.

[50] . Figure 7 shows the efficacy results of the A36-LD-38 ADC on the human gastric cancer cell line NCI-N87 CDX model in Example 10.

[51] . Figure 8 shows the efficacy results of the A36-LD-38 ADC on the human colon cancer cell line COLO205 CDX model in Example 11.

[52] . Figure 9 shows the efficacy results of the A36mut-LD-38 ADC on the human colon cancer cell line COLO205 CDX model in Example 11.

[53] . Figure 10 shows the in vivo anti-tumor efficacy results of the A36mut-LD-38 ADC on the intestinal cancer PDX model in Example 12.  

[54] . DETAILED DESCRIPTION OF THE INVENTION

[55] . Exemplary embodiments of the present application are described below. These include various details of the embodiments of the present application to facilitate understanding. They should be considered as exemplary only. Accordingly, those of ordinary skill in the art will recognize that various changes and modifications can be made to the embodiments described herein without departing from the scope and spirit of the application. Additionally, descriptions of well-known functions and constructions are omitted from the following description for clarity and conciseness.

[56] . It should be noted that certain words are used in the description and claims to refer to specific components. Those skilled in the art will understand that different names may be used to refer to the same component. This description and the claims do not use differences in nouns as a way to distinguish components, but rather use differences in the functions of the components as a criterion for distinction. If the words "comprise" or "include" are mentioned throughout the description and claims, they are open-ended terms and should be interpreted as "including but not limited to." The following descriptions are of preferred embodiments for implementing the present application. However, these descriptions are for the purpose of illustrating the general principles of the application and are not intended to limit the scope of the present application. The scope of protection of this application shall be determined by the appended claims.

[57] . The present application provides an antibody drug conjugate, which comprises the structure of the following formula 1: Formula 1

[58] . wherein Ab is an antibody or antibody fragment which targets ITGA2;

[59] . j is 1 to 8, preferably 4 to 8, for example, it can be 1, 2, 3, 4, 5, 6, 7, 8, etc.

[60] . In the present application, the antibody or antibody fragment which targets ITGA2 comprises three heavy chain complementarity determining regions (CDR-H1, CDR-H2 and CDR-H3) and three light chain complementarity determining regions (CDR-L1, CDR-L2 and CDR-L3), wherein:

[61] . the amino acid sequence of CDR-H1 is shown in SEQ ID NO: 1;

[62] . SEQ ID NO: 1 is GGSISSGGYYWS;

[63] . the amino acid sequence of CDR-H2 is shown in SEQ ID NO: 2;

[64] . SEQ ID NO: 2 is YIYYSGSTY;

[65] . the amino acid sequence of CDR-H3 is shown in SEQ ID NO: 3;

[66] . SEQ ID NO: 3 is VRLLGGGFDI;

[67] . the amino acid sequence of CDR-L1 is shown in SEQ ID NO: 4;

[68] . SEQ ID NO: 4 is RASQSVSTYLA;

[69] . the amino acid sequence of CDR-L2 is shown in SEQ ID NO: 5;

[70] . SEQ ID NO: 5 is DTSIRAT;

[71] . the amino acid sequence of CDR-L3 is shown in SEQ ID NO: 6;

[72] . SEQ ID NO: 6 is QQRSNWPLT.

[73] . In the present application, the antibody or antibody fragment which targets ITGA2 comprises a heavy chain variable region and a light chain variable region, wherein

[74] . the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO: 7 or has at least 90 %, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 7;

[75] . SEQ ID NO: 7 is

[76] . QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVRLLGGGFDIWGQGTTVTVSS;

[77] . the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 8 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 8;

[78] . SEQ ID NO: 8 is

[79] . EIVLTQSPATLSLSPGERATLSCRASQSVSTYLAWYQQKPGQAPRLLIYDTSIRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK.

[80] . In the present application, the Ab is an antibody which targets ITGA2, the heavy chain of the antibody is an IgG1 subtype or an IgG1 subtype with mutations, and the light chain of the antibody is of the Kappa type.

[81] . In the present application, the antibody which targets ITGA2 comprises a heavy chain and a light chain.

[82] . In some embodiments, the amino acid sequence of the heavy chain is shown in SEQ ID NO: 9 or has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SEQ ID NO: 9;

[83] . SEQ ID NO:9 is

[84] . QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVRLLGGGFDIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.

[85] . In some embodiments, the amino acid sequence of the heavy chain is shown in SEQ ID NO: 11 or has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SEQ ID NO: 11,

[86] . SEQ ID NO: 11 is

[87] . QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVRLLGGGFDIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELYGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.

[88] . The amino acid sequence of the light chain is shown in SEQ ID NO: 10 or has at least 80%, 81%, 82%, 83%, 84%, 85%, 86 %, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SEQ ID NO: 10;

[89] . SEQ ID NO: 10 is

[90] . EIVLTQSPATLSLSPGERATLSCRASQSVSTYLAWYQQKPGQAPRLLIYDTSIRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC.

[91] . SEQ ID NOs: 9-11 are all humanized sequences.

[92] . In the present application, the antibody which targets ITGA2 is capable of binding to ITGA2 with sufficient affinity such that it can be used as a diagnostic and / or therapeutic agent for targeting ITGA2.

[93] . The antibodies used to target ITGA2 in the present application do not bind to proteins irrelevant to the target. Here, "irrelevant proteins" refers to other proteins than ITGA2. "Non-binding" refers to, if the binding ability of the ITGA2-targeting antibody of the present application to its target ITGA2 is deemed as 100%, the binding ability of the antibody which targets ITGA2 of the present application to irrelevant proteins is less than 10%, such as 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0%.

[94] . The antibody used to target ITGA2 in this application is a monoclonal antibody.

[95] . As used herein, ITGA2 is Integrin alpha-2, and the accession number of human ITGA2 protein in the Uniprot database is P17301, see https: / / www.uniprot.org / uniprot / P17301.

[96] . The amino acid sequence of ITGA2 is

[97] . MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKEGILGQHQFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS.

