Circular RNA compositions and methods
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- MASSACHUSETTS INST OF TECH
- Filing Date
- 2020-05-22
- Publication Date
- 2026-07-30
AI Technical Summary
Conventional DNA-based gene therapy methods face challenges such as integration into the host genome, potential disruption of essential genes, immune responses, and toxicity issues, particularly in cancer therapies using CARs and TCRs, while RNA-based approaches offer safer alternatives but are limited by existing methodologies for circular RNA production.
A pharmaceutical composition comprising a circular RNA polynucleotide with a specific structure, including a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) complex, and a 5’ group I intron fragment, delivered by a transfer vehicle containing ionizable or structural lipids, enabling targeted expression in human immune cells.
This approach provides a safer and more effective method for engineering immune cells to express CARs and TCRs, reducing toxicity and improving therapeutic efficacy by avoiding genome integration and immune responses, with enhanced stability and longer therapeutic effect compared to linear RNA.
Smart Images

Figure 00000216_0000 
Figure 00000216_0001 
Figure 00000217_0000
Abstract
Description
CIRCULAR RNA COMPOSITIONS AND METHODS CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of and priority to U.S. Provisional Patent Application No. 62 / 851,548, filed May 22, 2019; U.S. Provisional Patent Application No. 62 / 857,121, filed June 4, 2019; International Patent Application No. PCT / US2019 / 035531, filed June 5, 2019, U.S. Provisional Patent Application No. 62 / 943, 796, filed December 4, 2019; U.S. Provisional Patent Application No. 62 / 943,779, filed December 4, 2019; and U.S. Provisional Patent Application No. 62 / 972,194, filed February 10, 2020, the disclosures of which are hereby incorporated by reference in their entireties for all purposes. BACKGROUND 11 Conventional gene therapy involves the use of DNA for insertion of desired genetic information into host cells. The DNA introduced into the cell is usually integrated to a certain extent into the genome of one or more transfected cells, allowing for long-lasting action of the introduced genetic material in the host. While there may be substantial benefits to such sustained action, integration of exogenous DNA into a host genome may also have many deleterious effects. For example, it is possible that the introduced DNA will be inserted into an intact gene, resulting in a mutation which impedes or even totally eliminates the function of the endogenous gene. Thus, gene therapy with DNA may result in the impairment of a vital genetic function in the treated host, such as e.g., elimination or deleteriously reduced production of an essential enzyme or interruption of a gene critical for the regulation of cell growth, resulting in unregulated or cancerous cell proliferation. In addition, with conventional DNA-based gene therapy, it is necessary for effective expression of the desired gene product to include a strong promoter sequence, which again may lead to undesirable changes in the regulation of normal gene expression in the cell. It is also possible that the DNA-based genetic material will result in the induction of undesired anti-DNA antibodies, which in turn, may trigger a possibly fatal immune response. Gene therapy approaches using viral vectors can also result in an adverse immune response. In some circumstances, the viral vector may even integrate into the host genome. In addition, production of clinical grade viral vectors also is expensive and time consuming. Targeting delivery of the introduced genetic material using viral vectors can also be difficult to control. Thus, while DNA-based gene therapy has been evaluated for delivery of secreted proteins using viral vectors (U.S. Pat. No. 6,066,626; US2004 / 0110709), these approaches may be limited for these various reasons. [21 In contrast to DNA, the use of RNA as a gene therapy agent is substantially safer because RNA does not involve the risk of being stably integrated into the genome of the transfected cell, thus eliminating the concern that the introduced genetic material will disrupt the normal functioning of an essential gene, or cause a mutation that results in deleterious or oncogenic effects, and extraneous promoter sequences are not required for effective translation of the encoded protein, again avoiding possible deleterious side effects. In addition, it is not necessary for mRNA to enter the nucleus to perform its function, while DNA must overcome this major barrier. 31 Circular RNA is useful in the design and production of stable forms of RNA. The circularization of an RNA molecule provides an advantage to the study of RNA structure and function, especially in the case of molecules that are prone to folding in an inactive conformation (Wang and Ruffner, 1998). Circular RNA can also be particularly interesting and useful for in vivo applications, especially in the research area of RNA-based control of gene expression and therapeutics, including protein replacement therapy and vaccination. [4] Use of T cells genetically modified to express Chimeric Antigen Receptors (CARs) and recombinant T Cell Receptors (TCRs) targeting antigens on cancer cells is an attractive therapeutic strategy for the treatment of cancer. However, current methods of modifying T cells to express CARs and TCRs and the resulting therapies are associated with toxicity in the form of Cytokine Release Syndrome (CRS) and other complications. There remains a need for safer methods of engineering cells to express CARs and recombinant TCRs. [5] Prior to this invention, there were three main techniques for making circularized RNA in vitro: the splint-mediated method, the permuted intron-exon method, and the RNA ligase- mediated method. However, the existing methodologies are limited by the size of RNA that can be circularized, thus limiting their therapeutic application. SUMMARY [6] In one aspect, provided herein is a pharmaceutical composition comprising: a circular RNA polynucleotide comprising, in the following order, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) complex protein, and a 5° group I intron fragment, and a transfer vehicle comprising at least one of (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG-modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell present in a human subject, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell. 7 In some embodiments, the pharmaceutical composition is formulated for intravenous administration to the human subject in need thereof. In some embodiments, the 3’ group intron fragment and 5° group I intron fragment are Anabaena group I intron fragments. [8] In certain embodiments, the 3” intron fragment and 5” intron fragment are defined by the L9a-5 permutation site in the intact intron. In certain embodiments, the 3’ intron fragment and 5” intron fragment are defined by the L8-2 permutation site in the intact intron. 91 In some embodiments, the IRES is from Taura syndrome virus, Triatoma virus, Theiler's encephalomyelitis virus, Simian Virus 40, Solenopsis invicta virus 1, Rhopalosiphum padi virus, Reticuloendotheliosis virus, Human poliovirus 1, Plautia stali intestine virus, Kashmir bee virus, Human rhinovirus 2, Homalodisca coagulata virus- 1, Human Immunodeficiency Virus type 1, Homalodisca coagulata virus- 1, Himetobi P virus, Hepatitis C virus, Hepatitis A virus, Hepatitis GB virus Foot and mouth disease virus, Human enterovirus 71, Equine rhinitis virus, Ectropis obliqua picorna-like virus, Encephalomyocarditis virus, Drosophila C Virus, Human coxsackievirus B3, Crucifer tobamovirus, Cricket paralysis virus, Bovine viral diarrhea virus 1, Black Queen Cell Virus, Aphid lethal paralysis virus, Avian encephalomyelitis virus, Acute bee paralysis virus, Hibiscus chlorotic ringspot virus, Classical swine fever virus, Human FGF2, Human SFTPAI, Human AMLI / RUNXI, Drosophila antennapedia, Human AQP4, Human ATIR, Human BAG-1, Human BCL2, Human BiP, Human c-IAPI, Human c-myc, Human eIF4G, Mouse NDST4L, Human LEF1, Mouse HIF1 alpha, Human n.myc, Mouse Gtx, Human p27kipl, Human PDGF2 / c-sis, Human p53, Human Pim-1, Mouse Rbm3, Drosophila reaper, Canine Scamper, Drosophila Ubx, Human UNR, Mouse UtrA, Human VEGF-A, Human XIAP, Drosophila hairless, S. cerevisiae TFIID, S. cerevisiae YAP], tobacco etch virus, turnip crinkle virus, EMCV-A, EMCV-B, EMCV-Bf, EMCV-Cf, EMCV pEC9, Picobirnavirus, HCV QC64, Human Cosavirus E / D, Human Cosavirus F, Human Cosavirus JMY, Rhinovirus NAT001, HRV14, HRV89, HRVC-02, HRV-A21, Salivirus A SHI, Salivirus FHB, Salivirus NG-J1, Human Parechovirus 1, Crohivirus B, Ye-3, Rosavirus M-7, Shanbavirus A, Pasivirus A, Pasivirus A 2, Echovirus E14, Human Parechovirus 5, Aichi Virus, Hepatitis A Virus HA16, Phopivirus, CVA10, Enterovirus C, Enterovirus D, Enterovirus J, Human Pegivirus 2, GBV-C GT110, GBV-C K1737, GBV-C Iowa, Pegivirus A 1220, Pasivirus A 3, Sapelovirus, Rosavirus B, Bakunsa Virus, Tremovirus A, Swine Pasivirus 1, PLV-CHN, Pasivirus A, Sicinivirus, Hepacivirus K, Hepacivirus A, BVDV, Border Disease Virus, BVDV2, CSFV- PK15C, SF573 Dicistrovirus, Hubei Picorna-like Virus, CRPV, Salivirus A BN3, Salivirus A BN2, Salivirus A 02394, Salivirus A GUT, Salivirus A CH, Salivirus A SZ1, Salivirus FHB, CVB3, CVBI, Echovirus 7, CVB5, EVA71, CVA3, CVA12, EV24 or an aptamer to eIF4G.
[10] In some embodiments, the IRES comprises a CVB3 IRES or a fragment or variant thereof, or wherein the IRES comprises a sequence according to SEQ ID NO: 65. In some embodiments, the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof. In certain embodiments, the IRES comprises a sequence according to SEQ ID NO: 63. In some embodiments, the pharmaceutical composition comprises a first internal spacer between the 3’ group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment. In certain embodiments, the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
[11] In some embodiments, the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRVIID), disialoganglioside GD2, disaloganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GalNAca-Ser / Thr)), prostate- specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER3, Mucin 1, cell surface associated (MUCI), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GMI, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGSS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDNG), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein-coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179a.
