Monoclonal antibodies for prevention and treatment of herpes simplex viral infections
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2020-03-19
- Publication Date
- 2026-08-13
AI Technical Summary
Current treatments for herpes simplex virus (HSV) infections lack effective vaccines and monoclonal antibodies, particularly for HSV-1 and HSV-2, which are major health issues with limited commercial solutions, especially for immunocompromised patients.
Development of monoclonal antibodies and antigen-binding fragments with specific heavy and light chain variable regions that bind to HSV-2 antigens, including glycoprotein B, to inhibit viral activity and activate antibody-dependent cellular cytotoxicity.
The antibodies effectively inhibit HSV-2 activity, provide protection against lethal challenges, and offer a potential treatment or prevention method for HSV infections, particularly in immunocompromised individuals.
Smart Images

Figure 00000064_0000 
Figure 00000065_0000 
Figure 00000066_0000
Abstract
Description
MONOCLONAL ANTIBODIES FOR PREVENTION AND TREATMENT OF HERPES SIMPLEX VIRAL INFECTIONS CROSS-REFERENCE TO RELATED APPLICATION This application claims priority to U.S. provisional application serial No. 62 / 820,495, filed on March 19, 2019, the content of which is incorporated herein by reference in its entirety. STATEMENT OF GOVERNMENT SUPPORT
[0001] This invention was made with government support under grant number AI117321 awarded by the National Institutes of Health. The government has certain rights in the invention. BACKGROUND
[0002] Herpesvirus infections are a major health issue in human populations. There are currently small molecule anti-viral treatments that have some activity against an active infection, but no commercially available vaccines against HSV-1 or HSV-2 infections. In addition, there are no effective monoclonal antibodies for HSV treatment. SUMMARY
[0003] An antibody or antigen-binding fragment is provided, comprising: a heavy chain variable region comprising GYSFITYD (SEQ ID NO:1), IYPREGST (SEQ ID NO:2), and ATYGSSRYYTMDY (SEQ ID NO:3); and / or a light chain variable region comprising ESVDNFGISF (SEQ ID NO:4), AAS (SEQ ID NO:5), and QQSKEVPLT (SEQ ID NO:6).
[0004] An antibody or antigen-binding fragment is provided, comprising: a heavy chain variable region comprising GYSITNGNH (SEQ ID NO:7), IRSSGSS (SEQ ID NO:8), and ARGGGLRHYFDY (SEQ ID NO:9); and / or a light chain variable region comprising GNIHNY (SEQ ID NO:10), HAE (SEQ ID NO:11), and QHFWSTPYT (SEQ ID NO:12).
[0005] An antibody or antigen-binding fragment is provided, comprising: a heavy chain variable region comprising GFTFTIDYY (SEQ ID NO:13), IRNKANGYTT (SEQ ID NO:14), and ACGNYVGYAMDY (SEQ ID NO:15);and / or a light chain variable region comprising QSLLNSRTRKNY (SEQ ID NO:16), WAS (SEQ ID NO:17), and KQSYNLYT (SEQ ID NO:18).
[0006] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GFSLSRHD (SEQ ID NO:79), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); and / or a light chain variable region comprising QDISSY (SEQ ID NO:82), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84).
[0007] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFINYD (SEQ ID NO:87), IYPRDGST (SEQ ID NO:88), and ARGIFYVNYDVY (SEQ ID NO:89); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92).
[0008] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising EYEFPSHD (SEQ ID NO:93), INSDGGST (SEQ ID NO:94), and ARHSSGYVLDY (SEQ ID NO:95); and / or a light chain variable region comprising DHINHW (SEQ ID NO:96), GAT (SEQ ID NO:97), and QQYWSTPYT (SEQ ID NO:98).
[0009] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising EYEFPSHD (SEQ ID NO:85), INSDGGST (SEQ ID NO:80), and ARHSSGYVLDY (SEQ ID NO:81); and / or a light chain variable region comprising DHINHW (SEQ ID NO:86), GAT (SEQ ID NO:83), and QQYWSTPYT (SEQ ID NO:84).
[0010] A pharmaceutical composition comprising the antibody or antigen-binding fragment described herein and a pharmaceutically acceptable carrier or excipient.
[0011] A nucleic acid encoding a heavy chain variable region of an antibody, wherein the heavy chain variable region has an amino acid sequence comprising: GYSFTTYD (SEQ ID NO:1), IYPREGST (SEQ ID NO:2), and ATYGSSRYYTMDY (SEQ ID NO:3); or GYSITNGNH (SEQ ID NO:7); IRSSGSS (SEQ ID NO:8), and ARGGGLRHYFDY (SEQ ID NO:9); or GFTFTDYY (SEQ ID NO:13), IRNKANGYTT (SEQ ID NO:14), and ACGNYVGYAMDY (SEQ ID NO:15); or GFSLSRHD (SEQ ID NO:79), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); or GFSLNNYD (SEQ ID NO: 85), IWGDGST (SEQ ID NO: 80), and AKEDYGIFPY (SEQ ID NO: 81); or GYTFTNYD (SEQ ID NO:87), IYPRDGST (SEQ ID NO:88), and ARGIFYVNYDVY (SEQ ID NO:89); or EYEFPSHD (SEQ ID NO:93), INSDGGST (SEQ ID NO:94), and ARHSSGYVLDY (SEQ ID NO:95).
[0012] A nucleic acid encoding a light chain variable region ¢ ar wherein the light chain variable region has an amino acid sequence comprising: ESVDNFGISF (SEQ ID NO:4); AAS (SEQ ID NO:5); and QQSKEVPLT (SEQ ID NO:6), or GNIHNY (SEQ ID NO:10); HAE (SEQ ID NO:11); and QHFWSTPYT (SEQ ID NO:12), or QSLLNSRTRKNY (SEQ ID NO:16); WAS (SEQ ID NO:17); and KQSYNLYT (SEQ ID NO:18); or QDISSY (SEQ ID NO:82), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84); or QDINSY (SEQ ID NO:86), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84); or DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92); or DHINHW (SEQ ID NO:96), GAT (SEQ ID NO:97), and QQYWSTPYT (SEQ ID NO:98).
[0013] A nucleic acid encoding light chain complementarity determining regions (LCDR) LCDR1, LCDR2, and LCDR3 of a light chain of an antibody as described herein.
[0014] A nucleic acid encoding heavy chain complementarity determining regions (HCDR) HCDRI1, HCDR2, and HCDR3 of a heavy chain of an antibody as described herein.
[0015] A host cell comprising one or more of the nucleic acids described herein.
[0016] An antibody or antigen-binding fragment as described herein, linked or conjugated to a therapeutic agent.
[0017] A method of inhibiting a herpes simplex virus-2 (HSV-2) activity in a subject, the comprising administering the antibody or antigen-binding fragment described herein in an amount effective to inhibit HSV-2 activity in the subject.
[0018] A method of activating antibody-dependent cellular cytotoxicity (ADCC) of a cell infected with herpes simplex virus-2 (HSV-2) comprising: contacting the cell with an isolated antibody or antigen-binding fragment described herein in an amount which effects ADCC of the cell.
[0019] Use of an effective amount of the antibody or antigen-binding fragment described herein, or the pharmaceutical composition described herein. for treating or preventing a disease or condition that is associated with an herpes simplex virus-2 (HSV-2) infection in a subject. BRIEF DESCRIPTION OF THE DRAWINGS
[0020] Those of skill in the art will understand that the drawings, described below, are for illustrative purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
[0021] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0022] FIG. 1: ELISA results showing binding of culture supernatant to HSV-2 G infected cell lysates and uninfected Vero cell lysates. Germinal center (GC) B cells from inguinal lymph nodes of mice vaccinated with AgD-2 were sorted directly into 96-well plates (1 cell / well). These GC B cells were then cultured in the presence of NB-21.2D9 feeder cells. After culture, presence of IgG was first determined by ELISA, and then the reactivity of culture supernatant IgG against HSV-2 G infected cell lysates (HSV-2 G) and uninfected Vero lysates (Control) were tested by ELISA.
[0023] FIG. 2: Distribution of VH gene segments obtained from d16-d17 GC B cells.
[0024] FIGS. 3A-3B: Retention of HSV-2 G lysate-binding by recombinant antibodies (22D10, 32H6, 33B8, and 35H7). Binding of recombinant antibodies to HSV-2 G lysates was tested by ELISA. Both heavy and light chain V(D)J rearrangements were amplified from selected single B-cell culture wells (22D10, 32H6, 33B8, and 35H7) by standard RT-PCR. These cloned V(D)J rearrangements were introduced into expression vectors. Recombinant antibodies were obtained by co-transfection of these expression vectors into Expi293F cells. 24 mg of purified IgGs was obtained (not shown). These antibodies did not bind to control, uninfected Vero lysate.
[0025] FIG. 4: FcyRIV activation by the IgG1 and IgG2c isotypes of individual mAbs. FcyRIV activation was assayed using the Promega FcyRIV ADCC Reporter Bioassay at a concentration of 1 mg / mL. Statistical analysis is by ANOVA, **P<0.01, **** P<0.0001.
[0026] FIGS. 5A-5B show HSV-2 G lysate-binding by recombinant antibodies (BMPC- 23 and 19G7) cloned from single, bone marrow plasmacyte and GC B cell, respectively. Binding of recombinant antibodies to HSV-2-G infected cell lysates and uninfected cell lysates was tested by ELISA.
[0027] FIGS. 6A-6C: Passive transfer of mice with cloned HSV reactive IgG2c antibodies (BMPC-23, 33B8, and 22D10) provides protection against lethal HSV-2 challenge in overall survival (FIG. 6A), as well as in epithelial (FIG. 6B), and neurological assays (FIG. 6C).
[0028] FIG. 7A-7B. Immunoprecipitation-Mass Spectrometry (IP-MS) was performed to identify the binding targets of 22D10, 33B8, and BMPC-23 antibodies. The results identify human herpesvirus glycoprotein B (gB) as a target.
[0029] FIG. 8: shows the binding of the recombinant antibodies to glycoprotein B of HSV-1 (gB-1) as measured by Luminex multiplex assay.
[0030] FIGS. 9A and 9B are graphs of median fluorescence intensity (MFI) versus IgG concentration (ng / ml), showing the binding of various recombinant antibodies to gB-1 as measured by Luminex multiplex assay.
[0031] FIGS. 10A-10G show the capacity of gB-1 specific mouse monoclonal IgG antibodies to inhibit binding of BMPC-23 human IgG antibodies to gB-1. DETAILED DESCRIPTION
[0032] Prophylactic treatment with an anti-respiratory syncytial virus (RSV) F neutralizing monoclonal antibody (mAb), palivizumab, has proven effective in preventing serious complications of RSV infection in high-risk infants and young children and is now licensed and regularly used for this purpose. A commercially available anti-HSV-2 or anti-HSV- 1 antibody treatment would be very useful but has not previously existed. Such a product would be especially useful in immunocompromised patients or premature patients who have an undeveloped immune response.
[0033] Disclosed herein are antibodies, antigen-binding fragments, and nucleic acids encoding the antibodies and antigen-binding fragments. The antibody or antigen-binding fragment bind to a herpes simplex virus-2 (HSV-2) antigen. The antibody or antigen-binding fragment comprises a heavy chain variable region having an amino acid sequence comprising three heavy chain complementarity determining regions (HCDR), a light chain variable region having an amino acid sequence comprising three light chain complementarity determining regions (LCDR), or a combination thereof. The antibody or antigen-binding fragment comprises a heavy chain variable region having an amino acid sequence comprising heavy chain HCDR1, HCDR2, and HCDR3; a light chain variable region having an amino acid sequence comprising light chain LCDR1, LCDR2, and LCDR3; or a combination thereof.
[0034] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYSFTTYD (SEQ ID NO:1), IYPREGST (SEQ ID NO:2), and ATYGSSRYYTMDY (SEQ ID NO:3); and / or a light chain variable region comprising ESVDNFGISF (SEQ ID NO:4), AAS (SEQ ID NO:5), and QQSKEVPLT (SEQ ID NO:6).