[98] . As used herein, "antibody" refers to a whole antibody, which may also be called a complete or intact antibody. Antibodies are glycoproteins containing at least two heavy chains (HC) and two light chains (LC) interconnected by disulfide bonds. Each heavy chain consists of a heavy chain variable region (VH) and a heavy chain constant region. The heavy chain constant region consists of three domains (CH1, CH2, and CH3). Each light chain consists of a light chain variable region (VL) and a light chain constant region. The light chain constant region consists of one domain (CL). The VH and VL regions can be further subdivided into highly variable regions called complementarity-determining regions (CDRs) interspersed with more conserved regions called framework regions (FRs). Each VH and VL consists of three CDRs and four FRs arranged from the amino terminus to the carboxyl terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain binding domains that interact with the antigen. The constant region of an antibody mediates the binding of immunoglobulins to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system. As used herein, the term "antibody" is used in its broadest sense and encompasses immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules containing an antigen-binding site or domain. This term may also refer to an antigen-binding fragment or a complex of one or more antigen-binding fragments (e.g., a scFv). Immunoglobulin molecules may be of any class (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), or of any type (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2), or of any subclass, or of any provenance source (for example, human, rat, rabbit, camel, fish, etc.).

[99] . As used herein, "antigen-binding fragment" or "antibody fragment" refers to one or more fragments of an antibody that retain the ability to specifically bind to a given antigen and thereby exhibit the desired antigen-binding activity. The antigen-binding function of an antibody can be performed by fragments of the intact antibody. Examples of binding fragments encompassed by the term "antigen-binding fragment of an antibody" include, but are not limited to: Fab, Fab', Fab'-SH, F(ab')2; bispecific antibodies; linear antibodies; single-chain antibody molecules (e.g., scFv and scFab); single-domain antibodies (dAb); and multispecific antibodies formed from antibody fragments; Fd fragments composed of VH and CH1 domains; Fv fragments consisting of VL and VH domains of a single arm; single-domain antibody (dAb) fragments consisting of VH domains or VL domains; and isolated complementarity determining regions (CDRs). Furthermore, although the two domains of the Fv fragment, VL and VH, are encoded by separate genes, they can be linked by artificial peptide linkers using recombinant methods. This enables them to form a single protein chain in which the VL and VH regions pair to form a monovalent molecule, known as a single-chain Fv (scFv). These single-chain antibodies may comprise one or more antigen-binding fragments of the antibody. These antigen-binding fragments are obtained using conventional techniques known to those skilled in the art, and the fragments are screened for utility in the same manner as intact antibodies. Antigen-binding fragments can also be incorporated into single-domain antibodies, large antibodies, minibodies, endobodies, diabodies, tribodies, tetrabodies, v-NARs, and bis-scFv. The antigen-binding fragments can be incorporated into a single-chain molecule comprising a pair of tandem Fv fragments (VH-CH1-VL-CL), which together with complementary light chain polypeptides form a pair of antigen-binding regions. "Antibodies" comprise polyclonal antibodies and monoclonal antibodies.

[100] . As used herein, the "Fd" fragment consists of the VH and CH1 domains. "dAb" fragments, as described by Ward et al. (1989) in Nature 341:544-546, consist of the VH domain. An isolated complementarity-determining region (CDR) or a combination of two or more isolated CDRs may optionally be linked by a synthetic linker.

[101] . As used herein, an "Fv" fragment consists of the VL and VH domains of a single arm of an antibody. Single-chain Fv (scFv) consists of a heavy chain variable domain and a light chain variable domain, which are covalently linked into a single polypeptide chain through a flexible peptide linker.

[102] . As used herein, "monoclonal antibody" refers to an antibody derived from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and / or bind the same epitope. Exceptions include variant antibodies containing naturally occurring mutations or those arising during the production of monoclonal antibody preparations; such variants are typically present in trace amounts. Unlike polyclonal antibody preparations, which typically comprise different antibodies directed against different determinants (epitopes), monoclonal antibody preparations have each monoclonal antibody directed against a single determinant on the antigen. Thus, the term "monoclonal" indicates the characteristic that the antibody is derived from a substantially homogeneous population of antibodies and should not be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies to be used in accordance with the present application can be prepared by a variety of techniques, including, but not limited to, hybridoma methods, recombinant DNA methods, phage display methods, and a method using transgenic animals containing all or part of the human immunoglobulin loci. Such methods and other exemplary methods of preparing monoclonal antibodies are described herein.

[103] . As used herein, a "monoclonal antibody" is generally a human antibody, which can be prepared using techniques well known to those skilled in the art. For example, human antibodies are generally described in van Dijk, MA and van de Winkel, JG, Curr. Opin. Pharmacol. 5:368-374 (2001) and Lonberg, N., Curr. Opin. Immunol. 20:450-459 (2008).

[104] . The monoclonal antibodies described in this application may also be antibody variants, for example, where it may be desirable to improve the binding affinity and / or other biological properties of the antibody. Amino acid sequence variants of antibodies can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions, insertions, and / or substitutions of residues within the amino acid sequence of the antibody. Any combination of deletions, insertions, and substitutions can be made to obtain the final construct, as long as the final construct possesses the desired characteristics, such as antigen binding. Thus, in certain embodiments, antibody variants are provided with one or more amino acid substitutions. Sites of interest for substitution mutations comprise the HVR and FR. For example, amino acid substitutions can be introduced into the antibody of interest and screened for products with desired activity, e.g., retained or improved antigen binding, reduced immunogenicity, or improved ADCC or CDC.

[105] . As used herein, the Fc region of the antibody whose heavy chain is of the IgG1 subtype is different from that of the antibody whose heavy chain is the IgG1 subtype with a mutation. However, the variable regions are the same, that is, the heavy chain variable regions and the light chain variable regions of the two aforementioned antibodies are identical.

[106] . As used herein, the antibody component or antibody in the antibody drug conjugate comprises an Fc domain (Fc region) derived from a human origin and preferably all other parts of the human constant region. As used herein, the term "human-derived Fc domain" means an Fc domain that is an Fc domain of a human antibody of the IgG1, IgG2, IgG3, or IgG4 subclass, preferably an Fc domain from the human IgG1 subclass or a mutated Fc domain from the human IgG1 subclass. The antibody has reduced or minimal effector function. Minimal effector function is caused by effector-null Fc mutations.