[12] In some embodiments, the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, CD2, SLAM, and combinations thereof. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain.
[13] In some embodiments, the CAR or TCR complex protein comprises a CAR comprising: an antigen binding domain, a spacer domain, a transmembrane domain, a costimulatory domain, and an intracellular T cell signaling domain.
[14] In some embodiments, the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens. In some embodiments, the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta. In some embodiments, the transfer vehicle comprises a lipid nanoparticle, a core-shell nanoparticle, a biodegradable nanoparticle, a biodegradable lipid nanoparticle, a polymer nanoparticle, or a biodegradable polymer nanoparticle.
[15] In some embodiments, the pharmaceutical composition further comprises a targeting moiety. In certain embodiments, the targeting moiety mediates receptor-mediated endocytosis or direct fusion into selected cells of a selected cell population or tissue in the absence of cell isolation or purification. In certain embodiments, the targeting moiety is capable of binding to a protein selected from the group CD3, CD4, CDS, CDS, CD7, PD-1, 4-1BB, CD28, Clq, and CD2. In certain embodiments, the targeting moiety comprises an antibody specific for a macrophage, dendritic cell, NK cell, NKT, or T cell antigen. In certain embodiments, the targeting moiety comprises a scFv, nanobody, peptide, minibody, polynucleotide aptamer, heavy chain variable region, light chain variable region or fragment thereof.
[16] In some embodiments, the pharmaceutical composition is administered in an amount effective to treat cancer in the human subject. In some embodiments, the pharmaceutical composition has an enhanced safety profile when compared to a pharmaceutical composition comprising T cells or vectors comprising exogenous DNA encoding the same CAR.
[17] In some embodiments, less than 1%, by weight, of the polynucleotides in the composition are double stranded RNA, DNA splints, or triphosphorylated RNA.
[18] In some embodiments, less than 1%, by weight, of the polynucleotides and proteins in the pharmaceutical composition are double stranded RNA, DNA splints, triphosphorylated RNA, phosphatase proteins, protein ligases, and capping enzymes. In some embodiments, the transfer vehicle comprises more than one circular RNA polynucleotide.
[19] In another aspect, the present disclosure provides a circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment.
[20] In some embodiments, the 3” group I intron fragment and 5’ group I intron fragment are Anabaena group I intron fragments. In certain embodiments, the 3’ intron fragment and 5’ intron fragment are defined by the L9a-5 permutation site in the intact intron. In certain embodiments, the 3’ intron fragment and 5’ intron fragment are defined by the L8-2 permutation site in the intact intron. In certain embodiments, the IRES comprises a CVB3 IRES or a fragment or variant thereof. In certain embodiments, the IRES has a sequence according to SEQ ID NO: 65. In certain embodiments, the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof. In certain embodiments, the IRES has a sequence according to SEQ ID NO: 63.
[21] In some embodiments, the circular RNA polynucleotide comprises a first internal spacer between the 3’ group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment.
[22] In certain embodiments, the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
[23] In some embodiments, the circular RNA polynucleotide consists of natural nucleotides. In some embodiments, the circular RNA polynucleotide further comprises a second expression sequence encoding a therapeutic protein. In some embodiments, the therapeutic protein comprises a checkpoint inhibitor. In certain embodiments, the therapeutic protein comprises a cytokine.
[24] In some embodiments, the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant IIT (EGFRVII), disialoganglioside GD2, disialoganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate- specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER3, Mucin 1, cell surface associated (MUCI), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gpl100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GMI, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDNS), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein-coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179a
[25] In some embodiments, the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, CD2, SLAM, and combinations thereof. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain.
[26] In some embodiments, the CAR or TCR complex protein comprises a CAR comprising: an antigen binding domain, a spacer domain, a transmembrane domain, a costimulatory domain, and an intracellular T cell signaling domain.
[27] In some embodiments, the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens. In some embodiments, the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta.
[28] In some embodiments, the circular RNA polynucleotide consists of natural nucleotides.
[29] In some embodiments, the circular RNA polynucleotide expression sequence is codon optimized. In some embodiments, the circular RNA polynucleotide is optimized to lack at least one microRNA binding site present in an equivalent pre-optimized polynucleotide. In some embodiments, the circular RNA polynucleotide is optimized to lack at least one endonuclease susceptible site present in an equivalent pre-optimized polynucleotide. In some embodiments, the circular RNA polynucleotide is optimized to lack at least one RNA-editing susceptible site present in an equivalent pre-optimized polynucleotide.
[30] In some embodiments, the circular RNA polynucleotide has an in vivo functional half- life in humans greater than that of an equivalent linear RNA polynucleotide having the same expression sequence. In some embodiments, the circular RNA polynucleotide has a length of about 100 nucleotides to about 10 kilobases. In some embodiments, the circular RNA polynucleotide has a functional half-life of at least about 20 hours. In some embodiments, the circular RNA polynucleotide has a duration of therapeutic effect in a human cell of at least about 20 hours. In some embodiments, the circular RNA polynucleotide has a duration of therapeutic effect in a human cell greater than or equal to that of an equivalent linear RNA polynucleotide comprising the same expression sequence. In some embodiments, the circular RNA polynucleotide has a functional half-life in a human cell greater than or equal to that of an equivalent linear RNA polynucleotide comprising the same expression sequence. [311 In another aspect, the present disclosure provides a DNA vector comprising, in the following order, a 5’ duplex forming region, an Anabaena 3’ group I intron fragment with a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, an Anabaena 5’ group I intron fragment with a second permutation site, and a 3” duplex forming region.
[32] In some embodiments, the 3’ group I intron fragment and 5° group I intron fragment are Anabaena group I intron fragments. In some embodiments, the 3’ intron fragment and 5° intron fragment are defined by the L9a-5 permutation site in the intact intron. In some embodiments, the 3’ intron fragment and 5° intron fragment are defined by the L8-2 permutation site in the intact intron. In some embodiments, the IRES comprises a CVB3 IRES or a fragment or variant thereof,
[33] In some embodiments, the IRES encodes a sequence according to SEQ ID NO: 65. In some embodiments, the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof. In some embodiments, the IRES encodes a sequence according to SEQ ID NO: 63. In some embodiments, the circular RNA polynucleotide comprises, in the following order, 5° duplex forming region, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, a 5’ group I intron fragment, and a 3’ duplex forming region. In some embodiments, the 5’ duplex forming region and 3’ duplex forming region each have about 70% GC nucleotides. In some embodiments, the 5’ duplex forming region and 3’ duplex forming region each have a length of about 30 nucleotides.
[34] In some embodiments, the DNA vector comprises a first external spacer between the 5° duplex forming region and the 3’ group I intron fragment, and a second external spacer between the 5° group I intron fragment and the 3’ duplex forming region. In some embodiments, the first and second external spacers each have a length of about 10 to about 60 nucleotides. In some embodiments, the 5’ duplex forming region is directly adjacent to the 3’ group I intron fragment, and wherein the 5° group I intron fragment is directly adjacent to the 3’ duplex forming region. In some embodiments, the DNA vector comprises a first internal spacer between the 3’ group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment. In some embodiments, the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
[35] Insome embodiments, the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRVIII), disialoganglioside GD2, disialoganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate- specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER3, Mucin 1, cell surface associated (MUCI), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gpl100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GM], sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDNS), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein-coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179a
[36] In some embodiments, the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, CD2, SLAM, and combinations thereof. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain. In some embodiments, the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain. [371 In some embodiments, the CAR or TCR complex protein comprises a CAR comprising: an antigen binding domain, a spacer domain, a transmembrane domain, a costimulatory domain, and an intracellular T cell signaling domain.
[38] In some embodiments, the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens. In some embodiments, the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta.
[39] In another aspect, the present disclosure provides a eukaryotic cell comprising a circular RNA polynucleotide comprising, in the following order, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment. In some embodiments, the eukaryotic cell comprises a human cell. In some embodiments, the eukaryotic cell comprises an immune cell. In some embodiments, the eukaryotic cell comprises aT cell.
[40] In another aspect, the present disclosure provides a population of eukaryotic cells comprising a circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5’ group I intron fragment, wherein the population of eukaryotic cells express the CAR or TCR complex protein encoded by the circular RNA polynucleotide on its cell surface.
[41] In some embodiments, the population of cells comprises NK cells, NKT cells, macrophages, dendritic cells, alphabeta T cells, gammadelta T cells, or combinations thereof. In some embodiments, the population of cells comprises T cells. In some embodiments, the population comprises CD3+ T cells. In some embodiments, the population comprises CD4+ T cells. In some embodiments, the population comprises CD8+ T cells. In some embodiments, the population of eukaryotic cells is administered in an amount effective to treat cancer in a human subject in need thereof. In some embodiments, the population of cells kills tumor cells more effectively or for longer than an equivalent population of eukaryotic cells comprising linear RNA encoding the same CAR.
[42] In another aspect, provided herein is a method of making a population of eukaryotic cells comprising contacting cells in the population with a transfer vehicle comprising a circular RNA polynucleotide comprising, in the following order, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group intron fragment, wherein the transfer vehicle comprises (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG-modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell.
[43] In another aspect, provided herein is a method of treating a subject in need thereof comprising administering a therapeutically effective amount of a pharmaceutical composition comprising: a circular RNA polynucleotide comprising, in the following order, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment, and a transfer vehicle comprising (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG- modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell.