[0035] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYSITNGNH (SEQ ID NO:7), IRSSGSS (SEQ ID NO:8), and ARGGGLRHYFDY (SEQ ID NO:9); and / or a light chain variable region comprising GNIHNY (SEQ ID NO:10), HAE (SEQ ID NO:11), and QHFWSTPYT (SEQ ID NO:12).
[0036] An antibody or antigen-binding fragment thereof is provided comprising: a heavy chain variable region comprising GFTFTDYY (SEQ ID NO:13), IRNKANGYTT (SEQ ID NO:14), and ACGNYVGYAMDY (SEQ ID NO:15) and / or a light chain variable region comprising QSLLNSRTRKNY (SEQ ID NO:16), WAS (SEQ ID NO:17), and KQSYNLYT (SEQ ID NO:18).
[0037] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GFSLSRHD (SEQ ID NO:79), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); and / or a light chain variable region comprising QDISSY (SEQ ID NO:82), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84)
[0038] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GFSLNNYD (SEQ ID NO:85), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); and / or a light chain variable region comprising QDINSY (SEQ ID NO:86), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84).
[0039] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFINYD (SEQ ID NO:87), IYPRDGST (SEQ ID NO:88), and ARGIFYVNYDVY (SEQ ID NO:89); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92).
[0040] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising EYEFPSHD (SEQ ID NO:93), INSDGGST (SEQ ID NO:94), and ARHSSGYVLDY (SEQ ID NO:95); and / or a light chain variable region comprising DHINHW (SEQ ID NO:96), GAT (SEQ ID NO:97), and QQYWSTPYT (SEQ ID NO:98).
[0041] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFTNYW (SEQ ID NO:99), IHPNIGIT (SEQ ID NO:100), and ARGSDSGSAWFAY (SEQ ID NO:101); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAT (SEQ ID NO:97), and QQYWSTPLT (SEQ ID NO:102).
[0042] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFTSYW (SEQ ID NO:103), THPNSGIT (SEQ ID NO:104), and ARGSNSGSAWFAY (SEQ ID NO:105); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAT (SEQ ID NO:97), and QQYWSTPLT (SEQ ID NO:102).
[0043] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFTSYW (SEQ ID NO:103), IHPNSGIT (SEQ ID NO:104), and ARGSNSGSAWFAY (SEQ ID NO:105); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92).
[0044] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFTTYG (SEQ ID NO:107), INTYSGVS (SEQ ID NO:108), and AQLNYGMDY. (SEQ ID NO:109); and / or a light chain variable region comprising QDVSTS (SEQ ID NO:110), SAS (SEQ ID NO:111), and HQHYSIPRT (SEQ ID NO:112).
[0045] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYTFTTYG (SEQ ID NO:107), INTYSGVS (SEQ ID NO:108), and AQVNYAMDY (SEQ ID NO:113); and / or a light chain variable region comprising QDVSTA (SEQ ID NO:114), SAS (SEQ ID NO:111), and QQHYSTPRT (SEQ ID NO:115).
[0046] An antibody or antigen-binding fragment is provided comprising: a heavy chain variable region comprising GYSITSGYD (SEQ ID NO:116), ISYSGLT (SEQ ID NO:117), and ARGPPWYFDV (SEQ ID NO:118); a light chain variable region comprising QIVRAT (SEQ ID NO:119), LAS (SEQ ID NO:120), and LQYWNYPYT (SEQ ID NO:121).
[0047] In embodiments, the antibody or antigen-binding fragment thereof is an IgG antibody. In embodiments, the antibody or antigen-binding fragment thereof is an IgG antibody having an IgG2c isotype.
[0048] In embodiments, the antibody or fragment thereof is a humanized antibody.
[0049] In embodiments, the antibody is provided. In embodiments, the antigen-binding fragment is provided. In embodiments, the antigen is a Herpes simplex virus-2 (HSV-2) antigen. For example, the HSV-2 antigen is glycoprotein B (gB).
[0050] In embodiments, the antibody or fragment thereof comprises an Fc region which binds a Fc gamma receptor RII (FcyRIID). In embodiments, the antibody or fragment thereof comprises an Fc region which activates a human FcyRIII when bound thereto. In embodiments, the human FeyRIII receptor is FeyRIIIa,
[0051] In embodiments, the antibody or fragment thereof binds a Fc gamma receptor RIV (EcYRIV).
[0052] In embodiments, the antibody or fragment thereof binds an HSV-2 antigen.
[0053] In embodiments, the framework regions of the light chain and / or the heavy chain are human framework regions, or have 85% or greater identity thereto. In embodiments, the framework regions of the light chain and / or the heavy chain are human framework regions.
[0054] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV1-85, D of IGHD1-1 and JH of IGHJ4. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV1-85, D of IGHD1-1 and JH of IGHJ4. In embodiments, the light chain is derived from germline VL of IGKV3-2 and JL of IGKJ5. In embodiments, the light chain has 95% or more identity to a germline VL of IGKV3-2 and JL of IGK]JS.
[0055] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV3-4, D of IGHD2, and JH of IGHJ4. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV3-4, D of IGHD2, and JH of IGHJ4. In embodiments, the light chain is derived from germline VL of IGKV12-41 and JL of IGKJ2. In embodiments, the light chain has 95% or more identity to a germline VL of IGKV12- 41 and JL of IGKJ2.
[0056] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV7-3, D of IGHD2-1, and JH of IGHJ4. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV7-3, D of IGHD2-1, and JH of IGHJ4. In embodiments, the light chain is derived from germline VL of IGKV8-21 and JL of IGKJ2. In embodiments, the light chain has 95% or more identity to a germline VL of IGKV8-21 and JL of IGKJ2.
[0057] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV2-3, D of IGHD2-1, and JH of IGHJ3. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV2-3, D of IGHD2-1, and JH of IGHJ3. In embodiments, the light chain is derived from germline VL of IGKV14-111 and JL of IGKJS. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV 14-111 and JL of IGKIJS.
[0058] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV1-85, D of IGHD2-1, and JH of IGHJ3. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV1-85, D of IGHD2-1, and JH of IGHJ3. In embodiments, the light chain is derived from germline VL of IGKV13-85 and JL of IGKJ5. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV 13-85 and JL. of IGK]JS.
[0059] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHVS-2, D of IGHD3-2, and JH of IGHJ4. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHVS-2, D of IGHD3-2, and JH of IGHJ4. In embodiments, the light chain is derived from germline VL of IGKV13-85 and JL of IGKJ2. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV 13-85 and JL of IGKJ2.
[0060] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV1-64, D of IGHD3-2, and JH of IGHJ3. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV 1-64, D of IGHD3-2, and JH of IGHJ3. In embodiments, the light chain is derived from germline VL of IGKV13-85 and JL of IGKJS. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV 13-85 and JL of IGKJS.
[0061] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV9-3, D of IGHD2-12, and JH of IGHJ4. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV9-3, D of IGHD2-12, and JH of IGHJ4. In embodiments, the light chain is derived from germline VL of IGKV6-17 and JL of IGKJ1. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV6-17 and JL of IGKJ1.
[0062] In embodiments, the heavy chain V(D)J rearrangement is derived from germline VH of IGHV3-1, D of IGHD6-3, and JH of IGHJ1. In embodiments, the heavy chain V(D)J rearrangement has 95% or more identity to a germline VH of IGHV3-1, D of IGHD6-3, and JH of IGHJ1. In embodiments, the light chain is derived from germline VL of IGKV6-14 and JL of IGKJ2. In embodiments, the light chain has 95% or more identity to a germline VL of VL of IGKV6-14 and JL of IGKJ2.
[0063] Also provided is a pharmaceutical composition comprising an effective amount of the antibody or antigen-binding fragment described herein and a pharmaceutically acceptable carrier or excipient. In embodiments, the pharmaceutical composition further comprises an anti- viral small molecule drug. The anti-viral small molecule comprises famcyclovir, penciclovir, valacyclovir, or a combination thereof. In embodiments, the small molecule anti-viral drug is acyclovir.
[0064] The following are exemplary nucleotide sequences and amino acid sequences of anti-HSV antibodies. The corresponding heavy chain or light chain CDRs (e.g., HCDRI, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3) are underlined in consecutive order. A summary of the nucleotide sequences and amino acid sequences, including the corresponding HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 of the exemplary anti-HSV antibodies, is provided in Table 4.