[107] . As used herein, "Fc region" is used to define the C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region, which comprises native sequence Fc regions and variant Fc regions. In some embodiments, the human IgG heavy chain Fc region extends from Cys226 or from Pro230 to the carboxy terminus of the heavy chain. However, antibodies produced by the host cell may undergo post-translational cleavage of one or more (especially one or two) amino acids from the C-terminus of the heavy chain. Thus, an antibody produced by a host cell through the expression of a specific nucleic acid molecule encoding a full-length heavy chain may comprise a full-length heavy chain, or the antibody may comprise a cleaved variant of a full-length heavy chain. This may be the case when the last two C-terminal amino acids of the heavy chain are glycine (G446) and lysine (K447, numbered according to the Kabat EU index). Therefore, the C-terminal lysine (Lys447) or the C-terminal glycine (Gly446) and lysine (Lys447) of the Fc region may or may not be present. In some embodiments, a heavy chain including an Fc region (subunit) as specified herein is comprised in an antibody according to the present application. Unless otherwise indicated herein, the numbering of amino acid residues in the Fc region or constant region is numbered according to the EU numbering system (also known as the EU index), as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., U.S. Department of Health and Human Services, National Institutes of Health, Bethesda, MD, 1991 (see also supra). As used herein, a "subunit" of an Fc domain refers to one of the two polypeptides that form the dimeric Fc domain, namely the polypeptide comprising the C-terminal constant region of the immunoglobulin heavy chain that is capable of stabilizing self-association and combining. For example, subunits of the IgG Fc domain comprise the IgG CH2 constant domain and the IgG CH3 constant domain.

[108] . As used herein, "variable region," also called "variable domain," refers to the domain of the antibody heavy chain or light chain that participates in the binding of the antibody to the antigen. The variable domains of the heavy and light chains of natural antibodies (VH and VL, respectively) generally have similar structures, with each domain containing four conserved framework regions (FR) and three hypervariable regions (HVR). See, for example, Kindt et al., Kuby Immunology, 6th ed., W. H. Freeman and Co., p. 91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity.

[109] . As used herein, "host cell," "host cell line," and "host cell culture" are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells comprise "transformants" and "transformed cells," which include primary transformed cells and progeny derived from said primary transformed cells, regardless of passage number. The progeny may not have exactly the same nucleic acid content as the parent cell, but may contain mutations. Included herein are mutant progeny having the same function or biological activity as screened or selected in the original transformed cell. A host cell is any type of cell system that can be used to produce the antibodies of the invention. Host cells comprise cultured cells, such as mammalian cultured cells, like HEK cells, CHO cells, BHK cells, NSO cells, SP2 / 0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, or hybridoma cells, yeast cells, insect cells, and plant cells. They also include cells contained in transgenic animals, transgenic plants, or cultured plant or animal tissues. In one aspect, the host cells of the invention are eukaryotic cells, particularly mammalian cells. In one aspect, the host cells are not cells in the human body.

[110] . As used herein, "affinity" refers to the strength of the sum of the non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless otherwise indicated, "binding affinity" as used in this specification means an intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be expressed by the equilibrium dissociation constant (KD). Affinity can be measured by common methods known in the art.

[111] . This application provides a method for preparing an antibody drug conjugate, which comprises the following steps:

[112] . Step 1: providing LD-38;

[113] . Step 2: constructing an antibody or an antibody fragment Ab which targets ITGA2;

[114] . Step 3: conjugating LD-38 with the antibody or antibody fragment Ab which targets ITGA2 to obtain an antibody drug conjugate;

[115] . the structure of LD-38 is;

[116] . the antibody or antibody fragment Ab which targets ITGA2 is defined as the above.

[117] . The present application provides a pharmaceutical composition, which comprises the aforementioned antibody drug conjugate, or its tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs, or solvates (e.g., hydrate) thereof.

[118] . The present application also provides use of the antibody drug conjugate as mentioned above, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in the preparation of a medicament for the treatment and / or prevention of tumors.

[119] . The tumors are selected from solid tumors, hematological tumors and metastatic, refractory or recurrent lesions of cancer.

[120] . The tumors are selected from the group consisting of esophageal cancer, gastrointestinal cancer, pancreatic cancer, thyroid cancer, colorectal cancer, renal cancer, lung cancer (such as non-small cell lung cancer), liver cancer, gastric cancer, gastric adenocarcinoma, gastroesophageal junction (GEJ) adenocarcinoma, head and neck cancer, bladder cancer, breast cancer, uterine cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, germ cell cancer, bone cancer, skin cancer, thymus cancer, cholangiocarcinoma, gallbladder cancer, melanoma, mesothelioma, lymphoma, myeloma (such as multiple myeloma), sarcoma, glioblastoma, and leukemia.

[121] . The present application also provides use of the antibody drug conjugate as mentioned above, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in combination with other therapeutic drugs in the preparation of a medicament for the treatment and / or prevention of tumors.

[122] . The other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.

[123] . The present application also provides the antibody drug conjugate as mentioned above, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof, for use in the treatment and / or prevention of tumors.

[124] . The present application also provides the antibody drug conjugate as mentioned above, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates (e.g., hydrate) thereof in combination with other therapeutic drugs, for use in the treatment and / or prevention of tumors.

[125] . The other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.

[126] . As used herein, "pharmaceutical composition" means a mixture containing one or more compounds described herein, or physiologically acceptable salts or prodrugs thereof, and other chemical components, as well as other components such as physiologically acceptable carriers and excipients. The purpose of pharmaceutical compositions is to facilitate administration to living organisms and facilitate the absorption of active ingredients to exert biological activity.

[127] . As used herein, "treatment" (and its grammatical variations) refers to clinical interventions that attempt to alter the natural course of a disease in the individual being treated, and that may be performed for prevention or may be performed in the course of clinical pathology. Desired effects of treatment comprise, but are not limited to, preventing the occurrence or recurrence of disease, alleviating symptoms, attenuating any direct or indirect pathological consequences of the disease, preventing metastasis, reducing the rate of disease progression, ameliorating or alleviating the disease state, and alleviating or improving the prognosis. In some aspects, the antibodies of the present application are used to delay the development of a disease or slow the progression of a disease.

[128] . As used herein, an "individual" or "subject" is a mammal. Mammals comprise, but are not limited to, domesticated animals (e.g., cattle, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates, such as monkeys), rabbits, and rodents (e.g., mice and rats). In some embodiments, the individual or subject is a human being.

[129] . In a preferred embodiment of the present invention, a subset of “A36”-containing ADCs is provided that demonstrates improved potency and / or reduced toxicity over structurally similar A36-containing ADCs. One advantage associated with this subset of ADCs of the present invention is that they can provide a drug: antibody loading ratio that is greater than 6, preferably greater than 7, and more preferably close to 8. 

[130] . EXAMPLES

[131] . This application provides a general and / or specific description of the materials and test methods used in the experiments. In the following examples, unless otherwise specified, "%" means "wt %," that is, weight percentage. If the manufacturer of the reagents or instruments used is not indicated, they are all conventional reagent products that can be purchased commercially.