[44] In some embodiments, the subject has a cancer selected from the group acute lymphocytic cancer, acute myeloid leukemia (AML), alveolar rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., medulloblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia, liquid tumors, liver cancer, lung cancer (e.g., non-small cell lung carcinoma and lung adenocarcinoma), lymphoma, mesothelioma, mastocytoma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, ovarian cancer, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, solid tumors, synovial sarcoma, gastric cancer, testicular cancer, thyroid cancer, and ureter cancer.
[45] In another aspect, provided herein is an RNA polynucleotide comprising an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, and at least one self-circularizing element.
[46] In some embodiments, the RNA polynucleotide comprises a 5° duplex forming region, an Anabaena 3’ group I intron fragment with a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, an Anabaena 5’ group I intron fragment with a second permutation site, and a 3 duplex forming region. In some embodiments, the RNA polynucleotide comprises a 5° duplex forming region, a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, a second permutation site, and a 3” duplex forming region. In some embodiments, the self-circularizing element is a group intron fragment. In some embodiments, a 3° group I intron fragment and a 5’ intron fragment. In some embodiments, the 3’ group I intron fragment and 5° group I intron fragment are Anabaena group I intron fragments. In some embodiments, the 3” intron fragment and 5’ intron fragment are defined by the L.9a-5 permutation site in the intact intron. In some embodiments, the 3’ intron fragment and 5’ intron fragment are defined by the L8-2 permutation site in the intact intron. In some embodiments, the RNA polynucleotide is capable of circularizing in the absence of an enzyme. In some embodiments, the RNA polynucleotide consists of natural nucleotides. [471 In another aspect, the present disclosures provides a DNA vector suitable for synthesizing the RNA polynucleotide of one of the above embodiments.
[48] In some embodiments, a circular RNA polynucleotide of the present disclosure is delivered to a target cell in a non-lipid polymeric core-shell nanoparticle. INCORPORATION BY REFERENCE
[49] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated as being incorporated by reference herein. BRIEF DESCRIPTION OF THE DRAWINGS
[50] Figure 1 depicts luminescence in supernatants of HEK293 (Figure 1A), HepG2 (Figure 1B), or 1C1C7 (Figure 1C) cells 24 hours after transfection with circular RNA comprising a Gaussia luciferase expression sequence and various IRES sequences. [511 Figure 2 depicts luminescence in supernatants of HEK293 (Figure 2A), HepG2 (Figure 2B), or 1C1C7 (Figure 2C) cells 24 hours after transfection with circular RNA comprising a Gaussia luciferase expression sequence and various IRES sequences having different lengths.
[52] Figure 3 depicts stability of select IRES constructs in HepG2 (Figure 3A) or 1C1C7 (Figure 3B) cells over 3 days as measured by luminescence.
[53] Figures 4A and 4B depict protein expression from select IRES constructs in Jurkat cells, as measured by luminescence from secreted Gaussia luciferase in cell supernatants.
[54] Figures 5A and 5B depict stability of select IRES constructs in Jurkat cells over 3 days as measured by luminescence.
[55] Figure 6 depicts comparisons of 24 hour luminescence (Figure 6A) or relative luminescence over 3 days (Figure 6B) of modified linear, unpurified circular, or purified circular RNA encoding Gaussia luciferase.
[56] Figure 7 depicts transcript induction of IFNy (Figure 7A), IL-6 (Figure 7B), IL-2 (Figure 7C), RIG-I (Figure 7D), IFN-Bl (Figure 7E), and TNFa (Figure 7F) after electroporation of Jurkat cells with modified linear, unpurified circular, or purified circular RNA. [571 Figure 8 depicts a comparison of luminescence of circular RNA and modified linear RNA encoding Gaussia luciferase in human primary monocytes (Figure 8A) and macrophages (Figure 8B and Figure 8C).
[58] Figure 9 depicts relative luminescence over 3 days (Figure 9A) in supernatant of primary T cells after transduction with circular RNA comprising a Gaussia luciferase expression sequence and varying IRES sequences or 24 hour luminescence (Figure 9B).
[59] Figure 10 depicts 24 hour luminescence in supernatant of primary T cells (Figure 10A) after transduction with circular RNA or modified linear RNA comprising a Gaussia luciferase expression sequence, or relative luminescence over 3 days (Figure 10B), and 24 hour luminescence in PBMCs (Figure 10C).
[60] Figure 11 depicts HPLC chromatograms (Figure 11A) and circularization efficiencies (Figure 11B) of RNA constructs having different permutation sites.
[61] Figure 12 depicts HPLC chromatograms (Figure 12A) and circularization efficiencies (Figure 12B) of RNA constructs having different introns and / or permutation sites.
[62] Figure 13 depicts HPLC chromatograms (Figure 13A) and circularization efficiencies (Figure 13B) of 3 RNA constructs with or without homology arms.
[63] Figure 14 depicts circularization efficiencies of 3 RNA constructs without homology arms or with homology arms having various lengths and GC content.
[64] Figure 15A and 15B depict HPLC HPLC chromatograms showing the contribution of strong homology arms to improved splicing efficiency, the relationship between circularization efficiency and nicking in select constructs, and combinations of permutations sites and homology arms hypothesized to demonstrate improved circularization efficiency.
[65] Figure 16 shows fluorescent images of T cells mock electroporated (left) or electroporated with circular RNA encoding a CAR (right) and co-cultured with Raji cells expressing GFP and firefly luciferase.
[66] Figure 17 shows bright field (left), fluorescent (center), and overlay (right) images of T cells mock electroporated (top) or electroporated with circular RNA encoding a CAR (bottom) and co-cultured with Raji cells expressing GFP and firefly luciferase.
[67] Figure 18 depicts specific lysis of Raji target cells by T cells mock electroporated or electroporated with circular RNA encoding different CAR sequences.
[68] Figure 19 depicts luminescence in supernatants of Jurkat cells (left) or resting primary human CD3+ T cells (right) 24 hours after transduction with linear or circular RNA comprising a Guaussia luciferase expression sequence and varying IRES sequences (Figure 19A), and relative luminescence over 3 days (Figure 19B).
[69] Figure 20 depicts transcript induction of IFN-B1 (Fig. 20A), RIG-I (Fig. 20B), IL-2 (Fig. 200), IL-6 (Fig. 20D), IFNy (Fig. 20E), and TNFa (Fig. 20F) after electroporation of human CD3+ T cells with modified linear, unpurified circular, or purified circular RNA.
[70] Figure 21 depicts specific lysis of Raji target cells by human primary CD3+ T cells electroporated with circRNA encoding a CAR as determined by detection of firefly luminescence (Figure 21A), and IFNy transcript induction 24 hours after electroporation with different quantities of circular or linear RNA encoding a CAR sequence (Figure 21B). [711 Figure 22 depicts specific lysis of target or non-target cells by human primary CD3+ T cells electroporated with circular or linear RNA encoding a CAR at different E:T ratios (Figure 22A and Figure 22B) as determined by detection of firefly luminescence.
[72] Figure 23 depicts specific lysis of target cells by human CD3+ T cells electroporated with RNA encoding a CAR at 1, 3, 5, and 7 days post electroporation.
[73] Figure 24 depicts specific lysis of target cells by human CD3+ T cells electroporated with circular RNA encoding a CD19 or BCMA targeted CAR.
[74] Figure 25 depicts RNAFold predictions of precursor RNA secondary structure for homology arm design. Darker bases indicates higher base pairing probability. Without homology arms, no base pairing is predicted to occur between the ends of the precursor molecule.
[75] Figure 26 depicts agarose gel confirmation of precursor RNA circularization. C: precursor RNA (with strong homology arms) subjected to circularization conditions. C +R: Lane C, digested with RNase R. C +R + H: Lane C +R, digested with oligonucleotide-guided RNase H. U: precursor RNA not subjected to circularization conditions. U + H: Lane U, digested with oligonucleotide-guided RNase H. [761 Figure 27 depicts Sanger sequencing output of RT-PCR across the splice junction of the sample depicted in lane C + R from Figure 26. [771 Figure 28 depicts RNAFold predictions of precursor RNA secondary structure in the context of designed spacers. Secondary structures potentially important for ribozyme function are identified by black arrows.
[78] Figure 29 depicts an agarose gel demonstrating the effect of spacers on splicing. (—): no spacer. D: disruptive spacer. P1: permissive spacer 1. P2: permissive spacer 2. ¢ RNAFold predictions of precursor RNA secondary structure for internal homology region design. Lack of significant internal homology (Anabaena 1.0) and introduced internal homology (Anabaena 2.0) indicated by black arrows. Splicing bubble indicated as the region between homology arms and internal homology regions that contains the splicing ribozyme. [791 Figure 30 is a schematic diagram showing elements of the engineered self- splicing precursor RNA design.
[80] Figure 31 shows luminescence in the supernatant of HEK293 (left, black outline) and HeLa (right, gray outline) cells 24 h after transfection with CVB3-GLuc-pAC circRNA or modified or unmodified linear GLuc mRNA (n =4 HEK293, n=3 HeLa).
[81] Figure 32 shows luminescence in the supernatant of HEK293 cells starting 24 h after transfection with CVB3-GLuc-pAC circRNA or modified or unmodified linear GLuc mRNA and continuing for 6 days (n=4).
[82] Figure 33 gives an overview of precursor RNA design and self-splicing. Shading denotes different regions of RNAs described herein.