[0065] BMPC-23_IgH Nucleotide: caggttcagctgcageagtctggacctgagetggtgaageetggggcttcagtgaagttgtectgeaaggettetggetacagtttcacaac ctacgatataaactgggtgaaggagaggectggacagggacttgagtggattgggtggatttatcctagagagggtagtacgaattacaatg agaagttcaggggcaaggeeacattgactgeagacacatectccagtacagegtacatggagetceacagectgacatctgaggactctg cggtctatttctgtgeaacctacggtagtagtegctactatactatggactactggggtcaaggaacctcagteacegtetectcagee (SEQ ID NO:19) Amino acid: QVQLQQSGPELVKPGASVKLSCKASGYSFTTYDINWVKERPGQGLEWIGWIYPREGSTN YNEKFRGKATLTADTSSSTAYMELHSLTSEDSAVYFCATYGSSRYYTMDYWGQGTSVT VSSA (SEQ ID NO:20)
[0066] BMPC-23_IgL Nucleotide gacattgtgctgacceaatctceaacttetttggetgtgtetetagggeagagggecaccatctcetgecagagecagegaaagtgttgataatt ttggeattagtittatgaactggttccagcagaaaccaggacageeacceaaactecteatetacgetgeatecaacctaggateeggggtee ctgecaggtitagtggeagtgggtetgggacagacttcagectcaacateeatectatggaggatgatgatactgeaatgtatttetgtcagea aagtaaggaggttccgeteacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO:21) Amino Acid: DIVLTQSPTSLAVSLGQRATISCRASES VDNFGISFMNWFQQKPGQPPKLLIYAASNLGSG VPARFSGSGSGTDFSLNIHPMEDDDTAMYFCQOSKEVPLTFGAGTKLELKR (SEQ ID NO:22)
[0067] 22D10_IgH Nucleotide gatgtacagcttcaggagtcaggacctgeectggtgaagectictcagacagtgteecteacctgeactgteactggetactctatcactaatg gtaatcattggtggaactggatccggeaggtitcaggaageaaactggagtggttagggtacataaggtecagtogtagetetgacageaat ccatctctcaaaagtegaatctccatcactagagacacttccaagaaccagttattcetgeacttgaactctatgactactgaagatatagecac atattactgtgcaagaggggggepattacggcactactttgactactggggecaaggeaccactcteacagtetectcagee (SEQ ID NO:23) Amino acid: DVQLQESGPALVKPSQTVSLTCTVTGYSITNGNHWWNWIRQVSGSKLEWLGYIRSSGSS DSNPSLKSRISITRDTSKNQLFLHLNSMTTEDIATYYCARGGGLRHYFDYWGQGTTLTVS SA (SEQ ID NO:24)
[0068] 22D10_IgL Nucleotide gacatccagatgactcagtctecagectecctatetgeatctgtgggagatactgteaccatcacatgtcgageaagtgggaatattcacaatt atttagcatggtatcaccagaaacagggaaaatctcctcaactcetggtetatcatgeagaaaccttaacagatggtgtgecatcaaggttcag tggcagtggatcaggaacacaatattctctcaagatcaacagectgeagectgaagattttgggagttattactgtcaacatttttggagtacte cgtacacattcggaggggggaccaagetggaaataaaacgg (SEQ ID NO:25) Amino acid: DIQMTQSPASLSASVGDTVTITCRASGNIHNYLAWYHQKQGKSPQLLVYHAETLTDGVP SRESGSGSGTQYSLKINSLQPEDFGSY YCQHFWSTPYTFGGGTKLEIKR (SEQ ID NO:26)
[0069] 33B8_IgH Nucleotide gaggtgaagetggtggagtetggaggaggcttggtacagectgggggttctetgagteteteetgtgeaacttctggattcacctteactgatt actacatgaactgggteegecagectccagggaaggeacttgagtggtigggttttattagaaacaaagetaatggttacacaacagagtac agtgcatctgtgaagggteggttcaccatctccagagataattcecaaageatcctetatcettcaaatgaattcectgagagetgaggacagtg ccacttattactgtgettgtggtaactacgtaggctatgetatggactactggggtcaaggaaccteagteacegtetectcagee (SEQ ID NO:27) Amino acid: EVKLVESGGGLVQPGGSLSLSCATSGFTFTDYYMNWVRQPPGKALEWLGFIRNKANGY TTEYSASVKGRFTISRDNSQSILYLQMNSLRAEDSATYYCACGNYVGYAMDYWGQGTS VTVSSA (SEQ ID NO:28)
[0070] 33B8_IgL Nucleotide gacattgtgatgtcacagtctccatecteectggetgtgtcageaggagagaaggtcactatgagetgcaaatccagtcagagtetgctcaac agtagaacccgaaagaactacttggcttggtaccagcagaaaccagggeagtetcctaaactgetgatetactgggcatceactagggaat ctggggteectgatcgettcacaggeagtggatctgggacagatttcactctcaccatcageagtgtgeaggetgaagacctggeagtttatt actgcaageaatcttataatctgtacacgttcggaggggggaccaagetggaaataaaacgg (SEQ ID NO:29) Amino acid: DIVMSQSPSSLAVSAGEKVTMSCKSSQSLINSRTRKNYLAWYQQKPGQSPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKR (SEQ ID NO:30)
[0071] HSV010-4_IgH Nucleotide caggtgeagetgaaggagtcaggacctggeetggtggegeectcacagagectgtecateacatgeactgtetcagggtteteattaagea gacatgatgtaagcetgggttcgecagectccaggaaagggtetggagtggetgggagtaatatggggtgacgggageacaaattatcatte agctctcatatccagactgageatcagcaaagataactccaagagecaagttttcttaaaactgaacagtctgcaaaatgatgacacagecac gtactactgtgccaaagaagactatggtatttttccttactggggecaagggactetggteactgtetetgeagee (SEQ ID NO:31) Amino Acid QVQLKESGPGLVAPSQSLSITCTVSGFSLSRHDVSWVRQPPGKGLEWLGVIWGDGSTNY HSALISRLSISKDNSKSQVFLKLNSLQNDDTATYYCAKEDYGIFPYWGQGTLVTVSAA (SEQ ID NO: 32)
[0072] HSV010-4_IgL Nucleotide gacatcaagatgacccagtctccatcttccatgtatgeatctctaggagagaaagtcactatcacttgcaaggegagtcaggacattagtage tatttaagctggttccageagaaaccagggaaatetectaagacectgatctategtgeaaacagattggtagatggggteccatcaaggtte agtggcagtggatetgggeaagattattctetetecatcageagectggactatgaagatatgggaatttattattgtetacagtatgatgagttt cegeteacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO: 33) Amino Acid DIKMTQSPSSMYASLGEKVTITCKASODISSYLSWFQQKPGKSPKTLIYRANRLVDGVPS RESGSGSGQDYSLSISSLDYEDMGIYYCLOQYDEFPLTFGAGTKLELKR (SEQ ID NO: 34)
[0073] HSV010-7_IgH Nucleotide caggttcagetgeageagtetggacctgagetggtgaageetggggettcagtgaagtigtectgeaaggcttctggctacaccttcacaaa ctacgatataaactgggtgaagcagaggcectggacagggacttgagtggattggatggatttatcctagagatggtageactaaatacaatg agaaattcaagggcaaggceacattgactattgacacatcetccageacagegtacatggagetceacagectgacatctgaggactetge ggtctatttctgtgeaagagggatcttctatgttaactacgacgtttactggggccaagggactctggteactgtetetgeagee (SEQ ID NO: 35) Amino Acid QVQLQQSGPELVKPGASVKLSCKASGYTETNYDINWVKQRPGQGLEWIGWIYPRDGST KYNEKFKGKATLTIDTSSSTAYMELHSLTSEDSAVYFCARGIFYVNYDVYWGQGTLVT VSAA (SEQ ID NO: 36)
[0074] HSV010-7_IgL Nucleotide gacatccagatgacacaatcttcatecttettgtetgtatetctaggaggeagagteaccattacttgcaaggeaagtgaccacattaataattg. gttagectggtatcagcagaaaccaggacatgetectaggetettaatatctggtgeageeagtttggaaactggggttecttcaagattcagt ggcagtggatctggaaaggattacactctcaccattaccagtcttcagactgaagatgttgctacttattactgtcaacagtattggagtagtec geteacgtteggtggtgggaccaagetggagetgaaacgg (SEQ ID NO: 37) Amino Acid DIQMTQSSSFLSVSLGGRVTITCKASDHINNWLAWY QQKPGHAPRLLISGAASLETGVPS RESGSGSGKDYTLTITSLQTEDVATYYCQQYWSSPLTFGGGTKLELKR (SEQ ID NO: 38)
[0075] HSV010-34_IgH Nucleotide gaggtgeagetggtggagtetgggggaggcettagtgeagectggagagtecetgaaactetectgtgaatecaatgaatacgaatteectte ccatgacatgtcttgggtecgcaagactccggagaagaggetggagttggtegeagecattaatagtgatggtgptageacctactatceag acaccatggagagacgattcatcatctccagagacaataccaagaagaccctgtacctgeaaatgageagtetgaggtctgaggacacag ccttgtattactgtgeaagacatagetcaggetatgttttggactactggggtcaaggaacctcagteaccegtetectcagee (SEQ ID NO: 39) Amino Acid EVQLVESGGGLVQPGESLKLSCESNEYEFPSHDMSWVRKTPEKRLELVAAINSDGGSTY YPDTMERRFISRDNTKKTLYLQMSSLRSEDTALYYCARHSSGYVLDYWGQGTSVTVSS A (SEQ ID NO: 40)
[0076] HSV010-34_IgL Nucleotide gacatccagatgacacaatcttcatcctacttgtetgtatctctaggaggeagagteaccattacttgcaaggeaagtgaccacattaatcattg gitagectggtatcagcagaaaccaggaaatgetectaggetettaatatctggtecaaccagtttggaaactggggttecttcaagattcagt gecagtggatctggaaaggattacactctcageattgecagtettcagactgaagatgttgetacttattactgtcaacagtattggagtactee gtacacgttcggaggggggaccaagetggaaataaaacgg (SEQ ID NO: 41) Amino Acid DIQMTQSSSYLSVSLGGRVTITCKASDHINHWILAWYQQKPGNAPRLLISGATSLETGVPS RESGSGSGKDYTLSIASLQTEDVATYYCQOYWSTPYTFGGGTKLEIKR (SEQ ID NO: 42)
[0077] HSVO010-6_IgH Nucleotide caggtccaactgeageagectggggctgagetggtaaagectggggcttcagtgaagttgtectgeaaggcttctggetacactttcaccaa ctactggatacactgggtgaagcagaggectggacaaggecttgagtggattggaatgattcatcctaatattggtattactcactacagtga gaggttcaagagcaaggccacactgactgtagacaaatcetccaccacagectacatgeaactcageagectgacatctgaggactetge ggtctattactgtgeaagagggteggacteaggeteegectggttgettactggggecaagggactetggteactgtetetgeagee (SEQ ID NO: 43) Amino Acid QVQLQQPGAELVKPGASVKLSCKASGYTFTNYWIHW VKQRPGQGLEWIGMIHPNIGIT HYSERFKSKATLTVDKSSTTAYMQLSSLTSEDSAVYYCARGSDSGSAWFAYWGQGTLV TVSAA (SEQ ID NO: 44)
[0078] HSV010-6_IgL Nucleotide Gacatccagatgacacaatcttcatcctacttgtetgtttctctaggaggeagagtcaccattacttgeaaggcaagtgaccacattaataattg gttageetggtatetgeagaaaccaggaaatgetectagactettaatgtetggtgcaaccagtttggaaactggggttecttcaagattcagt ggcagtggatctggaaaggattacactetcageattaccagtcttcagactgaagatgttgetacttattactgtcaacagtattggagtactee getcacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO: 45) Amino Acid DIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYLQKPGNAPRLLMSGATSLETGVP SRFESGSGSGKDYTLSITSLQTEDVATYYCQOYWSTPLTFGAGTKLELKR (SEQ ID NO: 46)
[0079] HSV010-9_IgH Nucleotide caggtccaactgeageagectggggctgagttggtaaagectggggettcagtgaagttgtectgcaagtettctggetacactttcaccage tactggatgcactgggtgaageagaggectggacaaggecttgagtggattggaatgattcatcctaatagtggtattactcactacaatgag aagttcaagaccaaggccacactgactgtagacaaatcctccageacagectacatgeaactcageagectgacatetgaggactetgegg tetettactgtgeaagaggptegaactcaggeteegectggtttcttactggggecaagggactetggteactgtetetgeagee (SEQ ID NO: 47) Amino Acid QVQLQQPGAELVKPGASVKLSCKSSGYTFTSYWMHWVKQRPGQGLEWIGMIHPNSGIT HYNEKFKTKATLTVDKSSSTAYMQLSSLTSEDSAVSYCARGSNSGSAWFAYWGQGTLV TVSAA (SEQ ID NO: 48)
[0080] HSV010-9_IgL Nucleotide Gacatccagatgacacaatcttcatcctacttgtctgtatctctaggaggeagagtcaccattacttgcaaggcaagtgaccacattaataatt ggttagectggtatcagcagaaaccaggaaatgetcctaggctcttaatatetggtgeaaccagtttggaaactggggttccttcaagattcag tggcagtggatctggaaaggattacactctcageattaccagtcttcagactgaagatgttgctacttattactgtcaacagtattggagtactee getcacgtteggtgetgggaccaagetggagetgaaacgg (SEQ ID NO: 49) Amino Acid DIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPS RESGSGSGKDYTLSITSLQTEDVATYYCQQYWSTPLTFGAGTKLELKR (SEQ ID NO: 50)
[0081] HSVO010-13_IgH Nucleotide caggtccaactgeageagectggggctgagetggtaaagectggggettcagtgaagttgtectgeaaggcttctggetacactttcaccag ctactggatacactgggtgaagcaggggectggacaaggectigagtggattggaatgattcatcctaatagtggtattactcactacaatga gaagttcaagaccaaggccacactgactgtagacaaatcetccageacagectacatgeaactcageagectgacatctgaggactetgeg gtctgttactgtgcaagagggtegagetcaggetecgectggtttgettactggggccaagggactetggteactgtctetgeagee (SEQ ID NO: 51) Amino Acid QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWIHWVKQGPGQGLEWIGMIHPNSGIT HYNEKFKTKATLTVDKSSSTAYMQLSSLTSEDSAVCYCARGSSSGSAWFAYWGQGTLV TVSAA (SEQ ID NO: 52)