[132] . Example 1 Preparation of LD-38

[133] . The synthesis route of LD-38 is as follows: Synthesis of 38-1

[134] . Fmoc-L-glutamic acid-5-tert-butyl ester (144.7 mg, 1.175 mmol) and 4-aminobenzyl alcohol (500 mg, 1.175 mmol) were dissolved in 3 mL of anhydrous DMF. DIEA (303.7 mg, 2.350 mmol) and HATU (536.19 mg, 1.410 mmol) were added, and the mixture was stirred at room temperature for 16 hours. The completion of the reaction was indicated by LCMS. Water was added, and the mixture was extracted with ethyl acetate three times. The organic phases were combined, washed with saturated brine, dried over anhydrous sodium sulfate, filtered, and concentrated to obtain the crude product. The product was purified using a normal phase silica gel column (EA / PE, 0% to 45%) to yield 530 mg. MS(+) = 475.2.

[135] . Synthesis of 38-2

[136] . Compound 38-1 (530 mg, 0.999 mmol) was dissolved in 3 mL of anhydrous DMF. Piperidine (0.2 mL) was added to the reaction solution, and the mixture was stirred at room temperature for one hour. The reaction mixture was then concentrated to obtain 600 mg of crude product, which was used directly in the next reaction. MS(+) = 309.2.

[137] . Synthesis of 38-3

[138] . Compound 38-2 (600 mg, crude product) and Fmoc-L-valine (500 mg, 1.175 mmol) were dissolved in 3 mL of anhydrous DMF. DIEA (334.13 mg, 2.585 mmol) and HATU (589.82 mg, 1.551 mmol) were added, and the mixture was stirred at room temperature for 16 hours. LCMS showed that the reaction was complete. Water was added, and the mixture was extracted three times with ethyl acetate. The organic phases were combined, washed with saturated brine, dried over anhydrous sodium sulfate, filtered, and concentrated to obtain the crude product. The crude product was purified using a normal phase silica gel column (EA / PE, 40% to 60%) to yield 450 mg. MS(+) = 630.4.

[139] . Synthesis of 38-4

[140] . Compound 38-3 (450 mg, 0.715 mmol) was dissolved in a mixture of 1 mL anhydrous DCM and 4 mL anhydrous DMF. Bis(p-nitrophenyl) carbonate (869.5 mg, 2.858 mmol) and 0.354 mL DIEA were added sequentially. After reacting at room temperature for 12 hours, water was added to the reaction solution. The mixture was then extracted three times with ethyl acetate. The organic phases were combined, washed with saturated brine, dried over anhydrous sodium sulfate, filtered, and concentrated to obtain the crude product. The crude product was purified using a normal phase silica gel column (EA / PE, 30% to 70%) to yield 200 mg. MS(+) = 543.2.

[141] . Synthesis of 38-5

[142] . Compound 38-4 (100 mg, 0.126 mmol) and exatecan mesylate (54.78 mg, 0.126 mmol) were dissolved in 2 mL of anhydrous DMF. DMAP (0.15 mg, 0.0001 mmol) and DIEA (32.52 mg, 0.252 mmol) were added sequentially. After reacting at room temperature for 1 hour, water was added to the reaction solution. The mixture was then extracted three times with ethyl acetate. The organic phases were combined, washed with saturated brine, dried over anhydrous sodium sulfate, filtered, and concentrated to obtain the crude product. The crude product was purified using a normal phase silica gel column (EA / PE, 30% to 70%) to yield 100 mg. MS(+) = 1091.4.

[143] . Synthesis of 38-6

[144] . Compound 38-5 (100 mg, 0.073 mmol) was dissolved in 3 mL of anhydrous DMF. Piperidine (0.3 mL) was added to the reaction solution, and the mixture was stirred at room temperature for one hour. The solution was then concentrated to obtain 110 mg of crude product, which was used directly in the next reaction. MS(+) = 870.8.

[145] . Synthesis of 38-7

[146] . Compound 38-6 (110 mg, crude product) and Mal-amido-PEG4-acid (30.19 mg, 0.073 mmol) were dissolved in 2 mL of anhydrous DMF. DIEA (18.74 mg, 0.145 mmol) and HATU (33.08 mg, 0.087 mmol) were added, and the mixture was stirred at room temperature for 2 hours. LCMS showed that the reaction was complete. Water was added, and the mixture was extracted with ethyl acetate three times. The organic phases were combined, washed with saturated brine, dried over anhydrous sodium sulfate, filtered, and concentrated to obtain the crude product. The crude product was purified using a normal phase silica gel column (MeOH / DCM, 5% to 20%) to yield 90 mg. MS(+) = 1267.6.

[147] . Synthesis of 38-8

[148] . Compound 38-7 (90 mg, 0.071 mmol) was dissolved in 3 mL of anhydrous DCM. TFA (0.3 mL) was added, and the mixture was stirred at room temperature for 2 hours. The solution was then concentrated to obtain 80 mg of crude product, which was used directly in the next reaction. MS(+) = 2111.4.

[149] . Synthesis of LD-38

[150] . Compound 38-8 (80 mg, crude product) and sulfonate quaternary ammonium salt A (13.89 mg, 0.066 mmol, CAS number: 78276-19-4, provided by Shanghai Haoyuan Pharmaceutical Co., Ltd., the synthesis method refers to WO2011146595A2) were dissolved in 2 mL of anhydrous DMF. DIEA (17.07 mg, 0.132 mmol) and HATU (30.14 mg, 0.079 mmol) were added, and the mixture was stirred at room temperature for 1 hour. LCMS showed that the reaction was complete. Reverse-phase preparation (mobile phase containing 0.1% formic acid) was used for purification to obtain 13.5 mg of white solid.

[151] . LCMS: m / z (ES+) (M+ H)+ = 1404.6, Rt = 1.314 min

[152] . 1H NMR (400 MHz, DMSO) δ 9.89 (s, 1H), 8.18 (d, J = 7.2 Hz, 2H), 8.10 – 7.93 (m, 3H), 7.78 (d, J = 10.8 Hz, 1H), 7.63 (d, J = 8.4 Hz, 2H), 7.37 (d, J = 8.4 Hz, 2H), 7.32 (s, 1H), 6.99 (s, 2H), 6.53 (s, 1H), 5.45 (s, 2H), 5.29 (d, J = 4.Hz, 3H), 5.08 (s, 2H), 4.32 (dd, J = 13.2, 7.6 Hz, 1H), 4.20 – 4.14 (m, 1H), 3.59 (dd, J = 14.8, 7.6 Hz, 6H), 3.40-3.51 (m, 18H), 3.14-3.20 (m, 4H), 3.03 (s, 7H), 2.42 – 2.30 (m, 7H), 2.20-2.31 (m, 4H), 2.03 – 1.82 (m, 8H), 0.87-0.91 (m, 9H).  