[83] Figure 34 depicts cell viability, circRNA expression stability, and cytokine release from A549 cells transfected with different circRNA preparations (+RNase R, unpurified circRNA digested with RNase R only; +HPLC, unpurified circRNA HPLC purified, and then digested with RNase R; +Phos, unpurified circRNA HPLC purified, treated with a phosphatase, and then digested with RNase R). Cell viability was assessed 3 days after transfection. Cytokine release was assessed 24 h after transfection (data presented as means + SDs; n = 3; *p < 0.05; ND, not detected).
[84] Figure 35 depicts schematics of RNAs introduced and used for TLR experiments. Linearized circRNAs contain all of the same sequence elements as spliced circRNA due to deletions encompassing both the introns and the homology arms.
[85] Figure 36 shows the surface expression of anti-CD19 CAR on primary human T-cells isolated from four donors and electroporated with circRNA. [861 Figure 37A shows the proportion of CAR+ of live T cells electroporated with circRNA (Figure 37A) and the proportion of CD4 and CD8 positive T cells in the 4 human donors in Figure 36 (Figure 37B).
[87] Figure 38 shows the efficacy of T cells mock electroporated, or electroporated with anti-CD19 CAR-encoding circRNA or linear RNA, in reducing the bioluminescence of luciferase-expressing CD 19+ target cells and CD19- non-target cells.
[88] Figure 39 shows the efficacy of T-cells electroporated with anti-CD19 CAR- encoding circRNAs having different IRES and co-cultured with luciferase-expressing Raji or K562 cells 5 days (Figure 39A) or 1 day (Figure 39B) after electroporation. (Oro-B1 = circKymriah; CVB3 IRES, Oro-152 = circKymriah; Salivirus SZ1 IRES, L9a-5 permutation site)
[89] Figure 40 shows the lysis of target and non-target cells by T cells electroporated with circRNA encoding anti-CD19 CAR. Figure 40A shows the lysis of CD19+ Raji cells and CD19- K562 cells by primary human T cells electroporated with circRNA having an anti-CD19 CAR expression sequence and a CVB3 IRES or a Salivirus SZ1 IRES. Figure 40B shows the lysis of CD19+ Raji cells and CD19- K562 cells by primary human T cells electroporated with different ratios of circRNA having an anti-CD19 CAR expression sequence or linear mRNA. Figure 40C shows the lysis of CD19+ Raji cells and CD19- K562 cells by different ratios of primary human T cells electroporated with circRNA having an anti-CD19 CAR expression sequence.
[90] Figure 41 shows the efficacy of T-cells electroporated with anti-CD19 CAR- encoding circRNAs in lysing CD19+ Raji cells as compared to T-cells transduced with anti- CD19 CAR-encoding lentivirus. Figure 41A shows the specific lysis of anti-CD19 CAR- encoding circRNAs in lysing CD19+ Raji cells as compared to T-cell transduced with anti- CD19 CAR-encoding lentivirus at a ratio of 10 Raji cells to one T-cell. Figure 41B shows the percentage of anti-CD19 CAR expressing T cells that were mock electroporated or electroporated with anti-CD19 CAR-encoding lentivirus or circRNA. Figure 41C shows the induction of interferon gamma mRNA in T-cells electroporated with anti-CD19 CAR- encoding circRNAs co-cultured in the presence or absence of CD19+ Raji cells. (Oro-Bl = circKymriah; CVB3 IRES, Oro-B6 = linKymriah)
[91] Figure 42 shows the stability of anti-CD19 CAR expression in primary human CD3+ T cells electroporated with anti-CD19CAR-encoding circRNA or linear mRNA.
[92] Figure 43 shows the efficacy of THP-1 monocytes electroporated with a CAR- encoding circRNA in lysing luciferase-expressing Raji cells in co-culture experiments. [931 Figure 44 shows the efficacy of T-cells electroporated with anti-murine CD19 CAR encoding circRNAs in lysing CD19+ A20 cells and CD19- K562 cells. DETAILED DESCRIPTION
[94] Provided herein are pharmaceutical compositions and transfer vehicles, e.g., lipid nanoparticles, comprising circular RNA. The circular RNA provided herein may be delivered and / or targeted to a cell in a transfer vehicle, e.g., a nanoparticle, or a composition comprising a transfer vehicle. In some embodiments, the circular RNA may also be delivered to a subject in a transfer vehicle or a composition comprising a transfer vehicle. In some embodiments, the transfer vehicle is a nanoparticle. In some embodiments, the nanoparticle is a lipid nanoparticle, a non-lipid polymeric core-shell nanoparticle, or a biodegradable nanoparticle. In some embodiments, the transfer vehicle comprises one or more ionizable lipids, PEG modified lipids, helper lipids, and / or structural lipids.
[95] In some embodiments, a transfer vehicle encapsulates circular RNA and comprises an ionizable lipid, a structural lipid, and a PEG-modified lipid. In some embodiments, a transfer vehicle encapsulates circular RNA and comprises an ionizable lipid, a structural lipid, a PEG- modified lipid, and a helper lipid.
[96] Without wishing to be bound by theory, it is thought that transfer vehicles described herein shield encapsulated circular RNA from degradation and provide for effective delivery of circular RNA to target cells in vivo and in vitro.
[97] Embodiments of the present disclosure provide lipid compositions described according to the respective molar ratios of the component lipids in the formulation. In one embodiment, the mol-% of the ionizable lipid may be from about 10 mol-% to about 80 mol-%. In one embodiment, the mol-% of the ionizable lipid may be from about 20 mol-% to about 70 mol- %. In one embodiment, the mol-% of the ionizable lipid may be from about 30 mol-% to about 60 mol-%. In one embodiment, the mol-% of the ionizable lipid may be from about 35 mol-% to about 55 mol-%. In one embodiment, the mol-% of the ionizable lipid may be from about 40 mol-% to about 50 mol-%. In some embodiments, the ionizable lipid mol-% of the transfer vehicle batch will be +30%, +25%, 20%, +15%, 10%, +5%, or +2.5% of the target mol-%. In certain embodiments, transfer vehicle inter-lot variability will be less than 15%, less than 10% or less than 5%.
[98] In one embodiment, the mol-% of the helper lipid may be from about 1 mol-% to about 50 mol-%. In one embodiment, the mol-% of the helper lipid may be from about 2 mol-% to about 45 mol-%. In one embodiment, the mol-% of the helper lipid may be from about 3 mol- % to about 40 mol-%. In one embodiment, the mol-% of the helper lipid may be from about 4 mol-% to about 35 mol-%. In one embodiment, the mol-% of the helper lipid may be from about 5 mol-% to about 30 mol-%. In one embodiment, the mol-% of the helper lipid may be from about 10 mol-% to about 20 mol-%.In some embodiments, the helper lipid mol-% of the transfer vehicle batch will be 30%, +25%, 20%, +15%, 10%, +5%, or +2.5% of the target mol-%.
[99] In one embodiment, the mol-% of the structural lipid may be from about 10 mol-% to about 80 mol-%. In one embodiment, the mol-% of the structural lipid may be from about 20 mol-% to about 70 mol-%. In one embodiment, the mol-% of the structural lipid may be from about 30 mol-% to about 60 mol-%. In one embodiment, the mol-% of the structural lipid may be from about 35 mol-% to about 55 mol-%. In one embodiment, the mol-% of the structural lipid may be from about 40 mol-% to about 50 mol-%. In some embodiments, the structural lipid mol-% of the transfer vehicle batch will be 30%, 25%, ¥20%, +15%, *10%, 5%, or +2.5% of the target mol-%.
[100] In one embodiment, the mol-% of the PEG modified lipid may be from about 0.1 mol- % to about 10 mol-%. In one embodiment, the mol-% of the PEG modified lipid may be from about 0.2 mol-% to about 5 mol-%. In one embodiment, the mol-% of the PEG modified lipid may be from about 0.5 mol-% to about 3 mol-%. In one embodiment, the mol-% of the PEG modified lipid may be from about 1 mol-% to about 2 mol-%. In one embodiment, the mol-% of the PEG modified lipid may be about 1.5 mol-%. In some embodiments, the PEG modified lipid mol-% of the transfer vehicle batch will be 30%, +25%, ¥20%, +15%, *10%, 5%, or +2.5% of the target mol-%.
[101] Also contemplated are pharmaceutical compositions, and in particular transfer vehicles, that comprise one or more of the compounds disclosed herein. In certain embodiments, such transfer vehicles comprise one or more of a PEG-modified lipid, an ionizable lipid, a helper lipid, and / or a structural lipid disclosed herein. Also contemplated are transfer vehicles that comprise one or more of the compounds disclosed herein and that further comprise one or more additional lipids. In certain embodiments, such transfer vehicles are loaded with or otherwise encapsulate circular RNA.
[102] Transfer vehicles of the invention encapsulate circular RNA. In certain embodiments, the polynucleotides encapsulated by the compounds or pharmaceutical and liposomal compositions of the invention include RNA encoding a protein or enzyme (e.g., circRNA encoding, for example, phenylalanine hydroxylase (PAH)). The present invention contemplates the use of such polynucleotides as a therapeutic that is capable of being expressed by target cells for the production (and in certain instances, the excretion) of a functional enzyme or protein as disclosed, for example, in International Application No. PCT / US2010 / 058457 and in U.S. Provisional Application No. 61 / 494,881, filed Jun. 8, 2011, the teachings of which are both incorporated herein by reference in their entirety. For example, in certain embodiments, upon the expression of one or more polynucleotides by target cells, the production of a functional enzyme or protein in which a subject is deficient (e.g., a urea cycle enzyme or an enzyme associated with a lysosomal storage disorder) may be observed. As another example, circular RNA encapsulated by a transfer vehicle may encode a T cell receptor protein or a chimeric antigen receptor (CAR).