[0082] HSV010-13_IgL Nucleotide gacatccagatgacacaatcttcatcctacttgtctgaatctctaggaggeagagtcaccattacttgeaaggcaagtgaccacattaataattg gitageetggtatcageagaaaccaggaaatgeteecaggetcttaatatetggtgeaaccagtttggaaactggggttecttcaagattcagt ggcagtggatctggaaaggattacactetcageattaccagtcttcagactgaagatgttgetacttattactgtcaacagtattggagtagtee geteacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO: 53) Amino Acid DIQMTQSSSYLSESLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPS RESGSGSGKDYTLSITSLQTEDVATYYCQOYWSSPLTFGAGTKLELKR (SEQ ID NO: 54)
[0083] HSV010-14_IgH Nucleotide caggtccaactgeageagectggggcetgagetggtaaageetggggettcagtgaagttgtectgeaaggctictggetacactttcaccag ctactggatacactgggtgaagcagaggcctggecaaggecttgagtggattggaatgattcatcctaatagtggtattgetcactacagtga gaagttcaagagcacggecacactgactgtagacaaatcctccageacagectacatgeaactcageagectgacatetgaggactettcg gtctattactgtgcaagagggtcgagetcaggeteegectggtttgettattggggccaagggactctggtcactgtetetgeagee (SEQ ID NO: 55) Amino Acid QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWIHW VKQRPGQGLEWIGMIHPNSGIA HYSEKFKSTATLTVDKSSSTAYMQLSSLTSEDSSVYYCARGSSSGSAWFAYWGQGTLV TVSAA (SEQ ID NO: 56)
[0084] HSV010-14_IgL Nucleotide gacatccagatgacacaatcttcatcetacttgtetgtttctctaggaggeagagtcaccattacttgcaaggeaggtgaccacattaataattg. gttageetggtatcagcagaaaccaggaaatgetectaggetcttaatatetggtgeaaccagtitggaaactggggttecttcaagattcagt ggcagtggatctggaaaggattacactetcageattaccagtcttcagactgaagatgttgetacttattactgtcaacagtattggagtactee getcacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO: 57) Amino Acid DIQMTQSSSYLSVSLGGRVTITCKAGDHINNWLAWYQQKPGNAPRLLISGATSLETGVP SRFSGSGSGKDYTLSITSLQTEDVATYYCQOYWSTPLTFGAGTKLELKR (SEQ ID NO: 58)
[0085] HSV010-28_IgH Nucleotide cagatccagttggtacagtctggacctgagetgaagaagectggagagacagtcaagatctectgeaaggettctgggtataccttcacaac ctatggaatgagetgggtgaaacaggetccaggaaagggtitaaagtggatggectggataaacacctactetggagtgteaacatatgetg atgacttcaagggacggtttgecttetctttggaaacctetgecageactgectatttgecagatcaacaacctcaaaaatgaggacacggetac atatttetgtgetcaggtaaactatgetatgpactactggggtcaaggaaccteagteacegtetectcagee (SEQ ID NO: 59) Amino Acid QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGLKWMGWINTYSGVS TYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCAQVNY AMDYWGQGTSVTVSS A (SEQ ID NO: 60)
[0086] HSV010-28_IgL Nucleotide gacattgtgatgacccagtctcacaaattcttgtccacatcagtaggagactgggtcaccatcacctgeaaggecagtcaggatgtgagtact getgtagectggtttcagecagaaaccaggacaatctcctaaagtactgatttactcggeatectaceggtacactggagtcectgategettca ctggeagtggatctgggacggatttcactttcaccatcageagtgtgeaggcetgaagacctggeagtttattactgtcageaacattatagtac tecteggacgtteggtggaggeaccaagetggaaatcaaacgg (SEQ ID NO: 61) Amino Acid DIVMTQSHKFLSTSVGDWVTITCKASQDVSTAVAWFQQKPGQSPKVLIYSASYRYTGVP DRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPRTFGGGTKLEIKR (SEQ ID NO: 62)
[0087] HSV010-20_IgH Nucleotide gatgtgcagcettcaggagtcaggacctggeatggtgagaccttctcagteactttccctcacctgeactgteactggetactceatcaceagtg gtatgactggeactggatcegacattticcaggaaacaaactggagtggatgggetacataagetacagtggteteactaactacaacceat ccetcagaagtcgattctecatcactcatgacacatctaagaaccatttettcctgaagttgaattetgtgactactgaggacacagecacatatt actgtgcaagaggtectecctggtacttegatgtetggggcacagggaccacggtcaccgtetectcagee (SEQ ID NO: 63) Amino Acid DVQLQESGPGMVRPSQSLSLTCTVTGYSITSGYDWHWIRHFPGNKLEWMGYISYSGLTN YNPSLRSRFSITHDTSKNHFFLKLNSVTTEDTATYYCARGPPWYFDVWGTGTTVTVSSA (SEQ ID NO: 64)
[0088] HSV010-20_IgL Nucleotide gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggaggcagggteageatcacctgeaaggecagtcagattgttegtget actgtagectggtatcaacagaaaccagggeagtetectaaaccactaatttacttggeatccaaceggeacactggagtecctgategette acaggcagtggatctgggacagatttcactctcaccattageaatgtgeaatctgaagacctggeagattatttetgtetgeaatattggaattat cegtacacgttcggaggggggaccaagetggaaataaaacgg (SEQ ID NO: 65) Amino Acid DIVMTQSQKFMSTSVGGRVSITCKASQIVRATVAWYQQKPGQSPKPLIYLASNRHTGVP DRFTGSGSGTDFTLTISNVQSEDLADYFCLOYWNYPYTFGGGTKLEIKR (SEQ ID NO: 66)
[0089] HSVO010-8_IgH Nucleotide caggtgcagetgaaggagtcaggacctggeetggtggegeectcacagagectgtegatcacatgeactgtetcagggtteteattaaaca actatgatgtaagctgggttcgecagectccaggaaagggtetggagtggetgggagtaatatgggateacgggagcacaaattatcattc agctctcatatccagactgagcatcagcaaggataactccaagagccaagttttcttaaaactgaacagtctgcaaactgatgacacageca cgtactactgtgccaaagaagactatggtatttttccttactggggccaagggactetggtcactgtetetgecagee (SEQ ID NO: 67) Amino Acid QVQLKESGPGLVAPSQSLSITCTVSGFSLNNYDVSWVRQPPGKGLEWLGVIWGDGSTN YHSALISRLSISKDNSKSQVFLKLNSLQTDDTATY YCAKEDYGIFPYWGQGTLVTVSAA (SEQ ID NO: 68)
[0090] HSV010-8_IgL Nucleotide gacatcaagatgacccagtctccatcttceatgtatgeatctctaggagagagagteactatcacttgeaaggegagtcaggacattaatage tatttaagetggttccageagaaaccagggaaatetectaagacectgatetategtgeaaacagattggtagatggggteecatcaaggttc agtggeagtggatetgggeaagattattctetcaccatcageagectggaatatgaaaatatgggaatttattattgtetacagtatgatgagttt cegeteacgtteggtgctgggaccaagetggagetgaaacgg (SEQ ID NO: 69) Amino Acid DIKMTQSPSSMYASLGERVTITCKASQDINSYL SWFQQKPGKSPKTLIYRANRLVDGVPS RESGSGSGQDYSLTISSLEYENMGIYYCLOYDEFPLTFGAGTKLELKR (SEQ ID NO: 70)
[0091] HSV010-15_IgH Nucleotide caggtccaactgcageagectggggetgagetggtaaageetggggcttcagtgaagttgtectgeaaggettctggetacactttcaccag ctactggatacactgggtgcageagaggectggacaaggecttgagtggattggaatgatteatectaatagtggtattactaactacagtga gaagttcaagagcaaggeeacactgactttagacaagtcctccageacagectacatgeaacteatcagectgacatctgaggactetgeg gtctattactgtgeaagagpgtegagttcagectecgectggtttgettactggggccaagggactcetggteactgtetetgeagee (SEQ ID NO: 71) Amino Acid QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWIHWVQQRPGQGLEWIGMIHPNSGIT NYSEKFKSKATLTLDKSSSTAYMQLISLTSEDSAVYYCARGSSSGSAWFAYWGQGTLVT VSAA (SEQ ID NO: 72)
[0092] HSVO010-15_IgL Nucleotide gacatccagatgacacaatcttcatcetacttgtetgtttctctaggaggeagagteaccattacttgcaaggeaagtgaccacattaataattg gttaccttggtatcagcagaaaccaggaaatgetectaggetettaatttctggtgeaaccagtttggaaactggggttccttcaagattcagtg geagtggatctggaaaggattacactctcagcattaccagtcttcagactgaagatgttgetacttattactgtcaacagtattggagttctecge teacgttcggtgetgggaccaagetggagetgaaacgg (SEQ ID NO: 3) Amino Acid DIQMTQSSSYLSVSLGGRVTITCKASDHINNWLPWYQQKPGNAPRLLISGATSLETGVPS RESGSGSGKDYTLSITSLQTEDVATYYCQQYWSSPLTFGAGTKLELKR (SEQ ID NO: 74)
[0093] HSVO010-16_IgH Nucleotide cagatccagttggtacagtctggacctgagetgaagaagectggagagacagtcaagatctectgcaaggettetgggtatacettcacaac ctatggaatgagctgggtgaaacaggetccaggaaaggatttaaagtggatgggetggataaacacetactetggagtgtcaacatatggtg atgacttcaagggacggtitgeetigtetttggaaacctetgecageactgectatttacaaatcaacaacctcaaaaatgaggacacggetac atatttctgtgetcagttaaactatggtatggactactggggtcaaggaacctcagtcaccgtetectcagee (SEQ ID NO: 75) Amino Acid QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKDLKWMGWINTYSGVS TYGDDFKGRFALSLETSASTAYLQINNLKNEDTATYFCAQLNYGMDYWGQGTSVTVSS A (SEQ ID NO: 76)
[0094] HSV010-16_IgL Nucleotide gacattgtgatgacceagtctcacaaattcatgtceacatcagtaggagacagggtecageatcacctgeaaggeeagtcaggatgtgagtac ttetttagectggtatcaacagaaaccaggacaatetcctaaactactgatttatteggeatectaccggtacactggagteectgategettea ctggeagtggatctgggacggatttcactttcaccatcageagtgtgeaggetgaagacctggeagtttattactgteaccaacattatagtatt ceteggacgttcggtggaggeaccaagetggaaatcaaacgg (SEQ ID NO: 77) Amino Acid DIVMTQSHKFMSTSVGDRVSITCKASQDVSTSLAWYQQKPGQSPKLLIYSASYRYTGVP DRFTGSGSGTDFTFTISSVQAEDLAVYYCHOHYSIPRTFGGGTKLEIKR (SEQ ID NO: 78)
[0095] In embodiments, an antibody is provided having the heavy chain HCDRI, HCDR2, and HCDR3 of one of the heavy chain amino acid sequences listed above and a light chain LCDR1, LCDR2, and LCDR3 of any one of the light chain amino acid sequences listed above. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDRI, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of BMPC-23. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of 33B8. In embodiments, both the heavy chain HCDR1, HCDR2 and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of 22D10. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-4. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-8. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-7. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-34. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-6. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSC010-9. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-13. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-14. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-15. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-16. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-28. In embodiments, both the heavy chain HCDR1, HCDR2, and HCDR3 and the light chain LCDR1, LCDR2, and LCDR3 are the same as the heavy chain HCDRs and light chains LCDRs of HSV010-20.
[0096] Provided is a nucleic acid encoding an antibody or an antigen-binding fragment thereof. Provided also is an isolated nucleic acid molecule encoding the antibody or antigen- binding fragment.
[0097] In embodiments, provided is a nucleic acid encoding a light chain of an antibody. In particular, the nucleic acid encodes a light chain variable region of an antibody. The light chain is a lambda chain or a kappa chain. In embodiments, the nucleic acid also encodes a human framework region. The nucleic acid may be an isolated nucleic acid molecule.
[0098] In embodiments, the nucleic acid encodes a light chain variable region of an antibody having a nucleic acid sequence which comprises: SEQ ID NO:21, SEQ ID NO:25, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:69, SEQ ID NO:37, SEQ ID NO:41, SEQ ID NO:45, SEQ ID NO:49, SEQ ID NO:53, SEQ ID NO:57, SEQ ID NO:73, SEQ ID NO:77, SEQ ID NO:61, or SEQ ID NO:66. In embodiments, the nucleic acid encodes a light chain variable region of an antibody, wherein the light chain has a nucleic acid sequence having 95% or more identity to SEQ ID NO:21, SEQ ID NO:25, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:69, SEQ ID NO:37, SEQ ID NO:41, SEQ ID NO:45, SEQ ID NO:49, SEQ ID NO:53, SEQ ID NO:57, SEQ ID NO:73, SEQ ID NO:77, SEQ ID NO:61, or SEQ ID NO:66.