[153] . Example 2 Preparation of Antibody Drug Conjugates ADC (A36-LD-38, A36mut-LD-38 and IgG-LD-38)

[154] . The sequence design of the ITGA2 monoclonal antibody A36, the vector construction, the expression, purification and identification were entrusted to Sanyou Biopharmaceutical (Shanghai) Co., Ltd. The specific preparation process can be found in patent PCT / CN2023 / 098076.

[155] . The A36 antibody is an anti-ITGA2 monoclonal antibody, and the Fc region of the antibody is the IgG1 subtype. The heavy chain of the antibody is shown as SEQ ID NO:9, and the light chain is shown as SEQ ID NO:10.

[156] . The A36mut antibody is an anti-ITGA2 monoclonal antibody, and the Fc region of the antibody is a mutated IgG1 subtype. The heavy chain of the antibody is shown as SEQ ID NO: 11, and the light chain is shown as SEQ ID NO: 10.

[157] . The IgG negative control antibody was also purchased from Sanyou (P102712).

[158] . The liquid of the A36 antibody was changed into a pH 7.4 phosphate buffer using an ultrafiltration centrifuge tube. Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) was added at 10 times the molar amount of the antibody, and the mixture was reacted at 37°C for 2 hours to open the antibody interchain disulfide bonds. After the reduction, the A36 antibody was changed back into a pH 7.4 phosphate buffer using an ultrafiltration centrifuge tube to remove excess TCEP. LD-38 was added at 12 times the molar amount of the antibody, and the mixture was reacted at room temperature for 1 hour. After the reaction was completed, cysteine was added at twice the molar amount of LD-38 prepared in Example 1 to quench the reaction. The liquid was then changed into a pH 5.5 acetic acid-sodium acetate (40 mM) buffer using an ultrafiltration centrifuge tube. The sample, after liquid replacement, was filtered using a 0.22-micron sterilizing filter to obtain the antibody drug conjugate A36-LD-38, A36mut-LD-38, or IgG-LD-38, which was measured by molecular sieve exclusion chromatography (SEC). The purity of A36-LD-38, A36mut-LD-38, and IgG-LD-38 was assessed.

[159] . The size exclusion chromatography (SEC) analysis was performed using a Tskgel G3000SWXL column (TOSOH, 0008541), with a mobile phase of 0.1 M PB pH 7.0 and 0.1 M NaCl. Isocratic elution was employed at a flow rate of 1 mL / min, with the column temperature maintained at 25°C. Detection wavelengths were set at 280 nm and 366 nm. The SEC analysis results are shown in Figure 1. Figure 1(A) shows the SEC analysis results for A36-LD-38. Figure 1(B) shows the SEC analysis for A36mut-LD-38. Figure 1(C) shows the SEC analysis results for IgG-LD-38. The purities of A36-LD-38, A36mut-LD-38, and IgG-LD-38 were 98.10%, 99.32%, and 98.22%, respectively.  

[160] . Example 3 Preparation of Antibody Drug Conjugates ADC (A36-Dxd, A36mut-Dxd and IgG- Dxd)

[161] . Materials and methods:

[162] . Conjugating buffer: 4×PBS, pH 7.4

[163] . Dialysis buffer: 1×PBS, pH 7.4

[164] . Antibody reducing concentration: 5 mg / mL

[165] . Tris(2-chloroethyl)phosphate (TCEP): 5mM in 4×PBS, pH 7.4

[166] . TCEP : Antibody=7 : 1

[167] . Payload : 10 mM linker-payload, dimethyl sulfoxide (DMSO)

[168] . DMSO in final reaction: 5%

[169] . Payload : Antibody=10 : 1

[170] . Reduction temperature and time: 37°C and 2 hours

[171] . Conjugating temperature and time: 25°C and 20 minutes

[172] . Conjugating steps:

[173] . Antibodies were thawed and dialyzed against conjugating buffer at 4°C for over 4 hours;

[174] . The antibody solution was concentrated to 2-5 mg / ml if necessary;

[175] . TCEP working solution was added to reduce the antibody, which was then incubated in a water bath at 25°C;

[176] . A linker-payload solution was prepared in DMSO (10 mM);

[177] . The volume of each conjugated linker-payload solution was calculated based on molar concentration;

[178] . The antibody was mixed with the linker-payload at the desired molar ratio and incubated in a 25°C water bath;

[179] . The conjugate was dialyzed using ADC storage buffer for over 4 hours at 4°C, with the buffer changed at least every 4 hours; and the ADC was extracted and filtered using a 0.22 μm filter, and the sample was submitted for SEC-HPLC analysis.

[180] . By the above method, antibody drug conjugates of antibody A36 and IgG were prepared in this example by using Dxd (MC-GGFG-DXD, HY13MY2801, MCE) as the linker-payload.

[181] . ADC chromatographic analysis:

[182] . The size exclusion chromatography (SEC) analysis was conducted using a Tskgel G3000SWXL column (TOSOH, 0008541), with a mobile phase of 0.1 M PB at pH 7.0 and 0.1 M NaCl. The elution was isocratic at a flow rate of 1 mL / min, with the column temperature maintained at 25°C. Detection wavelengths were set at 280 nm and 366 nm. The SEC analysis results are presented in Figure 2. Figure 2(A) shows the SEC analysis results for A36-Dxd. Figure 2(B) shows the SEC analysis for A36mut-Dxd. Figure 2(C) shows the SEC analysis results for IgG-Dxd. The purities of A36-Dxd, A36mut-Dxd, and IgG-Dxd were 99.12%, 99.42%, and 100%, respectively.  

[183] . Example 4 Determination of the binding of ADC to ITGA2 at the cellular level by flow cytometry (FACS)

[184] . The human cholangiocarcinoma cell line HuCCT1 (Meisen Cell: CTCC-003-0103), which exhibits high ITGA2 expression, was plated in a 96-well plate at a density of 50,000 cells per well. Following centrifugation, the cells were washed twice with PBS and the supernatant was discarded. ITGA2 antibody A36, the ADC A36-Dxd prepared in Example 3, and the A36-LD-38 prepared in Example 2 were used as primary antibodies. These were prepared in a PBS solution containing 1% FBS to a working concentration of 30 nM and then serially diluted threefold to create a total of 11 specific concentration points. The prepared antibody dilutions were added to the corresponding wells of a 96-well plate and incubated at 4°C for 30 minutes. The washing was then repeated twice with a PBS solution containing 1% FBS, after which the PBS was discarded, and the plate was centrifuged to discard the antibody supernatant. A goat anti-human secondary antibody IgG (H+L) (Invitrogen, A21445) was prepared at a dilution of 1:300 in a PBS solution containing 10% FBS to eliminate cross-reactivity with other species. This secondary antibody solution was added to the 96-well plate and incubated at 4°C for 30 minutes. The samples were then collected and analyzed using flow cytometry (Agilent, Novocyte 3000). Finally, the affinity of the antibodies for the ITGA2 target was evaluated through the EC50 value.