[103] Also provided herein are methods of treating a disease in a subject by administering an effective amount of a composition comprising circular RNA encoding a functional protein and a transfer vehicle described herein to the subject. In some embodiments, the circular RNA is encapsulated within the transfer vehicle. In certain embodiments, such methods may enhance (e.g., increase) the expression of a polynucleotide and / or increase the production and secretion of a functional polypeptide product in one or more target cells and tissues (e.g., hepatocytes). Generally, such methods comprise contacting the target cells with one or more compounds and / or transfer vehicles that comprise or otherwise encapsulate the circRNA.
[104] In certain embodiments, the transfer vehicles (e.g., lipid nanoparticles) are formulated based in part upon their ability to facilitate the transfection (e.g., of a circular RNA) of a target cell. In another embodiment, the transfer vehicles (e.g., lipid nanoparticles) may be selected and / or prepared to optimize delivery of circular RNA to a target cell, tissue or organ. For example, if the target cell is a hepatocyte the properties of the pharmaceutical and / or liposomal compositions (e.g., size, charge and / or pH) may be optimized to effectively deliver such composition (e.g., lipid nanoparticles) to the target cell or organ, reduce immune clearance and / or promote retention in the target cell or organ. Alternatively, if the target tissue is the central nervous system, the selection and preparation of the transfer vehicle must consider penetration of, and retention within. the blood brain barrier and / or the use of alternate means of directly delivering such compositions (e.g., lipid nanoparticles) to such target tissue (e.g., via intracerebrovascular administration). In certain embodiments, the transfer vehicles may be combined with agents that facilitate the transfer of encapsulated materials across the blood brain barrier (e.g., agents which disrupt or improve the permeability of the blood brain barrier and thereby enhance the transfer of circular RNA to the target cells). While the transfer vehicles described herein (e.g., lipid nanoparticles) can facilitate introduction of circRNA into target cells, the addition of polycations (e.g., poly L-lysine and protamine) as a copolymer to one or more of the lipid nanoparticles that comprise the pharmaceutical compositions can in some instances markedly enhance the transfection efficiency of several types of transfer vehicles by 2-28 fold in a number of cell lines both in vitro and in vivo (See, N. I. Caplen, et al., Gene Ther. 1995; 2: 603; S. Li, et al., Gene Ther. 1997; 4, 891.). In some embodiments, a target cell is an immune cell. In some embodiments, a target cell is a T cell.
[105] In certain embodiments, the transfer vehicles described herein (e.g., lipid nanoparticles) are prepared by combining multiple lipid components (e.g., one or more of the compounds disclosed herein) with one or more polymer components. For example, a lipid nanoparticle may be prepared using HGT4003, DOPE, cholesterol and DMG-PEG2000. A lipid nanoparticle may be comprised of additional lipid combinations in various ratios, including for example, HGT4001, DOPE and DMG-PEG2000. The selection of ionizable lipids, helper lipids, structural lipids, and / or PEG-modified lipids which comprise the lipid nanoparticles, as well as the relative molar ratio of such lipids to each other, is based upon the characteristics of the selected lipid(s), the nature of the intended target cells or tissues and the characteristics of the materials or polynucleotides to be delivered by the lipid nanoparticle. Additional considerations include, for example, the saturation of the alkyl chain, as well as the size, charge, pH, pKa, fusogenicity and toxicity of the selected lipid(s).
[106] Transfer vehicles described herein can allow the encapsulated polynucleotide to reach the target cell or may preferentially allow the encapsulated polynucleotide to reach the target cells or organs on a discriminatory basis (e.g., the transfer vehicles may concentrate in the liver or spleen of a subject to which such transfer vehicles are administered). Alternatively, the transfer vehicles may limit the delivery of encapsulated polynucleotides to other non-targeted cells or organs where the presence of the encapsulated polynucleotides may be undesirable or of limited utility.
[107] Loading or encapsulating a polynucleotide, e.g., circRNA, into a transfer vehicle may serve to protect the polynucleotide from an environment (e.g., serum) which may contain enzymes or chemicals that degrade such polynucleotides and / or systems or receptors that cause the rapid excretion of such polynucleotides. Accordingly, in some embodiments, the compositions described herein are capable of enhancing the stability of the encapsulated polynucleotide(s), particularly with respect to the environments into which such polynucleotides will be exposed.
[108] In certain embodiments, provided herein is a vector for making circular RNA, the vector comprising a 5° duplex forming region, a 3° group I intron fragment, optionally a first spacer, an Internal Ribosome Entry Site (IRES), an expression sequence, optionally a second spacer, a 5° group I intron fragment, and a 3’ duplex forming region. In some embodiments, these elements are positioned in the vector in the above order. In some embodiments, the vector further comprises an internal 5° duplex forming region between the 3” group I intron fragment and the IRES and an internal 3” duplex forming region between the expression sequence and the 5° group I intron fragment. In some embodiments, the internal duplex forming regions are capable of forming a duplex between each other but not with the external duplex forming regions. In some embodiments, the internal duplex forming regions are part of the first and second spacers. Additional embodiments include circular RNA polynucleotides, including circular RNA polynucleotides made using the vectors provided herein, compositions comprising such circular RNA, cells comprising such circular RNA, methods of using and making such vectors, circular RNA, compositions and cells.
[109] In some embodiments, provided herein are methods comprising administration of circular RNA polynucleotides provided herein into cells for therapy or production of useful proteins, such as chimeric antigen receptor (CAR) or T Cell Receptor (TCR) complex proteins. In some embodiments, the method is advantageous in providing the production of a desired polypeptide inside eukaryotic cells with a longer half-life than linear RNA, due to the resistance of the circular RNA to ribonucleases.
[110] Circular RNA polynucleotides lack the free ends necessary for exonuclease-mediated degradation, causing them to be resistant to several mechanisms of RNA degradation and granting extended half-lives when compared to an equivalent linear RNA. Circularization allows for the stabilization of RNA polynucleotides that generally suffer from short half-lives and improves the overall efficacy of exogenous mRNA in a variety of applications. In an embodiment, the half-life of the circular RNA polynucleotides provided herein in eukaryotic cells (e.g., mammalian cells, such as human cells) is at least 20 hours (e.g., at least 80 hours). 1. Definitions
[111] As used herein, the terms “circRNA” or “circular polyribonucleotide” or “circular RNA” are used interchangeably and refers to a polyribonucleotide that forms a circular structure through covalent bonds.
[112] As used herein, the term “3” group I intron fragment” refers to a sequence with 75% or higher similarity to the 3’-proximal end of a natural group I intron including the splice site dinucleotide and optionally a stretch of natural exon sequence.
[113] As used herein, the term “5° group I intron fragment” refers to a sequence with 75% or higher similarity to the 5’-proximal end of a natural group I intron including the splice site dinucleotide and optionally a stretch of natural exon sequence.
[114] As used herein, the term “permutation site” refers to the site in a group I intron where a cut is made prior to permutation of the intron. This cut generates 3’ and 5° group I intron fragments that are permuted to be on either side of a stretch of precursor RNA to be circularized.
[115] As used herein, the term “splice site” refers to a dinucleotide that is partially or fully included in a group I intron and between which a phosphodiester bond is cleaved during RNA circularization.
[116] As used herein, the term “therapeutic protein” refers to any protein that, when administered to a subject directly or indirectly in the form of a translated nucleic acid, has a therapeutic, diagnostic, and / or prophylactic effect and / or elicits a desired biological and / or pharmacological effect.
[117] As used herein, the term “immunogenic” refers to a potential to induce an immune response to a substance. An immune response may be induced when an immune system of an organism or a certain type of immune cell is exposed to an immunogenic substance. The term “non-immunogenic” refers to a lack of or absence of an immune response above a detectable threshold to a substance. No immune response is detected when an immune system of an organism or a certain type of immune cell is exposed to a non-immunogenic substance. In some embodiments, a non-immunogenic circular polyribonucleotide as provided herein, does not induce an immune response above a pre-determined threshold when measured by an immunogenicity assay. In some embodiments, no innate immune response is detected when an immune system of an organism or a certain type of immune cell is exposed to a non- immunogenic circular polyribonucleotide as provided herein. In some embodiments, no adaptive immune response is detected when an immune system of an organism or a certain type of immune cell is exposed to a non-immunogenic circular polyribonucleotide as provided herein.
[118] As used herein, the term “circularization efficiency” refers to a measurement of resultant circular polyribonucleotide as compared to its linear starting material.
[119] As used herein, the term “translation efficiency” refers to a rate or amount of protein or peptide production from a ribonucleotide transcript. In some embodiments, translation efficiency can be expressed as amount of protein or peptide produced per given amount of transcript that codes for the protein or peptide.
[120] The term “nucleotide” refers to a ribonucleotide, a deoxyribonucleotide, a modified form thereof, or an analog thereof. Nucleotides include species that comprise purines, e.g., adenine, hypoxanthine, guanine, and their derivatives and analogs, as well as pyrimidines, e.g., cytosine, uracil, thymine, and their derivatives and analogs. Nucleotide analogs include nucleotides having modifications in the chemical structure of the base, sugar and / or phosphate, including, but not limited to, 5’-position pyrimidine modifications, 8’-position purine modifications, modifications at cytosine exocyclic amines, and substitution of 5-bromo-uracil; and 2’-position sugar modifications, including but not limited to, sugar-modified ribonucleotides in which the 2’-OH is replaced by a group such as an H, OR, R, halo, SH, SR, NH2, NHR, NR2, or CN, wherein R is an alkyl moiety as defined herein. Nucleotide analogs are also meant to include nucleotides with bases such as inosine, quenosine, xanthine; sugars such as 2’-methyl ribose; non-natural phosphodiester linkages such as methylphosphonate, phosphorothioate and peptide linkages. Nucleotide analogs include 5-methoxyuridine, 1- methylpseudouridine, and 6-methyladenosine.