[0099] In embodiments, the nucleic acid encodes a light chain variable region of an antibody having an amino acid sequence which comprises (LCDR1, LCDR2, and LCDR3 listed in respective order): ESVDNEFGISF (SEQ ID NO:4); AAS (SEQ ID NO:5); and QQSKEVPLT (SEQ ID NO:6), or GNIHNY (SEQ ID NO:10); HAE (SEQ ID NO:11); and QHFWSTPYT (SEQ ID NO:12), or QSLLNSRTRKNY (SEQ ID NO:16); WAS (SEQ ID NO:17); and KQSYNLYT (SEQ ID NO:18) or QDISSY (SEQ ID NO:82); RAN (SEQ ID NO:83); and LQYDEFPLT (SEQ ID NO:84) or QDINSY (SEQ ID NO:86); RAN (SEQ ID NO:83); and LQYDEFPLT (SEQ ID NO:84) or DHINNW (SEQ ID NO:90); GAA (SEQ ID NO:91); and QQYWSSPLT (SEQ ID N0:92) or DHINHW (SEQ ID NO:96) GAT (SEQ ID NO:97) QQYWSTPYT (SEQ ID NO:98) or DHINNW (SEQ ID NO:90); GAT (SEQ ID NO:97); and QQYWSTPLT (SEQ ID NO:102) or DHINNW (SEQ ID NO:90); GAT (SEQ ID NO:97); and QQYWSSPLT (SEQ ID NO:92) or QDVSTS (SEQ ID NO:110); SAS (SEQ ID NO:111); and HQHYSIPRT (SEQ ID NO:112) or QDVSTA (SEQ ID NO:114); SAS (SEQ ID NO:111); and QQHYSTPRT (SEQ ID NO:115) or QIVRAT (SEQ ID NO:119); LAS (SEQ ID NO:120); and LQYWNYPYT (SEQ ID NO:122).
[00100] In embodiments, the nucleic acid also encodes a human framework region. In embodiments, the light chain is a lambda chain or a kappa chain.
[00101] Provided is a nucleic acid encoding a heavy chain of an antibody. In particular, the nucleic acid encodes a light chain variable region of an antibody. In embodiments, the nucleic acid also encodes a human framework region. The nucleic acid may be an isolated nucleic acid molecule.
[00102] In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody, wherein the heavy chain has a nucleic acid sequence which comprises: SEQ ID NO:19, SEQ ID NO:23, SEQ ID NO:27, SEQ ID NO:31, SEQ ID NO:67, SEQ ID NO:35, SEQ ID NO:39, SEQ ID NO:43, SEQ ID NO:47, SEQ ID NO:51, SEQ ID NO:55, SEQ ID NO:71, SEQ ID NO:75, SEQ ID NO:59, or SEQ ID NO:63. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody, wherein the heavy chain has a nucleic acid sequence having 95% or more identity to SEQ ID NO:19, SEQ ID NO:23, SEQ ID NO:27, SEQ ID NO:31, SEQ ID NO:67, SEQ ID NO:35, SEQ ID NO:39, SEQ ID NO:43, SEQ ID NO:47, SEQ ID NO:51, SEQ ID NO:55, SEQ ID NO:71, SEQ ID NO:75, SEQ ID NO:59, or SEQ ID NO:63.
[00103] In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having an amino acid sequence which comprises (HCDR1, HCDR2, and HCDR3 listed in respective order): GYSFTTYD (SEQ ID NO:1); IYPREGST (SEQ ID NO:2); and ATYGSSRYYTMDY (SEQ ID NO:3) or GYSITNGNH (SEQ ID NO:7), IRSSGSS (SEQ ID NO:8); and ARGGGLRHYFDY (SEQ ID NO:9), or GFTFTDYY (SEQ ID NO:13); IRNKANGYTT (SEQ ID NO:14); and ACGNYVGYAMDY (SEQ ID NO:15) or GFSLSRHD (SEQ ID NO:79); IWGDGST (SEQ ID NO:80); and AKEDYGIFPY (SEQ ID NO:81) or GFSLNNYD (SEQ ID NO:85); IWGDGST (SEQ ID NO:80); and AKEDYGIFPY (SEQ ID NO:81) or GYTFTNYD (SEQ ID NO:87); IYPRDGST (SEQ ID NO:88); and ARGIFYVNYDVY (SEQ ID NO:89) or EYEFPSHD (SEQ ID NO:93); INSDGGST (SEQ ID NO:94); and ARHSSGYVLDY (SEQ ID NO:95) or GYTFTNYW (SEQ ID NO:99); IHPNIGIT (SEQ ID NO:100); and ARGSDSGSAWFAY (SEQ ID NO:101) or GYTFTSYW (SEQ ID NO:103); IHPNSGIT (SEQ ID NO:104); and ARGSNSGSAWFAY (SEQ ID NO:105) or GYTFTTYG (SEQ ID NO:107); INTYSGVS (SEQ ID NO:108); and AQLNYGMDY (SEQ ID NO:109) or GYTFTTYG (SEQ ID NO:107); INTYSGVS (SEQ ID NO:108); and AQVNYAMDY (SEQ ID NO:113) or GYSITSGYD (SEQ ID NO:116); ISYSGLT (SEQ ID NO:117); and ARGPPWYFDV (SEQ ID NO:118).
[00104] In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:19 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:21. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:23 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:25. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:27 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:29. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:31 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:33. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:67 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:69. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:35 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:37. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:39 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:41. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:43 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:45. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:47 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:49. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:51 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:53. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:55 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:57. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:71 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:73. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:75 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:77. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:59 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:61. In embodiments, the nucleic acid encodes a heavy chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:63 and a light chain variable region of an antibody having a nucleic acid sequence of SEQ ID NO:65.
[00105] In embodiments, the nucleic acid also encodes a human Fc region. In embodiments, the nucleic acid also encodes a human Fc region which binds to FcyRIIL In embodiments, the antibody or antigen-binding fragment comprises an Fc region which activates a human FcyRIII when bound thereto. In embodiments, the human FcyRIII receptor is FcyRIIIa. In embodiments, the heavy chain is a gamma chain.
[00106] In embodiments, a nucleic acid of the disclosure encodes a polypeptide which is less than 500 amino acids in length, which is less than 250 amino acids in length, or which is less than 120 amino acids in length. In embodiments, a nucleic acid of the disclosure encodes a polypeptide which is 70 to 100 amino acids in length.
[00107] In embodiments of the nucleic acids, the nucleic acid is a DNA. In embodiments, the nucleic acid is a cDNA. In embodiments, the nucleic acid is an RNA.
[00108] Nucleic acids disclosed herein are suitable for recombinant production of the antibodies or antigen-binding fragments disclosed herein. Thus, the invention also relates to vectors and host cells containing a nucleic acid sequence encoding the antibody or antigen- binding fragment.
[00109] A vector encoding a nucleic acid molecule described herein is provided. A host cell comprising one or more of the nucleic acids described herein, or the vector described herein, is also provided.
[00110] The antibody or antigen-binding fragment may be linked, or conjugated, to a heterologous molecule. The heterologous molecule may be a therapeutic agent such as a cytotoxic drug, a radioactive isotope, an immunomodulator, a second antibody, an anti-viral small molecule, or a combination thereof. In embodiments, the antibody or antigen-binding fragment, may be linked, or conjugated, to a therapeutic agent.
[00111] A method of inhibiting HSV-2 activity in a subject comprises administering an antibody or antigen-binding fragment in an amount effective to inhibit HSV-2 activity in the subject. The antibody or antigen-binding fragment can inhibit HSV-2 activity in a subject by clearing the virus from the subject, preventing dissemination of the HSV-2 in the subject, preventing the establishment of latency in the subject, and / or preventing infection of the subject with HSV-2.
[00112] In embodiments, the subject is infected with HSV-2. In embodiments, the subject is not yet infected with HSV-2. In embodiments, the subject is immunocompromised. In embodiments the immunocompromised patient has cancer, has undergone a transplant or is on an immunosuppressive medication. In embodiments, the subject is pregnant. In embodiments, the subject is a neonate.
[00113] In embodiments, the subject is receiving or has received an anti-viral therapy. The anti-viral therapy comprises administration of an anti-viral small molecule to the subject. The anti-viral small molecule comprises famcyclovir, penciclovir, valacyclovir, or a combination thereof. In embodiments, the anti-viral therapy comprises administration of the acyclovir to the subject.
[00114] A method of activating antibody-dependent cell cytotoxicity (ADCC) of a cell infected with HSV-2 comprises contacting the cell with an isolated antibody or antigen-binding fragment in an amount which effects ADCC of the cell.
[00115] In embodiments, the cell is in a subject is infected with HSV-2.
[00116] An antibody or antigen-binding fragment described herein, or a pharmaceutical composition comprising the antibody or antigen-binding fragment, for use in the treatment or prevention of a disease or condition that is associated with herpes simplex virus-2 (HSV-2) infection in a subject, is provided.
[00117] Use of an effective amount of an antibody or antigen-binding fragment described herein for the manufacture of a medicament for treating or preventing a disease or condition that is associated with an HSV-2 infection in a subject.
[00118] The antibody or antibodies described herein may be an isolated antibody or antibodies. Similarly, the antigen-binding fragment(s) described herein may be an isolated antigen-binding fragment(s).
[00119] In embodiments, the antibody or antigen-binding fragment thereof is chimeric or humanized. In embodiments, the antibody or antigen-binding fragment thereof has a human sequence Fc region.
[00120] In embodiments, the antibody or antigen-binding fragment comprises a monoclonal antibody, an scFv, a Fab fragment, a Fab' fragment, a F(ab')2 fragment, or a combination thereof.
[00121] In embodiments, the isolated antibody, the isolated antigen-binding fragment, the antibody, or the antigen-binding fragment comprises a monoclonal antibody, an scFv, an Fab fragment, an Fab' fragment, an F(ab’)2 fragment, or a combination thereof. It is noted that while an scFv is not strictly a fragment of an antibody, rather it is a fusion protein, as used herein an antigen-binding fragment of an antibody includes an scFv unless otherwise indicated.
[00122] In embodiments, the methods are for the treatment and prevention of a neurological HSV-2 infection symptom in a subject.
[00123] In embodiments, the methods are for the treatment and prevention of an epithelial HSV-2 infection symptom.
[00124] In embodiments, the antibody or antigen-binding fragment thereof, comprises a VH framework comprising the framework sequence of a human germline as named in Table 2 or Table 4 and / or (ii) a VL framework comprising the framework sequence of human germline as named in Table 2 or Table 4. In embodiments, the antibody or antigen-binding fragment thereof, comprises a VH framework comprising 95% or more identity to a framework sequence of a human germline as named in Table 2 or Table 4 and / or (ii) a VL framework comprising 95% or more identity to a framework sequence of human germline as named in Table 2 or Table 4.
[00125] In embodiments, the antibody or fragment thereof, binds an HSV-2 surface antigen with a binding affinity (Kp) of from about 1x10" molar (M) to about 1x10? M.
[00126] A method of producing an antibody or antigen-binding fragment thereof as described herein is provided, comprising culturing a host cell, under conditions wherein the antibody or antigen-binding fragment thereof is produced by the host cell. The term "host cell" refers to a cell into which exogenous nucleic acid encoding the antibody or antigen-binding fragment has been introduced, including the progeny of such cells. Host cells include "transformants", "transformed cells", "transfectants", "transfected cells", and "transduced cells", which include the primary transformed / transfected / transduced cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are also included.
[00127] The host cell may be a mammalian host cell. Examples of mammalian host cells for expressing the antibody or antigen binding fragment thereof provided herein include Chinese Hamster Ovary (CHO cells) such as CHO-K1, CHO-S, CHO-K1SV, NSO myeloma cells, COS cells, HEK293 cells, HKB11 cells, BHK21 cells, CAP cells, EB66 cells, SP2 cells, and Expi293F cells. In embodiments, the host cell is a Chinese hamster ovary (CHO) cell. In embodiments, the host cell is an Expi293F cell.