[185] . The EC50 measurement results are shown in Figure 3. The EC50 values for antibodies A36, ADC A36-Dxd, and A36-LD-38 are 0.625 nM, 0.718 nM, and 0.746 nM, respectively. These values are not significantly different, indicating that the affinity of the ADC is not affected by the conjugated toxin.  

[186] . Example 5 Determination of determine the endocytosis rate of antibody A36 by high-content imaging

[187] . HuCCT1 cells (Meisen cells: CTCC-003-0103) were plated in a 96-well plate at a density of 5,000 cells per well and cultured overnight in a constant temperature incubator at 37°C and 5% CO₂. The following day, IgG and A36 antibodies were diluted to 24 μg / mL (4×) with culture medium. A volume of 200 μL of Zenon™ pHrodo™ iFL IgG (Invitrogen, Z25612) reagent was added to 2.3 mL of cell culture medium to achieve a total volume of 2.5 mL. The diluted A36 antibody was then mixed with the Zenon™ pHrodo™ iFL IgG reagent at a 1:1 ratio. The HuCCT1 cells were removed from the incubator, the medium was discarded, and 50 μL of fresh medium was added, followed by 50 μL of the prepared A36 antibody and Zenon™ pHrodo™ iFL IgG mixture. The final antibody concentration was 6 μg / mL (120 nM). The cells were then placed in a high-content imager (Molecular Devices, ImageXpress Micro-4). Under 20× magnification, 25 fields of view were selected in each well, and images were captured at various time points (0 h, 1 h, 2 h, 4 h, 8 h, 12 h, 16 h, 20 h, and 24 h). The proportion of cells exhibiting fluorescent signals was analyzed.

[188] . The endocytosis rate results are shown in Figure 4. After the A36 antibody was added to HuCCT1 cells, it was rapidly endocytosed, reaching a plateau phase after 12 hours.  

[189] . Example 6 In vitro cell killing effect of ADC molecules

[190] . HuCC-T1 (human cholangiocarcinoma cell; Meisen Cell: CTCC-003-0103), BxPC-3 (human orthotopic pancreatic adenocarcinoma cell; Meisen Cell: CTCC-001-0360), PANC-1 (human pancreatic cancer cell; Wuhan Procell: CL-0184), and COLO205 (human colorectal adenocarcinoma cell line; Wuhan Procell: CL-0066) were plated into a 96-well plate, with 2500 cells in 100 μL of medium per well. Cells were plated in triplicate and cultured overnight in a 37°C, 5% CO₂ constant temperature incubator. The following day, complete culture medium was used to prepare 2× ADC molecules (A36-Dxd prepared in Example 3 and A36-LD-38 prepared in Example 2). The working concentration of 60 μg / mL was diluted in a 3-fold gradient to a total of 11 concentration points. The 96-well plate was removed from the incubator, the medium was aspirated, and then 50 μL of fresh medium was added, followed by 50 μL of the prepared ADC molecules to the cell plate. The cell plate was then placed back in a 37°C, 5% CO2 incubator and incubated for 5 days.

[191] . After 5 days, the 96-well plate was removed and allowed to equilibrate at room temperature for 30 minutes. Then, 100 μL of CellTiter-Glo® 2.0 Assay Reagent (Promega, G9242) was added to each well. The plate was then placed on a shaker and shaken at 700 rpm for 2 minutes, followed by incubation at room temperature for 10 minutes. Finally, the plate was read using a Spark multifunctional microplate reader (TECAN).

[192] . Based on the readings from the Spark multifunctional microplate reader, the fluorescence values obtained were used as readouts to calculate and analyze the cytotoxic effects of ADC molecules on different cell lines using Prism software. A summary of the data obtained is presented in Table 1. The ADCs generated by conjugating antibodies to small molecule toxins, as described in this application, demonstrated excellent cytotoxic effects on tumor cells expressing the ITGA2 protein. Notably, A36-LD-38 exhibited a superior cytotoxic effect compared to A36-Dxd.

[193] . Table 1. Cell killing effect of A36 antibody and ADCDrug moleculeHuCC-T1 cell killing IC50 (nM)BxPC-3 cell killing IC50 (nM)PANC-1 cell killing IC50 (nM)COLO205 cell killing IC50 (nM)A36 No kill No kill No kill No killA36-Dxd 23.48 14.22 40.64 280.4A36-LD-38 17.37 0.77 36.19 73.67 

[194] . Example 7 Detection of bystander effect of the ADC molecular

[195] . ITGA2 is expressed at low levels in human normal thyroid cells Nthy-ori 3-1 (Zhejiang Meisen, CTCC-003-0031). The inventor constructed an Nthy-ori 3-1-ITGA2 overexpression cell line to detect the bystander effect of ADC molecules.

[196] . Nthy-ori 3-1 (Zhejiang Meisen, CTCC-003-0031) and Nthy-ori 3-1-ITGA2 cells were mixed at a ratio of 3:1 and plated in a 96-well plate at a density of 1500 cells / 100 μL per well. Concurrently, Nthy-ori 3-1 (Zhejiang Meisen, CTCC-003-0031) and Nthy-ori 3-1-ITGA2 cells were separately cultured and plated in a 96-well plate under the same conditions to serve as controls. The 96-well plate was placed in a 37°C, 5% CO2 incubator and incubated overnight. The following day, complete culture medium was used to prepare 2 × solutions of the antibody (A36) and ADC molecules (A36-Dxd and IgG-Dxd prepared in Example 3, and A36-LD-38 and IgG-LD-38 prepared in Example 2). The working concentration was set at 60 μg / mL, followed by a 3-fold serial dilution, resulting in a total of 10 concentration points. The 96-well plate was removed from the incubator, the medium was aspirated, and then 50 μL of fresh medium was added, followed by 50 μL of the prepared ADC molecules to the cell plate. The cell plate was then placed back in a 37°C, 5% CO2 incubator and incubated for 5 days. After 5 days, the 96-well plate was taken out and allowed to equilibrate at room temperature for a few minutes. Then, 100 μL of CellTiter-Glo® 2.0 Reagent (Promega, G9242) was added to each well. A mixer (Eppendorf / ThermoMixer C) was used to shake the plate at 700 rpm for 2 minutes to mix the contents, and the plate was left at room temperature for 10 minutes. Finally, a Spark multi-function microplate reader (Tecan / Spark 30086376) was used to read the plate.