[121] The term “nucleic acid” and “polynucleotide” are used interchangeably herein to describe a polymer of any length, e.g., greater than about 2 bases, greater than about 10 bases, greater than about 100 bases, greater than about 500 bases, greater than 1000 bases, or up to about 10,000 or more bases, composed of nucleotides, e.g., deoxyribonucleotides or ribonucleotides, and may be produced enzymatically or synthetically (e.g., as described in U.S. Pat. No. 5,948,902 and the references cited therein), which can hybridize with naturally occurring nucleic acids in a sequence specific manner analogous to that of two naturally occurring nucleic acids, e.g., can participate in Watson-Crick base pairing interactions. Naturally occurring nucleic acids are comprised of nucleotides including guanine, cytosine, adenine, thymine, and uracil (G, C, A, T, and U respectively).
[122] The terms “ribonucleic acid” and “RNA” as used herein mean a polymer composed of ribonucleotides.
[123] The terms “deoxyribonucleic acid” and “DNA” as used herein mean a polymer composed of deoxyribonucleotides.
[124] “Isolated” or “purified” generally refers to isolation of a substance (for example, in some embodiments, a compound, a polynucleotide, a protein, a polypeptide, a polynucleotide composition, or a polypeptide composition) such that the substance comprises a significant percent (e.g., greater than 1%, greater than 2%, greater than 5%, greater than 10%, greater than 20%, greater than 50%, or more, usually up to about 90%-100%) of the sample in which it resides. In certain embodiments, a substantially purified component comprises at least 50%, 80%-85%, or 90%-95% of the sample. Techniques for purifying polynucleotides and polypeptides of interest are well-known in the art and include, for example, ion-exchange chromatography, affinity chromatography and sedimentation according to density. Generally, a substance is purified when it exists in a sample in an amount, relative to other components of the sample, that is more than as it is found naturally.
[125] The terms “duplexed,” “double-stranded” or “hybridized” as used herein refer to nucleic acids formed by hybridization of two single strands of nucleic acids containing complementary sequences. In most cases, genomic DNA is double-stranded. Sequences can be fully complementary or partially complementary.
[126] As used herein, “unstructured” with regard to RNA refers to an RNA sequence that is not predicted by the RNAFold software or similar predictive tools to form a structure (e.g., a hairpin loop) with itself or other sequences in the same RNA molecule. In some embodiments, unstructured RNA can be functionally characterized using nuclease protection assays.
[127] As used herein, “structured” with regard to RNA refers to an RNA sequence that is predicted by the RNAFold software or similar predictive tools to form a structure (e.g., a hairpin loop) with itself or other sequences in the same RNA molecule.
[128] As used herein, two “duplex forming regions,” “homology arms,” or "homology regions,” complement, or are complementary, to one another when the two regions share a sufficient level of sequence identity to one another’s reverse complement to act as substrates for a hybridization reaction. As used herein polynucleotide sequences have “homology” when they are either identical or share sequence identity to a reverse complement or “complementary” sequence. The percent sequence identity between a homology region and a counterpart homology region’s reverse complement can be any percent of sequence identity that allows for hybridization to occur. In some embodiments, an internal duplex forming region of an inventive polynucleotide is capable of forming a duplex with another internal duplex forming region and does not form a duplex with an external duplex forming region.
[129] Linear nucleic acid molecules are said to have a “5’-terminus” (5° end) and a “3’- terminus” (3’ end) because nucleic acid phosphodiester linkages occur at the 5° carbon and 3’ carbon of the sugar moieties of the substituent mononucleotides. The end nucleotide of a polynucleotide at which a new linkage would be to a 5’ carbon is its 5° terminal nucleotide. The end nucleotide of a polynucleotide at which a new linkage would be to a 3’ carbon is its 3’ terminal nucleotide. A terminal nucleotide, as used herein, is the nucleotide at the end position of the 3’- or 5’-terminus.
[130] “Transcription” means the formation or synthesis of an RNA molecule by an RNA polymerase using a DNA molecule as a template. The invention is not limited with respect to the RNA polymerase that is used for transcription. For example, in some embodiments, a T7- type RNA polymerase can be used.
[131] “Translation” means the formation of a polypeptide molecule by a ribosome based upon an RNA template.
[132] Tt is to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a cell” includes combinations of two or more cells, or entire cultures of cells; reference to “a polynucleotide” includes, as a practical matter, many copies of that polynucleotide. Unless specifically stated or obvious from context, as used herein, the term “or” is understood to be inclusive. Unless defined herein and below in the reminder of the specification, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
[133] Unless specifically stated or obvious from context, as used herein, the term “about,” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. “About” can be understood as within 10%, 9%, 8%, 7%, 6%, 5%. 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, or 0.01% of the stated value. Unless otherwise clear from the context, all numerical values provided herein are modified by the term “about.”
[134] As used herein, the term “encode” refers broadly to any process whereby the information in a polymeric macromolecule is used to direct the production of a second molecule that is different from the first. The second molecule may have a chemical structure that is different from the chemical nature of the first molecule.
[135] By "co-administering” is meant administering a therapeutic agent provided herein in conjunction with one or more additional therapeutic agents sufficiently close in time such that the therapeutic agent provided herein can enhance the effect of the one or more additional therapeutic agents, or vice versa.
[136] The terms “treat,” and “prevent” as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. The treatment or prevention provided by the method disclosed herein can include treatment or prevention of one or more conditions or symptoms of the disease. Also, for purposes herein, “prevention” can encompass delaying the onset of the disease, or a symptom or condition thereof.
[137] As used herein, the term “expression sequence” can refer to a nucleic acid sequence that encodes a product, e.g., a peptide or polypeptide, regulatory nucleic acid, or non-coding nucleic acid. An exemplary expression sequence that codes for a peptide or polypeptide can comprise a plurality of nucleotide triads, each of which can code for an amino acid and is termed as a “codon”.
[138] As used herein, a "spacer” refers to a region of a polynucleotide sequence ranging from 1 nucleotide to hundreds or thousands of nucleotides separating two other elements along a polynucleotide sequence. The sequences can be defined or can be random. A spacer is typically non-coding. In some embodiments, spacers include duplex forming regions.
[139] As used herein, “splice site” refers to the dinucleotide or dinucleotides between which cleavage of the phosphodiester bond occurs during a splicing reaction. A “5” splice site” refers to the natural 5° dinucleotide of the intron e.g., group I intron, while a “3” splice site” refers to the natural 3’ dinucleotide of the intron.
[140] As used herein, an “internal ribosome entry site” or “IRES” refers to an RNA sequence or structural element ranging in size from 10 nt to 1000 nt or more , capable of initiating translation of a polypeptide in the absence of a typical RNA cap structure. An IRES is typically about 500 nt to about 700 nt in length.
[141] As used herein, an "miRNA site" refers to a stretch of nucleotides within a polynucleotide that is capable of forming a duplex with at least 8 nucleotides of a natural miRNA sequence.
[142] As used herein, an "endonuclease site" refers to a stretch of nucleotides within a polynucleotide that is capable of being recognized and cleaved by an endonuclease protein.
[143] As used herein, “bicistronic RNA” refers to a polynucleotide that includes two expression sequences coding for two distinct proteins. These expression sequences are often separated by a cleavable peptide such as a 2A site or an IRES sequence.
[144] As used herein, the term “co-formulate” refers to a nanoparticle formulation comprising two or more nucleic acids or a nucleic acid and other active drug substance. Typically, the ratios are equimolar or defined in the ratiometric amount of the two or more nucleic acids or the nucleic acid and other active drug substance.
[145] As used herein, “transfer vehicle” includes any of the standard pharmaceutical carriers, diluents, excipients, and the like, which are generally intended for use in connection with the administration of biologically active agents, including nucleic acids.
[146] As used herein, the phrase “lipid nanoparticle” refers to a transfer vehicle comprising one or more lipids (e.g., in some embodiments, cationic lipids, non-cationic lipids, and PEG- modified lipids).
[147] As used herein, the phrase “cationic lipid” refers to any of a number of lipid species that carry a net positive charge at a selected pH, such as physiological pH.
[148] As used herein, the phrase “non-cationic lipid” refers to any neutral, zwitterionic or anionic lipid.
[149] As used herein, the phrase “anionic lipid” refers to any of a number of lipid species that carry a net negative charge at a selected pH, such as physiological pH.
[150] As used herein, the phrase “ionizable lipid” refers to any of a number of lipid species that carry a net positive charge at a selected pH, such as physiological pH 4 and a neutral charge at other pHs such as physiological pH 7.