[00128] As used herein, the term "antibody" refers to an intact (whole) antibody, i.e. with complete Fc and Fv regions. Intact antibodies are glycoproteins comprising at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (Vu) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The Vy and VL regions are further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and Vi is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain or binding portion that interacts with an antigen.
[00129] As used herein, the terms “antigen-binding fragment” or “antigen-binding portion” refer to any portion of an antibody, or portions of an antibody linked together, which is less than the whole antibody but which retains the ability to specifically bind to an antigen. The antigen-binding fragment competes with the intact antibody of which it is a fragment for specific binding. In this case, the antigen is an HSV-2 antigen. The antigen may also be an HSV-1 antigen. An "antibody" or a “fragment” thereof can comprise an immunoglobulin of any class, e.g., IgG, IgM, IgA, IgD and IgE. An exemplary class is IgG and an exemplary isotype is IgG2c.
[00130] Examples encompassed within the terms “antigen-binding fragment” or “antigen- binding portion” of an antibody include a Fab fragment (a monovalent fragment consisting of the VL Vg, Ci, and Cm domains), a F(ab’), fragment (a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region), a Fab’ fragment (monovalent fragment produced by reduction of F(ab’), fragment, and which have a free sulfhydryl group), a fragment consisting of the Vi and Vu domains of a single arm of an antibody, a Fv fragment (a fragment consisting of the Vi. and Vu domains of a single arm of an antibody), a single chain fragment (scFv, a variable domain light chain (VL) and a variable domain heavy chain (VH) linked via a peptide linker), a dAb fragment (consists of a Vu domain); an isolated complementarity determining region (CDR), a nanobody (a heavy chain variable region containing a single variable domain and two constant domains), mutants thereof, naturally occurring variants, fusion proteins comprising an antibody portion with an antigen recognition site of the required specificity, humanized antibodies, chimeric antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.
[00131] Antigen-binding fragments can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989), hereby incorporated by reference in its entirety). Antigen- binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques. In some embodiments, a fragment is an Fab, Fab’, F(ab")2, Fd, Fv, complementarity determining region (CDR) fragment, or single-chain antibody (scFv). In the case of the scFv fragment, the Vi and Vi are coded by separate genes and are joined together, through recombinant means, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules. In embodiments, the scFv comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1, FR2, FR3 or FR4. In embodiments, the scFv comprises a synthetic linker, which is a peptide from 5 to 30 amino acid residues long. For example, the scFv comprises a linker peptide comprising one or more of glycine, serine, and threonine residues. In embodiments the linker of the scFv is 10-25 amino acids in length. In embodiments the peptide linker comprises glycine, serine and / or threonine residues. (For example, see Bird et al., Science, 242: 423-426 (1988) and Huston et al., Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988), each of which are hereby incorporated by reference in their entirety).
[00132] The antigen-binding fragment can be a polypeptide that contains at least a portion of an antibody that is sufficient to confer HSV-2 antigen -specific binding on the polypeptide, including a diabody. From N-terminus to C-terminus, both the mature light and heavy chain variable domains comprise the regions FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987), or Chothia et al.(Nature 342:878-883 (1989)), each of which are hereby incorporated by reference in their entirety. As used herein, the term "polypeptide" encompasses native or artificial proteins, protein fragments, and / or polypeptide analogs of a protein sequence. A polypeptide may be monomeric or polymeric. As used herein, an Fd fragment means an antibody fragment that consists of the VH and CH1 domains; an Fv fragment consists of the V1 and VH domains of a single arm of an antibody; and a dAb fragment (Ward et al., Nature 341:544-546 (1989) hereby incorporated by reference in its entirety) consists of a VH domain. In some embodiments, fragments are at least 5, 6, 8 or 10 amino acids long. In other embodiments, the antigen-binding fragment is at least 14, at least 20, at least 50, or at least 70, 80, 90, 100, 150 or 200 amino acids long.
[00133] The term "monoclonal antibody” or "mAb” as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different antigenic determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. In addition to their specificity, monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins. Thus an identified monoclonal antibody can be produced by non- hybridoma techniques, e.g. by appropriate recombinant means, once the sequence thereof is identified.
[00134] In embodiments of the inventions described herein, the antibody is isolated. As used herein, the term "isolated antibody" refers to an antibody that by virtue of its origin or source of derivation has at least one (e.g., one, two, three, or four) of the following: (1) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, or (4) does not occur in nature absent the hand of man.
[00135] In embodiments the antibody is humanized. As used herein, a "humanized antibody" refers to forms of antibodies that contain sequences from both human and non-human (e.g., murine, rat) antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. In one embodiment, a humanized antibody is an antibody having the sequence of a human immunoglobulin (recipient antibody) but the residues from a murine hypervariable region (HVR) (or CDR). In embodiments, framework (FR) residues of the murine mAb are replaced with corresponding human immunoglobulin variable domain framework (FR) residues. These humanized antibodies may be modified further to refine antibody performance. The humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. Alternatively, the humanized antibodies do not comprise residues that are not found in the recipient antibody or in the donor antibody. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all, or substantially all, of the hypervariable loops correspond to those of a non-human immunoglobulin, and all, or substantially all, of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); Presta, Curr. Op. Struct. Biol. 2:593-596 (1992); Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1:105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428- 433 (1994); and U.S. Pat. Nos. 6,982,321 and 7,087,409, the contents of each of which are hereby incorporated by reference in their entirety. In one embodiment the humanized antibodies comprise residues that are not found in the recipient antibody or in the donor antibody, and the Fc regions of the humanized antibodies are modified as described in WO 99 / 58572, the content of which is hereby incorporated by reference in its entirety.
[00136] Techniques to humanize a monoclonal antibody are well known and are described in, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370, the content of each of which is hereby incorporated by reference in its entirety. A number of "humanized" antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including antibodies having rodent or modified rodent V regions and their associated complementarity determining regions (CDRs) fused to human constant domains. See, for example, Winter et al. Nature 349: 293-299 (1991), Lobuglio et al. Proc. Nat. Acad. Sci. USA 86: 4220-4224 (1989), Shaw et al. J. Immunol. 138: 4534-4538 (1987), and Brown et al. Cancer Res. 47: 3577-3583 (1987), the content of each of which is hereby incorporated by reference in its entirety. Other references describe rodent hypervariable regions or CDRs grafted into a human supporting framework region (FR) prior to fusion with an appropriate human antibody constant domain. See, for example, Riechmann et al. Nature 332: 323-327 (1988), Verhoeyen et al. Science 239: 1534-1536 (1988), and Jones et al. Nature 321: 522-525 (1986), the content of each of which is hereby incorporated by reference in its entirety. Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions - European Patent Publication No. 0519596 (incorporated by reference in its entirety). These "humanized" molecules are designed to minimize unwanted immunological response toward rodent anti- human antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients. The antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g. PCT Publication No. W099 / 58572; UK Patent Application No. 9809951.8. Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al., Nucl. Acids Res. 19: 2471-2476 (1991) and in U.S. Pat. Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210,671; and 6,350,861; and in PCT Publication No. WO 01 / 27160 (each incorporated by reference in their entirety).
[00137] In embodiments, the antibodies or fragments herein can be produced recombinantly, for example antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes.
[00138] The "variable region" or "variable domain" of an antibody refers to the amino- terminal domains of the heavy or light chain of the antibody. The variable domain of the heavy chain may be referred to as "VH." The variable domain of the light chain may be referred to as "VL." These domains are generally the most variable parts of an antibody and contain the antigen-binding sites. The term "variable" refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) (or CDRs) both in the light-chain and the heavy- chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
[00139] The "light chains” of an antibody (immunoglobulin) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (x) and lambda (A), based on the amino acid sequences of their constant domains.
[00140] "Framework" or "FR" residues are those variable domain residues other than the HVR residues as herein defined.
[00141] In embodiments, the antibody herein has a human Fc region. The term "Fc region" herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, an intact antibody as used herein may be an antibody with or without the otherwise C-terminal lysine.
[00142] Compositions or pharmaceutical compositions comprising the antibodies, scFvs or fragments of antibodies disclosed herein are preferably comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation or aggregation over a period of time during storage and transportation prior to use. The compositions or pharmaceutical compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars can contribute to overcoming aggregation problems. Where a composition or pharmaceutical composition of the present invention is used as an injection, it is desirable to have a pH value in an approximately neutral pH range, it is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects. In embodiments, the composition or pharmaceutical composition is in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration. In embodiments, the composition or pharmaceutical composition is formulated for administration to a mammalian subject, and specifically, a human subject. In embodiments, the composition or pharmaceutical composition is formulated for intravenous, intramuscular, intraperitoneal, intradermal and / or subcutaneous injection. In embodiments, the composition or pharmaceutical composition can be in liquid form and has minimized risk of bubble formation and anaphylactoid side effects. In embodiments, the composition or pharmaceutical composition is isotonic. In an embodiment, the composition or pharmaceutical composition has a pH or 6.8 to 7.4.
[00143] In embodiments the scFvs or fragments of antibodies disclosed herein are lyophilized and / or freeze dried and are reconstituted for use.
[00144] Examples of pharmaceutically acceptable carriers include, but are not limited to, phosphate buffered saline solution, sterile water (including water for injection USP), emulsions such as oil / water emulsion, and various types of wetting agents. Exemplary diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline, for example 0.9% sodium chloride solution, USP. Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000, the content of each of which is hereby incorporated in its entirety). In non-limiting examples, the can comprise one or more of dibasic sodium phosphate, potassium chloride, monobasic potassium phosphate, polysorbate 80 (e.g. 2-[2-[3,5-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2-hydroxyethoxy)ethoxy]ethyl (E)-octadec- 9-enoate), disodium edetate dehydrate, sucrose, monobasic sodium phosphate monohydrate, and dibasic sodium phosphate dihydrate.
[00145] The antibodies, or fragments of antibodies, or compositions, or pharmaceutical compositions described herein can also be lyophilized or provided in any suitable forms including, but not limited to, injectable solutions or inhalable solutions, gel forms and tablet forms.
[00146] Substitution variants of the antibodies are encompassed by the present invention. Substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but framework alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of "conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions” in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened. Table 1: Amino Acid Substitutions
[00147] Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a 3-sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side-chain properties: (1) Non-polar: Norleucine, Met, Ala, Val, Leu, Ile; (2) Polar without charge: Cys, Ser, Thr, Asn, Gln; (3) Acidic (negatively charged): Asp, Glu; (4) Basic (positively charged): Lys, Arg; (5) Residues that influence chain orientation: Gly, Pro; and (6) Aromatic: Trp, Tyr, Phe, His.
[00148] Non-conservative substitutions are made by exchanging a member of one of these classes for another class.
[00149] One type of substitution, for example, that may be made is to change one or more cysteines in the antibody, which may be chemically reactive, to another residue, such as, without limitation, alanine or serine. For example, there can be a substitution of a non-canonical cysteine. The substitution can be made in a CDR or framework region of a variable domain or in the constant region of an antibody. In some embodiments, the cysteine is canonical. Any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant cross-linking. Conversely, cysteine bond(s) may be added to the antibody to improve its stability, particularly where the antibody is an antibody fragment such as an Fv fragment.
[00150] The antibodies may also be modified, e.g. in the variable domains of the heavy and / or light chains, e.g., to alter a binding property of the antibody. Changes in the variable region can alter binding affinity and / or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain.
[00151] An antibody described herein can be recombinantly produced. An antibody produced in the eukaryotic expression system comprises glycosylation at a residue on the Fc portion corresponding to Asn297.