[197] . Based on the readings from the Spark multifunctional microplate reader, the fluorescence values obtained were used as readouts to calculate and analyze the cytotoxic effects of ADC molecules on different cell lines using Prism software. A summary of the data obtained is presented in Table 2. This result demonstrates that antibody A36-LD-38 exhibits a significant bystander effect, with a cytotoxic effect that is markedly superior to that of A36-Dxd (IC50 0.2419 nM vs. 138.5 nM).

[198] . Table 2. Bystander killing effects of A36 antibodies and ADCsdrug molecule Nthy-ori-ITGA2 (IC50 nM) Mix(3:1) (IC50 nM) Nthy-ori (IC50 nM)A36 >2069>2069>2069IgG-Dxd 87.75 102.2 103.1A36-Dxd 2.813 138.5 217.1IgG-LD-38 76.0988.2584A36-LD-38 0.251 0.2419 67.95 

[199] . Example 8 Study on the efficacy of ADC on human cholangiocarcinoma cell line HuCCT1 CDX model

[200] . BALB / c nude mice, aged 4-6 weeks, were acclimated to the SPF environment for a week in advance. Subsequently, these mice were subcutaneously inoculated with 5×106 human cholangiocarcinoma cells of the HuCCT1 line (Zhejiang Meisen, CTCC-003-0103). On the 40th day following cell inoculation, each group was administered injections of PBS, A36-Dxd (10 mpk) as prepared in Example 3, and A36-LD-38 (10 mpk) drug molecules as prepared in Example 2. Thereafter, body weight and tumor size were measured twice weekly. The formula for calculating tumor volume was:

[201] . Tumor volume (mm3) = 1 / 2 × (a × b2)

[202] . (wherein ‘a’ represents the long diameter and ‘b’ represents the short diameter).

[203] . The results are presented in Figure 5. Compared to the PBS control, the growth of subcutaneous tumors treated with a single dose of A36-Dxd and A36-LD-38 was significantly inhibited. The anti-tumor efficacy of A36-LD-38 was slightly superior to that of the A36-Dxd drug molecule. This result demonstrates that the A36-LD-38 drug molecule exhibits good efficacy in the human cholangiocarcinoma line HuCCT1 CDX model.  

[204] . Example 9 Study on the efficacy of ADC on human pancreatic cancer cell line BxPC-3 CDX model

[205] . BALB / c nude mice, aged 4-6 weeks, were acclimated to the SPF environment for one week prior to the experiment. The mice were then subcutaneously inoculated with 5×106 human pancreatic cancer cells of the BxPC-3 line (Zhejiang Meisen, CTCC-001-0360). On the 38th day after cell inoculation, each group was administered injections of PBS, A36-Dxd (2.5 mpk, 5 mpk, 10 mpk) as prepared in Example 3, and A36-LD-38 (10 mpk) as prepared in Example 2. Body weight and tumor size were measured twice weekly. The formula for calculating tumor volume was:

[206] . Tumor volume (mm3) = 1 / 2 × (a × b2)

[207] . (wherein ‘a’ represents the long diameter and ‘b’ represents the short diameter).

[208] . The results are depicted in Figure 6. Compared to the PBS control, the tumor growth was significantly inhibited by A36-Dxd, with the drug effect becoming more pronounced as the dose increased. The efficacy of A36-LD-38 at 10 mpk was significantly superior to that of the same dose of A36-Dxd. This result demonstrates that the A36-LD-38 drug molecule exhibits good efficacy in the human pancreatic cancer cell line BxPC-3 CDX model, and is more effective than A36-Dxd. 

[209] . Example 10 Study on the efficacy of ADC on human gastric cancer cell line NCI-N87 CDX model

[210] . BALB / c nude mice, aged 4-6 weeks, were acclimated to the SPF environment for one week prior to the experiment. The mice were then subcutaneously inoculated with 5×106 human gastric cancer cells of the NCI-N87 line (Procell, CL-0169). On the 4th, 7th, and 18th days after cell inoculation, each group was administered injections of PBS, A36-Dxd (5 mpk) as prepared in Example 3, and A36-LD-38 (5 mpk) as prepared in Example 2. Body weight and tumor size were measured twice weekly. The formula for calculating tumor volume was:

[211] . Tumor volume (mm3) = 1 / 2 × (a × b2)

[212] . (wherein ‘a’ represents the long diameter and ‘b’ represents the short diameter).

[213] . The results are presented in Figure 7. Compared to the PBS control, the growth of subcutaneous tumors treated with A36-Dxd and A36-LD-38 was significantly inhibited. The anti-tumor efficacy of A36-LD-38 was notably superior to that of A36-Dxd. This result demonstrates that A36-LD-38 exhibits good efficacy in the human gastric cancer cell line NCI-N87 CDX model, and is more effective than A36-Dxd.  

[214] . Example 11 Study on the efficacy of ADC on human colon cancer cell line COLO205 CDX model

[215] . BALB / c nude mice, aged 4-6 weeks, were acclimated to the SPF environment for one week prior to the experiment. The mice were then subcutaneously inoculated with 5×106 human colon cancer cells of the COLO205 line (Procell, CL-0066). On the 8th and 15th days after cell inoculation, each group was administered injections of PBS, A36-Dxd (5 mpk) and IgG-Dxd (5 mpk) as prepared in Example 3, and A36-LD-38 (5 mpk), A36mut-LD-38 (1 mpk, 2.5 mpk, 5 mpk), and IgG-LD-38 (5 mpk) as prepared in Example 2. Body weight and tumor size were measured twice weekly. The formula for calculating tumor volume was:

[216] . Tumor volume (mm3) = 1 / 2 × (a × b2)

[217] . (wherein ‘a’ represents the long diameter and ‘b’ represents the short diameter).