[151] In some embodiments, a lipid, e.g., an ionizable lipid, disclosed herein comprises one or more cleavable groups. The terms “cleave” and “cleavable” are used herein to mean that one or more chemical bonds (e.g., one or more of covalent bonds, hydrogen-bonds, van der Waals’ forces and / or ionic interactions) between atoms in or adjacent to the subject functional group are broken (e.g., hydrolyzed) or are capable of being broken upon exposure to selected conditions (e.g., upon exposure to enzymatic conditions). In certain embodiments, the cleavable group is a disulfide functional group, and in particular embodiments is a disulfide group that is capable of being cleaved upon exposure to selected biological conditions (e.g., intracellular conditions). In certain embodiments, the cleavable group is an ester functional group that is capable of being cleaved upon exposure to selected biological conditions. For example, the disulfide groups may be cleaved enzymatically or by a hydrolysis, oxidation or reduction reaction. Upon cleavage of such disulfide functional group, the one or more functional moieties or groups (e.g., one or more of a head-group and / or a tail-group) that are bound thereto may be liberated. Exemplary cleavable groups may include, but are not limited to, disulfide groups, ester groups, ether groups, and any derivatives thereof (e.g., alkyl and aryl esters). In certain embodiments, the cleavable group is not an ester group or an ether group. In some embodiments, a cleavable group is bound (e.g., bound by one or more of hydrogen-bonds, van der Waals' forces, ionic interactions and covalent bonds) to one or more functional moieties or groups (e.g., at least one head-group and at least one tail-group). In certain embodiments, at least one of the functional moieties or groups is hydrophilic (e.g., a hydrophilic head-group comprising one or more of imidazole, guanidinium, amino, imine, enamine, optionally- substituted alkyl amino and pyridyl).
[152] As used herein, the term “hydrophilic” is used to indicate in qualitative terms that a functional group is water-preferring, and typically such groups are water-soluble. For example, disclosed herein are compounds that comprise a cleavable disulfide (S—S) functional group bound to one or more hydrophilic groups (e.g., a hydrophilic head-group), wherein such hydrophilic groups comprise or are selected from the group consisting of imidazole, guanidinium, amino, imine, enamine, an optionally-substituted alkyl amino (e.g., an alkyl amino such as dimethylamino) and pyridyl.
[153] In certain embodiments, at least one of the functional groups of moieties that comprise the compounds disclosed herein is hydrophobic in nature (e.g., a hydrophobic tail-group comprising a naturally-occurring lipid such as cholesterol). As used herein, the term “hydrophobic” is used to indicate in qualitative terms that a functional group is water-avoiding, and typically such groups are not water soluble. For example, disclosed herein are compounds that comprise a cleavable functional group (e.g., a disulfide (S—S) group) bound to one or more hydrophobic groups, wherein such hydrophobic groups comprise one or more naturally occurring lipids such as cholesterol, and / or an optionally substituted, variably saturated or unsaturated Cs-Cao alkyl and / or an optionally substituted, variably saturated or unsaturated Ce- Cao acyl.
[154] In certain embodiments, the compounds disclosed herein comprise, for example, at least one hydrophilic head-group and at least one hydrophobic tail-group, each bound to at least one cleavable group, thereby rendering such compounds amphiphilic. As used herein to describe a compound or composition, the term “amphiphilic” means the ability to dissolve in both polar (e.g., water) and non-polar (e.g., lipid) environments. For example, in certain embodiments, the compounds disclosed herein comprise at least one lipophilic tail-group (e.g., cholesterol or a Ce-Coo alkyl) and at least one hydrophilic head-group (e.g., imidazole), each bound to a cleavable group (e.g., disulfide).
[155] Tt should be noted that the terms “head-group” and “tail-group” as used describe the compounds of the present invention, and in particular functional groups that comprise such compounds, are used for ease of reference to describe the orientation of one or more functional groups relative to other functional groups. For example, in certain embodiments a hydrophilic head-group (e.g., guanidinium) is bound (e.g., by one or more of hydrogen-bonds, van der Waals' forces, ionic interactions and covalent bonds) to a cleavable functional group (e.g., a disulfide group), which in turn is bound to a hydrophobic tail-group (e.g., cholesterol).
[156] As used herein, the term “alkyl” refers to both straight and branched chain Ci-Cao hydrocarbons (e.g., Cs-C20 hydrocarbons), and include both saturated and unsaturated hydrocarbons. In certain embodiments, the alkyl may comprise one or more cyclic alkyls and / or one or more heteroatoms such as oxygen, nitrogen, or sulfur and may optionally be substituted with substituents (e.g., one or more of alkyl, halo, alkoxyl, hydroxy, amino, aryl, ether, ester or amide). In certain embodiments, a contemplated alkyl includes (9Z,127Z)-octadeca-9,12- dien. The use of designations such as, for example, “Cs-C20” is intended to refer to an alkyl (e.g., straight or branched chain and inclusive of alkenes and alkyls) having the recited range carbon atoms.
[157] As used herein, the term “aryl” refers to aromatic groups (e.g., monocyclic, bicyclic and tricyclic structures) containing six to ten carbons in the ring portion. The aryl groups may be optionally substituted through available carbon atoms and in certain embodiments may include one or more heteroatoms such as oxygen, nitrogen or sulfur.
[158] In certain embodiments the compounds and the transfer vehicles of which such compounds are a component (e.g., lipid nanoparticles) exhibit an enhanced (e.g., increased) ability to transfect one or more target cells. Accordingly, also provided herein are methods of transfecting one or more target cells. Such methods generally comprise the step of contacting the one or more target cells with the compounds and / or pharmaceutical compositions disclosed herein such that the one or more target cells are transfected with the circular RNA encapsulated therein. As used herein, the terms “transfect” or “transfection” refer to the intracellular introduction of one or more encapsulated materials (e.g., nucleic acids and / or polynucleotides) into a cell, or preferably into a target cell. The term “transfection efficiency” refers to the relative amount of such encapsulated material (e.g., polynucleotides) up-taken by, introduced into and / or expressed by the target cell which is subject to transfection. In some embodiments, transfection efficiency may be estimated by the amount of a reporter polynucleotide product produced by the target cells following transfection. In some embodiments, a transfer vehicle has high transfection efficiency. In some embodiments, a transfer vehicle has at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% transfection efficiency.
[159] As used herein, the term “liposome” generally refers to a vesicle composed of lipids (e.g., amphiphilic lipids) arranged in one or more spherical bilayer or bilayers. In certain embodiments, the liposome is a lipid nanoparticle (e.g., a lipid nanoparticle comprising one or more of the ionizable lipid compounds disclosed herein). Such liposomes may be unilamellar or multilamellar vesicles which have a membrane formed from a lipophilic material and an aqueous interior that contains the encapsulated circRNA to be delivered to one or more target cells, tissues and organs. In certain embodiments, the compositions described herein comprise one or more lipid nanoparticles. Examples of suitable lipids (e.g., ionizable lipids) that may be used to form the liposomes and lipid nanoparticles contemplated include one or more of the compounds disclosed herein (e.g., HGT4001, HGT4002, HGT4003, HGT4004 and / or HGT4005). Such liposomes and lipid nanoparticles may also comprise additional ionizable lipids such as C12-200, DLin-KC2-DMA, and / or HGT5001, helper lipids, structural lipids, PEG-modified lipids, MC3, DLinDMA, DLinkC2DMA, ¢KK-E12, ICE, HGT5000, DODAC, DDAB, DMRIE, DOSPA, DOGS, DODAP, DODMA, DMDMA, DODAC, DLenDMA, DMRIE, CLinDMA, CpLinDMA, DMOBA, DOcarbDAP, DLinDAP, DLincarbDAP, DLinCDAP, KLin-K-DMA, DLin-K-XTC2-DMA, HGT4003, and combinations thereof.
[160] As used herein, the phrases “non-cationic lipid”, “non-cationic helper lipid”, and “helper lipid” are used interchangeably and refer to any neutral, zwitterionic or anionic lipid.
[161] As used herein, the phrase “anionic lipid” refers to any of a number of lipid species that carry a net negative charge at a selected pH, such as physiological pH.
[162] As used herein, the phrase “biodegradable lipid” or “degradable lipid” refers to any of a number of lipid species that are broken down in a host environment on the order of minutes, hours, or days ideally making them less toxic and unlikely to accumulate in a host over time. Common modifications to lipids include ester bonds, and disulfide bonds among others to increase the biodegradability of a lipid.
[163] As used herein, the phrase “biodegradable PEG lipid” or “degradable PEG lipid” refers to any of a number of lipid species where the PEG molecules are cleaved from the lipid in a host environment on the order of minutes, hours, or days ideally making them less immunogenic. Common modifications to PEG lipids include ester bonds, and disulfide bonds among others to increase the biodegradability of a lipid.
[164] In certain embodiments of the present invention, the transfer vehicles (e.g., lipid nanoparticles) are prepared to encapsulate one or more materials or therapeutic agents (e.g., circRNA). The process of incorporating a desired therapeutic agent (e.g., circRNA) into a transfer vehicle is referred to herein as or “loading” or “encapsulating” (Lasic, et al., FEBS Lett, 312: 255-258, 1992). The transfer vehicle-loaded or -encapsulated materials (e.g., circRNA) may be completely or partially located in the interior space of the transfer vehicle, within a bilayer membrane of the transfer vehicle, or associated with the exterior surface of the transfer vehicle.
[165] As used herein, the term “structural lipid” refers to sterols and also to lipids containing sterol moieties.
[166] As defined herein, “sterols” are a subgroup of steroids consisting of steroid alcohols.
[167] As used herein, the term “structural lipid” refers to sterols and also to lipids containing sterol moieties.
[168] As used herein, the term "PEG" means any polyethylene glycol or other polyalkylene ether polymer.
[169] As generally defined herein, a “PEG-OH lipid” (also referred to herein as “hydroxy- PEGylated lipid”) is a PEGylated lipid having one or more hydroxyl (-OH) groups on the lipid.
[170] As used herein, a “phospholipid” is a lipid that includes a phosphate moiety and one or more carbon chains, such as unsaturated fatty acid chains.