[00152] In embodiments the composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein is substantially pure with regard to the antibody, or antigen-binding fragment thereof. A composition or pharmacentical composition comprising the antibody, or antigen-binding fragment thereof, described herein is "substantially pure” with regard to the antibody or fragment when at least 60% to 75% of a sample of the composition or pharmaceutical composition exhibits a single species of the antibody, or antigen-binding fragment thereof. A substantially pure composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein can comprise, in the portion thereof which is the antibody, or antigen-binding fragment, 60%, 70%, 80% or 90% of the antibody, or antigen-binding fragment, of the single species, more usually about 95%, and preferably over 99%. Purity or homogeneity may be tested by a number of means well known in the art, such as polyacrylamide gel electrophoresis or HPLC.
[00153] In embodiments of the methods, the subject is a mammal.
[00154] In embodiments, the mammal is a human.
[00155] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[00156] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. As used herein, the singular forms “a,” “an,” and “the” are intended to include the plural forms, including “at least one,” unless the content clearly indicates otherwise. “At least one” is not to be construed as limiting “a” or “an.” “Or” means “and / or.” As used herein, the term “and / or” includes any and all combinations of one or more of the associated listed items. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
[00157] Pharmaceutically acceptable: The term “pharmaceutically acceptable” as used herein means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia, other generally recognized pharmacopoeia in addition to other formulations that are safe for use in animals, and more particularly in humans and / or non-human mammals. Pharmaceutically acceptable carrier: The term “pharmaceutically acceptable carrier” as used herein refers to an excipient, diluent, preservative, solubilizer, emulsifier, adjuvant, and / or vehicle with which the present antibody or fragment is administered. Such carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose may also be a carrier. Methods for producing compositions in combination with carriers are known to those of skill in the art. In some embodiments, the language “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. See, e.g., Remington, The Science and Practice of Pharmacy. 20" ed., (Lippincott, Williams & Wilkins 2003). Except insofar as any conventional media or agent is incompatible with the active compound, such use in the compositions is contemplated.
[00158] It is understood that aspects and embodiments of the invention described herein include “consisting” and / or “consisting essentially of” aspects and embodiments.
[00159] Throughout this disclosure, various aspects of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[00160] Other objects, advantages and features of the present invention will become apparent from the following specification taken in conjunction with the accompanying drawings.
[00161] ‘While the disclosure has been described with reference to various embodiments, it will be understood by those skilled in the art that various changes may be made and equivalents may be substituted for elements thereof without departing from the scope of the disclosure. In addition, many modifications may be made to adapt a particular situation or material to the teachings of the disclosure without departing from the essential scope thereof. Therefore, it is intended that the disclosure not be limited to the particular embodiment disclosed as the best mode contemplated for carrying out this disclosure, but that the disclosure will include all embodiments falling within the scope of the appended claims.
[00162] All cited patents, patent applications, and other references are incorporated herein by reference in their entirety. However, if a term in the present application contradicts or conflicts with a term in the incorporated reference, the term from the present application takes precedence over the conflicting term from the incorporated reference.
[00163] This invention may be better understood from the Experimental Details, which follow. EXPERIMENTAL DETAILS
[00164] A candidate HSV-2 single-cycle viral vaccine deleted in the immunodominant envelope glycoprotein D (designated AgD-2) induces high-titer antibodies that are able to actively and passively protect mice from HSV disease in murine models. These antibodies are weakly neutralizing, but potently activate the murine Fc gamma receptor IV (FcyRIV) to activate antibody dependent cell mediated cytotoxicity (ADCC). The present disclosure has analyzed, cloned, sequenced and tested monoclonal antibodies (mAbs) isolated from the germinal center B cells of immunized mice and identified several that passively protect mice against viral disease. Certain mAbs were sufficiently active to be used for prophylaxis and treatment of patients with HSV (e.g. in humanized form) or at risk for disseminated disease (e.g. neonates, immunocompromised hosts).
[00165] Mice were prime-boost immunized with AgD-2 and the spleens, draining lymph nodes or bone marrow were isolated. Germinal center (GC) B cells were then cultured on NB- 21.2D9 cells (Nojima cultures). After culture, supernatants were screened for the presence of HSV-lysate binding IgG by ELISA. The V(D)J rearrangements amplified from selected GC B- cell cultures for the B-cell antigen receptor (BCR) repertoire analysis in GC B cell clones among individual mice were sequenced. Then, reconstituted antibodies from selected single GC B cell cultures and from single, bone marrow plasmacytes were evaluated for ability to activate the mFcyRIV in vitro and to protect mice in a passive transfer model.
[00166] Briefly, mice were vaccinated with AgD-2 and then 16 days after vaccination, the draining, inguinal lymph nodes were harvested. GC B cells were isolated from these tissues and were cultured in Nojima cultures. Although overall cloning efficiency of GC B cells from these (shipped) tissues was lower than those from freshly isolated tissues (6% vs. 20%), 50 GC clones were obtained that were specific to HSV-2 G strain (HSV-2 G or HSV2-G) lysate. An ELISA was performed against HSV-2 G lysates and uninfected Vero lysates (control), and the results are shown in FIG. 1. GC B cells from inguinal lymph nodes of mice vaccinated with AgD-2 were sorted directly into 96-well plates (1 cell / well). These GC B cells were then cultured in the presence of NB-21.2D9 feeder cells. After culture, presence of IgG was first determined by ELISA, and then the reactivity of culture supernatant IgG against HSV-2 G lysates (HSV-2 G) and uninfected Vero lysates were tested by ELISA.
[00167] The molecular genetics of the GC B cells were analyzed (FIG. 2). V(D)J rearrangements were amplified from cDNA of the HSV-2 G lysate-reactive, IgG+ cultures and then cloned and sequenced. The rearranged V, D, and J gene segments were determined using IMGT V-QUEST (see world wide web at imgt.org / ). A diverse set of VH gene segments were used by HSV2-specific GC B cells. VH1-64 and VH1-26 appeared more frequently (~10%) than other gene segments.
[00168] Based on the obtained V(D)J sequences from each B-cell culture, paired heavy and light chains were re-expressed (as recombinant mouse IgGl and IgG2c antibodies) in Expi293F cells (Kuraoka et al. Immunity 2016; DiLillo et al. Nature Medicine 2013). Then, 4 independent, HSV-2 G lysate reactive, IgG+ single B-cell cultures were selected from day 16 GC B cells. As expected, all recombinant antibodies reacted specifically with HSV-2 G lysates (FIG. 3). Clone 32H6 bound most avidly to the lysates, followed by 35H7, 22D10, and 33B8. FIG. 3 shows retention of HSV-2 G lysate-binding by recombinant antibodies. Binding of recombinant antibodies to HSV-2 G lysates was tested by ELISA. Both heavy and light chain V(D)J rearrangements were amplified from selected single B-cell culture wells (22D10, 32H6, 33B8, and 35H7) by standard RT-PCR. These cloned V(D)J rearrangements were introduced into expression vectors. Recombinant antibodies were obtained by co-transfection of these expression vectors into Expi293F cells. 24 mg of purified IgGs was obtained (not shown). These antibodies did not bind to control, uninfected Vero lysate. These recombinant antibodies (= 4 mg each) were tested for identification of reacting antigen(s), in an in vitro FcyRIV activation assay (Promega FcyRIV ADCC Reporter Bioassay)(FIG. 4), and in vivo protection assay.
[00169] AgD-2 prime-boost vaccinations establish long-lasting, HSV-reactive (and protective) serum IgG responses in mice as evidenced by results showing that 8 months post- boost, mice were still protected from HSV challenge. These results suggest that the vaccinations successfully establish long-lived plasmacytes. It was hypothesized that HSV-reactive plasmacytes could be isolated that produce protective IgGs from bone marrow of mice that had received the prime-boost vaccination. Compared with naive mice, AgD-2 vaccinated mice contained 4-fold higher frequency of surface IgM-CD138hiB220lo / -FSChi plasmacytes in the bone marrow in experiments where bone marrow plasmacytes were isolated from AgD-2 vaccinated mice.
[00170] To analyze molecular genetics of the bone marrow plasmacytes, V(D)J rearrangements were amplified from cDNA of single, slgM"CD138%B220"“ESC™ plasmacytes, and then cloned and sequenced the amplicand products. The rearranged V, D, and J gene segments were determined using IMGT V-QUEST (available on world wide web at imgt.org / ). From 96 individual cells we recovered 21 pairs of heavy and light chains and 4 heavy chain only clones (Table 1). The 25 heavy chain sequences consisted of four IgG3 (16%), nine IgG1 (36%), seven IgG2b (28%), four IgG2c (16%), and one IgA (4%) isotypes. Twenty individual clones (80%) carried at least one nucleotide substitution in Vu gene segment (average 4.4 Vu mutations). A summary of V(D)J rearrangements recovered from bone marrow plasmacytes of AgD:HSV vaccinated mice is provided in Table 2 below. As shown in Table 2, the CDR3 show conserved residues (C, W for HDCR and C, F for LCDR). With the exception of BMPC-7, the 1gG2b or IgG2c clones (gray rows in Table 2) carried Vy and VL mutations, suggesting that these plasmacyte clones are generated through GC responses.
[00171] Protection by serum antibodies elicited by AgD-2 vaccinations depends on FcyRIV activation. IgG2c antibodies that preferentially bind activating FcyRs were focused on. Based on the obtained V(D)J sequences from each plasmacyte, paired heavy and light chains were re-expressed (as recombinant mouse IgGl and IgG2c antibodies) in Expi293F cells as described above. Nine clones were selected that carry IgG2b and IgG2c constant regions ( BMPC-1, BMPC-12, BMPC-7, BMPC-8, BMPC-9, BMPC-23, BMPC-26, BMPC-57, and BMPC-61). Among these nine antibodies, BMPC-23, but not others, reacted with HSV-2 G lysate (FIGS. 5A and 5B, and data not shown). Binding of BMPC-23 is comparable to that of 19G7, another HSV-2 G lysate reactive IgG cloned from GC B cells of AgD-2 vaccinated mouse. The IgG1 and IgG2c isotype of BMPC-23 were analyzed in an in vitro FcyRIV activation assay (FIG. 4), and in vivo protection assay (see description below, FIGS. 6A to 6C). As shown in FIG.4, BMPC-23 IgG2c showed the highest level of FcyR activation.
[00172] Both IgG1 and IgG2c forms of 22D10, 33B8, and BMPC-23 antibodies (= 4 mg each) were assessed for reproducibility of in vivo protection assay, and any dependency on Ig isotype for protection. A representative experiment is shown in FIGS. 6A-6C. In brief, overall results from 2 independent experiments demonstrate that the IgG2c version of BMPC-23 protected 8 / 10 mice, 22D10 protected 5 / 10 mice, and 33B8 protected 4 / 10 mice from lethal challenge. Three monoclonal antibodies BMPC-23, 22D10, and 33B8 (as IgG2c) provided significant protection against HSV-2. To test roles of Ig isotypes on ability to provide protection, IgG1 and IgG2c isotypes of these three antibodies were generated and assessed for ability to activate mFcyRIV signaling (as a measurement for ADCC), and for in vivo protection assay. The results are shown in FIG. 4
[00173] IP-MS was performed to identify the targets of 22D10, 33B8, and BMPC-23 antibodies. The results are shown in FIGS. 7A and 7B, identifying human herpesvirus glycoprotein B (gB) as a target.
[00174] BMPC-23 binds HSV-1 gB (gB-1). The gB-1 binding of the antibodies was determined by Luminex multiplex assay. Mixtures of antigen (gB-1)-conjugated microspheres (1,000 counts each) were added to each well of 96-well filter plates (Millipore). After washing with PBS containing 1% BSA, 0.05% Tween 20 and 0.05% NaN, serially diluted recombinant antibodies (5E7, 19G7, 18G4, 22E10, 3A2, 17G3, 22D10, 32H6, 33B8, 25H7, BMPC-23, and S5V2-29) were added to the plates and incubated for 2 hours at room temperature, with mild agitation of the plates. Samples were diluted in PBS containing 1% cow milk, 1% BSA, 0.05% Tween 20 and 0.05% NaN. After washing, PE goat anti-mouse IgG was added to the plates and incubated for 1 hour at room temperature with mild agitation. After washing, microspheres were resuspended in PBS containing 1% BSA, 0.05% Tween 20 and 0.05% NaN3 and fluorescent signals from each microsphere were measured in a Bio-Plex® 3D machine. As shown in FIG. 8, the only antibody demonstrating substantial binding to gB-1 was BMPC-23.