[218] . The results, as shown in Figure 8, indicated that the tumor volume treated with A36-LD-38 gradually decreased or even disappeared, while the tumor volume treated with A36-Dxd gradually increased, albeit slightly smaller than that in the PBS group. On days 50, 57, and 64, the mice in the A36-Dxd treatment group were switched to A36-LD-38 treatment (5 mpk) for three times, after which the tumor volume showed a significant decrease. This result demonstrates that A36-LD-38 has good efficacy in the human colon cancer cell line COLO205 CDX model, and is much better than the efficacy of A36-Dxd. A further observation was that when the tumors in the A36-Dxd treatment group grew to 1000 mm³ and became drug-resistant, three more doses of A36-LD-38 could reverse the growth trend of the tumors and shrink them, indicating that the A36-LD-38 molecule could overcome the resistance of Dxd in the COLO205 colorectal cancer model. Similarly, different doses of A36mut-LD-38 also inhibited the tumor growth of COLO205 (Figure 9), indicating that both the A36 antibody with wild-type IgG1 (A36) and the A36 antibody with mutant IgG1 (A36mut) could be conjugated with LD-38 to form ADCs, and they have great efficacies in the human colon cancer cell line COLO205 CDX model.  

[219] . Example 12 Study on the in vivo anti-tumor efficacy of ADC in the intestinal cancer PDX model

[220] . Tumor tissue was collected from HuPrime® intestinal cancer C0170 xenograft tumor-bearing mice models, and the tumors were cut into pieces with a diameter of 2-3 mm³. These pieces were then subcutaneously inoculated in the right front scapula of BALB / c nude mice. When the average tumor volume of the tumor-bearing mice reached approximately 100 mm³, the mice were randomly divided into groups according to the "experimental design." The mice were randomly assigned to four groups, including a control group (PBS) and drug administration groups (A36mut-Dxd and IgG-Dxd prepared in Example 3, A36mut-LD-38 prepared in Example 2). The mice were dosed once a week, with a dose of 5 mpk in the first three weeks and a dose of 10 mpk in the last week. Body weight and tumor size were measured twice weekly. The formula for calculating tumor volume was:

[221] . Tumor volume (mm3) = 1 / 2 × (a × b2)

[222] . (wherein ‘a’ represents the long diameter and ‘b’ represents the short diameter).

[223] . The statistical efficacy results are presented in Figure 10 below. Compared to A36-Dxd, A36-LD-38 has a superior effect on the intestinal cancer PDX model.

[224] . The above are merely the preferred embodiments of the present application and are not intended to limit the application to other forms. Any person skilled in the art may make changes or modifications, or equivalent alterations, using the technical content disclosed herein. For example, however, any simple modifications, equivalent changes, and modifications made to the aforementioned embodiments based on the technical essence of the present application, without departing from the content of the technical solution of the present application, still fall within the scope of protection of the technical solution of the present application.  

Claims

1. An antibody drug conjugate, which comprises the structure of the following formula 1: Formula 1wherein Ab is an antibody or antibody fragment which targets ITGA2; j is 1 to 8, preferably 4 to 8.

2. The antibody drug conjugate according to claim 1, wherein the antibody or antibody fragment which targets ITGA2 comprises three heavy chain complementarity determining regions (CDR-H1, CDR-H2 and CDR-H3) and three light chain complementarity determining regions (CDR-L1, CDR-L2 and CDR-L3), wherein: the amino acid sequence of CDR-H1 is shown in SEQ ID NO: 1; the amino acid sequence of CDR-H2 is shown in SEQ ID NO: 2; the amino acid sequence of CDR-H3 is shown in SEQ ID NO: 3; the amino acid sequence of CDR-L1 is shown in SEQ ID NO: 4; the amino acid sequence of CDR-L2 is shown in SEQ ID NO: 5; the amino acid sequence of CDR-L3 is shown in SEQ ID NO:

6.

3. The antibody drug conjugate according to claim 1, wherein the antibody or antibody fragment which targets ITGA2 comprises a heavy chain variable region and a light chain variable region, wherein, the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO: 7 or has at least 90 %, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 7;the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 8 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO:

8.

4. The antibody drug conjugate according to any one of claims 1 to 3, wherein the Ab is an antibody which targets ITGA2, and the heavy chain of the antibody is an IgG1 subtype or an IgG1 subtype with mutations, and the light chain of the antibody is of the Kappa type.

5. The antibody drug conjugate according to claim 4, wherein the antibody which targets ITGA2 comprises a heavy chain and a light chain, wherein, the amino acid sequence of the heavy chain is shown in SEQ ID NO: 9 or SEQ ID NO: 11 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identity with the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 11; the amino acid sequence of the light chain is shown in SEQ ID NO: 10 or has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity with the amino acid sequence of SEQ ID NO: 10.

6. A method for preparing an antibody drug conjugate, which comprises the following steps: providing LD-38; constructing an antibody or an antibody fragment Ab which targets ITGA2; conjugating LD-38 with the antibody or antibody fragment Ab which targets ITGA2 to obtain an antibody drug conjugate; the structure of LD-38 is; wherein, the antibody or antibody fragment Ab which targets ITGA2 is the one as defined in claims 2-6.

7. A pharmaceutical composition, which comprises the antibody drug conjugate of any one of claims 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereoisomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs, or solvates thereof.

8. Use of the antibody drug conjugate according to any one of claims 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates thereof in the preparation of a medicament for the treatment and / or prevention of tumors.

9. The use according to claim 8, wherein the tumors are selected from the group consisting of solid tumors, hematological tumors and metastatic, refractory or recurrent lesions of cancers.

10. The use according to claim 8, wherein the tumors are selected from the group consisting of esophageal cancer, gastrointestinal cancer, pancreatic cancer, thyroid cancer, colorectal cancer, renal cancer, lung cancer (eg non-small cell lung cancer), liver cancer, stomach cancer, gastric adenocarcinoma, gastroesophageal junction (GEJ) adenocarcinoma, head and neck cancer, bladder cancer, breast cancer, uterine cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, germ cell cancer, bone cancer, skin cancer, thymic cancer, cholangiocarcinoma, gallbladder cancer, melanoma, mesothelioma, lymphoma, myeloma (such as multiple myeloma), sarcoma, glioblastoma, and leukemia.

11. Use of the antibody drug conjugate according to any one of claims 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates thereof in combination with other therapeutic drugs in the preparation of a medicament for the treatment and / or prevention of tumors.

12. The use according to claim 11, wherein the other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.

13. The antibody drug conjugate according to any one of claims 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates thereof for use in the treatment and / or prevention of tumors.

14. The antibody drug conjugate according to any one of claims 1 to 5, or tautomers, mesomers, racemates, enantiomers, diastereomers, or mixtures thereof, or pharmaceutically acceptable salts, prodrugs or solvates thereof in combination with other therapeutic drugs for use in the treatment and / or prevention of tumors.

15. The use according to claim 14, wherein the other therapeutic drugs are selected from immune checkpoint drugs, drugs for chemotherapy or drugs for radiotherapy.