[00175] Finding gB-1 specific HSV antibodies. After Nojima culture (single B-cell culture), HSV-specific antibodies were cloned from germinal center B cells and tested for binding to HSV-1 gB-1 by Luminex multiplex assay as described above. FIGS. 9A and 9B show the gB-1 binding results for 10 antibodies in comparison with BMPC-23. The cell origin and isolation methods for the antibodies tested are shown in Table 3. With the exception of BMPC- 23, the antibodies in Table 3 were derived from germinal center B cells (lymph nodes) taken 15- 17 days after primary vaccination with AgD-2. BMPC-23 was derived from bone marrow plasmacytes taken 2 weeks post-boost with AgD-2. Nucleotide sequences and amino acid sequences for the heavy-chains and light chains are shown in Table 4, as are the amino acid sequences for the light chain and heavy chain CDR 1, CDR2, and CDR3.
[00176] Finding BMPC-like antibodies. Nine out of 10 gB-1 specific mouse monoclonal IgG antibodies in Figure 3 were tested for their capacity to inhibit binding of BMPC-23 human IgG antibodies to gB-1. Serially diluted, gB-1 specific mouse monoclonal antibodies or irrelevant, control mouse antibody (H33Lyl) were incubated with gB-1 conjugated Luminex beads. After incubation, fixed concentration (2 ng / ml) of BMPC-23 human IgG antibodies were added to each well. After washing, mouse anti-human IgG-PE was added to detect binding of human BMPC-23 antibodies. The y-axis indicates MFI percentage of maximal binding, determined as the mean MFI in the presence of a control IgG, H33Ly1 that do not bind to gB-1. FIG. 10A shows BMPC-23 mouse IgG (at 222 ng / ml) inhibited human BMPCs >99%. Strong inhibition by HSV010-4 (>95% at 222 ng / ml), HSV010-7 (>90% at 222 ng / ml), and HSV010-34 (>80% at 222 ng / ml), shown in FIGS. 10B, 10F, and 10G, rescpetively, indicates these antibodies bind epitopes on gB-1 closely overlapping with the one recognized by BMPC-23. Therefore, similar protective efficacy as BMPC-23 is expected from these antibodies (experiments in progress). Mild inhibition by HSV010-28 (30% inhibition at 222 ng / ml in FIG. 10D) and by HSV010-6, 9, 13, 14 (32%-48% at 222 ng / ml in FIG. 10E) indicates that epitopes on gB-1 recognized by these antibodies partially overlap with the one recognized by BMPC-23. No inhibition by HSV010-20 as shown in FIG. 10C indicates that epitope recognized by this antibody does not overlap with the one recognized by BMPC-23. Protective efficacy of these antibodies need to be tested (experiments in progress). The above-described data is also summarized in Table 3 below.
[00177] Additional Experiments. Determination of the target antigen for antibodies 22D10 and 33B8 will be conducted using methods similar to those used for antigenic determination of the BMPC-23 antibody. For example, methods such as mass spectrometry of proteins bound by 22D10 or 33B8 antibodies and / or screening 22D10 or 33B8 against other non-gB purified antigens from HSV-1 can be used.
[00178] The ability of the 12 untested antibodies in Table 3 to protect against ocular infection by HSV-1 will be evaluated using the methods described above.
[00179] Structural determination of epitopes for the HSV-1 binding antibodies in Table 3 will be conducted. Such methods include co-crystallization of the Fab fragment of the antibody with the HSV-1 protein (e.g., gB-1), X-ray diffraction, and analysis by XDS. (See for example ‘Watanabe et al, 2019, Cell, 177, 1124-1135).
Claims
‘What is claimed is:
1. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising GYSFTTYD (SEQ ID NO:1), TYPREGST (SEQ ID NO:2), and ATYGSSRYYTMDY (SEQ ID NO:3); and / or a light chain variable region comprising ESVDNFGISF (SEQ ID NO:4), AAS (SEQ ID NO:5), and QQSKEVPLT (SEQ ID NO:6). 2 An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising GYSITNGNH (SEQ ID NO:7), IRSSGSS (SEQ ID NO:8), and ARGGGLRHYFDY (SEQ ID NO:9); and / or a light chain variable region comprising GNIHNY (SEQ ID NO:10), HAE (SEQ ID NO:11), and QHFWSTPYT (SEQ ID NO:12).
3. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising GFTFTDYY (SEQ ID NO:13), IRNKANGYTT (SEQ ID NO:14), and ACGNYVGYAMDY (SEQ ID NO:15); and / or a light chain variable region comprising QSLLNSRTRKNY (SEQ ID NO:16), WAS (SEQ ID NO:17), and KQSYNLYT (SEQ ID NO:18).
4. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising GFSLSRHD (SEQ ID NO:79), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); and / or a light chain variable region comprising QDISSY (SEQ ID NO:82), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84).
5. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising GYTFINYD (SEQ ID NO:87), IYPRDGST (SEQ ID NO:88), and ARGIFYVNYDVY (SEQ ID NO:89); and / or a light chain variable region comprising DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92).
6. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising EYEFPSHD (SEQ ID NO:93), INSDGGST (SEQ ID NO:94), and ARHSSGYVLDY (SEQ ID NO:95); and / or a light chain variable region comprising DHINHW (SEQ ID NO:96), GAT (SEQ ID NO:97), and QQYWSTPYT (SEQ ID NO:98).
7. An antibody or antigen-binding fragment, comprising: a heavy chain variable region comprising EYEFPSHD (SEQ ID NO:85), INSDGGST (SEQ ID NO:80), and ARHSSGYVLDY (SEQ ID NO:81); and / or a light chain variable region comprising DHINHW (SEQ ID NO:86), GAT (SEQ ID NO:83), and QQYWSTPYT (SEQ ID NO:84).
8. The antibody or antigen-binding fragment of any of Claims 1-7 having an IgG2c isotype.
9. The antibody or antigen-binding fragment of any of Claims 1 to 8, which is a humanized antibody.
10. The antibody or antigen-binding fragment of any of Claims 1 to 9, comprising an Fc region which binds a human Fc gamma receptor RIII (FcyRIII).
11. The antibody or antigen-binding fragment of any of Claims 1 to 10, which binds a herpes simplex virus-2 (HSV-2) antigen.
12. The antibody or antigen-binding fragment of any of Claims 1 to 11, which binds an HSV- 2 glycoprotein B.
13. The antibody or antigen-binding fragment of any of Claims 1 to 12, wherein a framework region of the light chain, a framework region of the heavy chain, or a combination thereof is a human framework region, or has a 85% or greater identity to the human framework region.
14. The antibody or antigen-binding fragment of Claim 13, wherein the framework region of the light chain, the framework region of the heavy chain, or the combination thereof is the human framework region.
15. A nucleic acid encoding a heavy chain variable region of an ar wherein the heavy chain variable region has an amino acid sequence comprising: GYSFTTYD (SEQ ID NO:1), TYPREGST (SEQ ID NO:2), and ATYGSSRYYTMDY (SEQ ID NO:3); or GYSITNGNH (SEQ ID NO:7), IRSSGSS (SEQ ID NO:8), and ARGGGLRHYFDY (SEQ ID NO:9); or GFTFTDYY (SEQ ID NO:13), IRNKANGYTT (SEQ ID NO:14), and ACGNYVGYAMDY (SEQ ID NO:15); or GFSLSRHD (SEQ ID NO:79), IWGDGST (SEQ ID NO:80), and AKEDYGIFPY (SEQ ID NO:81); or GFSLNNYD (SEQ ID NO: 85), IWGDGST (SEQ ID NO: 80), and AKEDYGIFPY (SEQ ID NO: 81); or GYTFINYD (SEQ ID NO:87), IYPRDGST (SEQ ID NO:88), and ARGIFYVNYDVY (SEQ ID NO:89); or EYEFPSHD (SEQ ID NO:93), INSDGGST (SEQ ID NO:94), and ARHSSGYVLDY (SEQ ID NO:95).
16. The nucleic acid of Claim 15, further comprising a nucleic acid sequence which encodes a human heavy chain framework region.
17. The nucleic acid of Claim 15 or 16, further comprising a nucleic acid sequence which encodes a human Fc region.
18. A nucleic acid encoding a light chain variable region of an antibody, wherein the light chain variable region has an amino acid sequence comprising: ESVDNFGISF (SEQ ID NO:4), AAS (SEQ ID NO:5), and QQSKEVPLT (SEQ ID NO:6); or GNIHNY (SEQ ID NO:10), HAE (SEQ ID NO:11), and QHFWSTPYT (SEQ ID NO:12); or QSLLNSRTRKNY (SEQ ID NO:16), ‘WAS (SEQ ID NO:17), and KQSYNLYT (SEQ ID NO:18); or QDISSY (SEQ ID NO:82), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84); or QDINSY (SEQ ID NO:86), RAN (SEQ ID NO:83), and LQYDEFPLT (SEQ ID NO:84); or DHINNW (SEQ ID NO:90), GAA (SEQ ID NO:91), and QQYWSSPLT (SEQ ID NO:92); or DHINHW (SEQ ID NO:96), GAT (SEQ ID NO:97), and QQYWSTPYT (SEQ ID NO:98).
19. The nucleic acid of Claim 18, further comprising a nucleic acid sequence which encodes a human light chain framework region.
20. Ahost cell comprising one or more of the nucleic acids of any of Claims 15 to 19.
21. A method of inhibiting a herpes simplex virus-2 (HSV-2) activity in a subject, the method comprising: administering the antibody or antigen-binding fragment of any of Claims 1 to 14, in an amount effective to inhibit HSV-2 activity in the subject.
22. The method of Claim 21, wherein the subject is infected with HSV-2.
23. The method of Claim 21, wherein the subject is not yet infected with HSV-2.
24. The method of any of Claims 21 to 23, wherein the subject is immunocompromised.
25. The method of any of Claims 21 to 24, wherein the subject is pregnant or is a neonate.
26. The method of any of Claims 21 to 25, wherein the subject is receiving or has received an anti-viral drug.
27. The method of Claim 26, wherein the anti-viral drug comprises acyclovir.
28. A pharmaceutical composition, comprising: the antibody or antigen-binding (ragment of any of Claims 1 to 14; and a pharmaceutically acceptable carrier or excipient.
29. The pharmaceutical composition of Claim 28, further comprising a small molecule anti- viral drug.
30. The pharmaceutical composition of Claim 29, wherein the small molecule anti-viral drug is acyclovir.
31. The pharmaceutical composition of any of claims 28 to 30, wherein the antibody or antigen-binding fragment is present in an amount effective for treating or preventing a disease or condition that is associated with an herpes simplex virus-2 (HSV-2) infection in a subject.
32. A method of activating antibody-dependent cellular cytotoxicity (ADCC) of a cell infected with herpes simplex virus-2 (HSV-2), comprising: contacting the cell with an isolated antibody or antigen-binding fragment according to any of Claims 1-14, in an amount which effects ADCC of the cell.
33. The method of Claim 32, wherein the cell is in a subject who has been exposed to HSV-2 or is infected with HSV-2.
34. The method of any of Claims 21 to 27 or 32 to 33, wherein the subject is a mammal.
35. The method of Claims 21 to 27 or 32 to 34, wherein the subject is a human.
36. Use of an effective amount of the antibody or antigen-binding fragment of any of Claims 1-14 for the manufacture of a medicament for treating or preventing a disease or condition that is associated with an herpes simplex virus-2 (HSV-2) infection in a subject.
Citation Information
Patent Citations
Human monoclonal antibodies to herpes simplex virus and methods therefor
US6156313A
Topical application for an Anti-HSV antibody
WO2015197763A1
Anti-HSV gb monoclonal antibody or antigen-binding fragment thereof
WO2019044926A1