[171] The term “antibody” (Ab) includes, without limitation, a glycoprotein immunoglobulin which binds specifically to an antigen. In general, and antibody may comprise at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds, or an antigen- binding molecule thereof. Each H chain comprises a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region comprises three constant domains, CH1, CH2 and CH3. Each light chain comprises a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region comprises one constant domain, CL. The VH and VL regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL comprises three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the Abs may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component of the classical complement system. Antibodies may include, for example, monoclonal antibodies, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), human antibodies, engineered antibodies, humanized antibodies, chimeric antibodies, immunoglobulins, synthetic antibodies, tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, an antibody heavy chain monomer, an antibody light chain dimer, an antibody heavy chain dimer, an antibody light chain- antibody heavy chain pair, intrabodies, antibody fusions (sometimes referred to herein as “antibody conjugates”), heteroconjugate antibodies, single domain antibodies, monovalent antibodies, single chain antibodies or single- chain Fvs (scFv), camelized antibodies, affybodies, Fab fragments, F(ab’)2 fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-id) antibodies (including, e.g., anti-anti-Id antibodies), minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as “antibody mimetics”), and antigen-binding fragments of any of the above. In some embodiments, antibodies described herein refer to polyclonal antibody populations.
[172] An immunoglobulin may derive from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM. IgG subclasses are also well known to those in the art and include but are not limited to human IgG1, IgG2, IgG3 and IgG4. “Isotype” refers to the Ab class or subclass (e.g., IgM or IgG1) that is encoded by the heavy chain constant region genes. The term “antibody” includes, by way of example, both naturally occurring and non-naturally occurring Abs; monoclonal and polyclonal Abs; chimeric and humanized Abs; human or nonhuman Abs; wholly synthetic Abs; and single chain Abs. A nonhuman Ab may be humanized by recombinant methods to reduce its immunogenicity in man. Where not expressly stated, and unless the context indicates otherwise, the term “antibody” also includes an antigen-binding fragment or an antigen-binding portion of any of the aforementioned immunoglobulins, and includes a monovalent and a divalent fragment or portion, and a single chain Ab.
[173] An “antigen binding molecule,” “antigen binding portion,” or “antibody fragment” refers to any molecule that comprises the antigen binding parts (e.g., CDRs) of the antibody from which the molecule is derived. An antigen binding molecule may include the antigenic complementarity determining regions (CDRs). Examples of antibody fragments include, but are not limited to, Fab, Fab’, F(ab')2, and Fv fragments, dAb, linear antibodies, scFv antibodies, and multispecific antibodies formed from antigen binding molecules. Peptibodies (i.e. Fc fusion molecules comprising peptide binding domains) are another example of suitable antigen binding molecules. In some embodiments, the antigen binding molecule binds to an antigen on a tumor cell. In some embodiments, the antigen binding molecule binds to an antigen on a cell involved in a hyperproliferative disease or to a viral or bacterial antigen. In some embodiments, the antigen binding molecule binds to BCMA. In further embodiments, the antigen binding molecule is an antibody fragment that specifically binds to the antigen, including one or more of the complementarity determining regions (CDRs) thereof. In further embodiments, the antigen binding molecule is a single chain variable fragment (scFv). In some embodiments, the antigen binding molecule comprises or consists of avimers.
[174] As used herein, the term “variable region” or “variable domain” is used interchangeably and are common in the art. The variable region typically refers to a portion of an antibody, generally, a portion of a light or heavy chain, typically about the amino-terminal 110 to 120 amino acids in the mature heavy chain and about 90 to 115 amino acids in the mature light chain, which differ extensively in sequence among antibodies and are used in the binding and specificity of a particular antibody for its particular antigen. The variability in sequence is concentrated in those regions called complementarity determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR). Without wishing to be bound by any particular mechanism or theory, it is believed that the CDRs of the light and heavy chains are primarily responsible for the interaction and specificity of the antibody with antigen. In some embodiments, the variable region is a human variable region. In some embodiments, the variable region comprises rodent or murine CDRs and human framework regions (FRs). In particular embodiments, the variable region is a primate (e.g., non-human primate) variable region. In some embodiments, the variable region comprises rodent or murine CDRs and primate (e.g., non-human primate) framework regions (FRs).
[175] The terms “VL” and “VL domain” are used interchangeably to refer to the light chain variable region of an antibody or an antigen-binding molecule thereof.
[176] The terms “VH” and “VH domain” are used interchangeably to refer to the heavy chain variable region of an antibody or an antigen-binding molecule thereof.
[177] A number of definitions of the CDRs are commonly in use: Kabat numbering, Chothia numbering, AbM numbering, or contact numbering. The AbM definition is a compromise between the two used by Oxford Molecular’s AbM antibody modelling software. The contact definition is based on an analysis of the available complex crystal structures. The term “Kabat numbering” and like terms are recognized in the art and refer to a system of numbering amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen-binding molecule thereof. In certain aspects, the CDRs of an antibody may be determined according to the Kabat numbering system (see, e.g., Kabat EA & Wu TT (1971) Ann NY Acad Sci 190: 382-391 and Kabat EA et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). Using the Kabat numbering system, CDRs within an antibody heavy chain molecule are typically present at amino acid positions 31 to 35, which optionally may include one or two additional amino acids, following 35 (referred to in the Kabat numbering scheme as 35A and 35B) (CDR1), amino acid positions 50 to 65 (CDR2), and amino acid positions 95 to 102 (CDR3). Using the Kabat numbering system, CDRs within an antibody light chain molecule are typically present at amino acid positions 24 to 34 (CDR1), amino acid positions 50 to 56 (CDR?2), and amino acid positions 89 to 97 (CDR3). In a specific embodiment, the CDRs of the antibodies described herein have been determined according to the Kabat numbering scheme. In certain aspects, the CDRs of an antibody may be determined according to the Chothia numbering scheme, which refers to the location of immunoglobulin structural loops (see, e.g., Chothia C & Lesk AM, (1987), J Mol Biol 196: 901-917; Al-Lazikani B et al, (1997) J Mol Biol 273: 927-948; Chothia C et al., (1992) J Mol Biol 227: 799-817; Tramontano A et al, (1990) J Mol Biol 215(1): 175- 82; and U.S. Patent No. 7,709,226). Typically, when using the Kabat numbering convention, the Chothia CDR-H1 loop is present at heavy chain amino acids 26 to 32, 33, or 34, the Chothia CDR-H2 loop is present at heavy chain amino acids 52 to 56, and the Chothia CDR-H3 loop is present at heavy chain amino acids 95 to 102, while the Chothia CDR-L1 loop is present at light chain amino acids 24 to 34, the Chothia CDR-L2 loop is present at light chain amino acids 50 to 56, and the Chothia CDR-L3 loop is present at light chain amino acids 89 to 97. The end of the Chothia CDR-HI loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). In a specific embodiment, the CDRs of the antibodies described herein have been determined according to the Chothia numbering scheme.
[178] As used herein, the terms “constant region” and “constant domain” are interchangeable and have a meaning common in the art. The constant region is an antibody portion, e.g., a carboxyl terminal portion of a light and / or heavy chain which is not directly involved in binding of an antibody to antigen but which may exhibit various effector functions, such as interaction with the Fc receptor. The constant region of an immunoglobulin molecule generally has a more conserved amino acid sequence relative to an immunoglobulin variable domain.
[179] “Binding affinity” generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y may generally be represented by the dissociation constant (KD or Kd). Affinity may be measured and / or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (KD), and equilibrium association constant (KA or Ka). The KD is calculated from the quotient of koff / kon, whereas KA is calculated from the quotient of kon / koff. kon refers to the association rate constant of, e.g., an antibody to an antigen, and koff refers to the dissociation of, e.g., an antibody to an antigen. The kon and koff may be determined by techniques known to one of ordinary skill in the art, such as BIACORE® or KinExA.
[180] As used herein, a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). In some embodiments, one or more amino acid residues within a CDR(s) or within a framework region(s) of an antibody or antigen-binding molecule thereof may be replaced with an amino acid residue with a similar side chain.
[181] As, used herein, the term “heterologous” means from any source other than naturally occurring sequences.
[182] As used herein, an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody may specifically bind. An epitope may be, for example, contiguous amino acids of a polypeptide (linear or contiguous epitope) or an epitope can, for example, come together from two or more non-contiguous regions of a polypeptide or polypeptides (conformational, non-linear, discontinuous, or non-contiguous epitope). In some embodiments, the epitope to which an antibody binds may be determined by, e.g., NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays, hydrogen / deuterium exchange coupled with mass spectrometry (e.g., liquid chromatography electrospray mass spectrometry), array -based oligo-peptide scanning assays, and / or mutagenesis mapping (e.g., site- directed mutagenesis mapping). For X-ray crystallography, crystallization may be accomplished using any of the known methods in the art (e.g., Giege R er al., (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1- 23; Chayen NE (1997) Structure 5: 1269- 1274; McPherson A (1976) J Biol Chem 251: 6300- 6303). Antibody: antigen crystals may be studied using well known X-ray diffraction techniques and may be refined using computer software such as X- PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Meth Enzymol (1985) volumes 114 & 115, eds Wyckoff HW ez al.; U.S. 2004 / 0014194), and BUSTER (Bricogne G (1993) Acta Crystallogr D Biol Crystallogr 49(Pt 1): 37-60; Bricogne G (1997) Meth Enzymol 276A: 361- 423, ed Carter CW; Roversi P er al, (2000) Acta Crystallogr D Biol Crystallogr 56(Pt 10): 1316-1323).
[183] As used herein, an antigen binding molecule, an antibody, or an antigen binding molecule thereof “cross-competes” with a reference antibody or an antigen binding molecule thereof if the interaction between an antigen and the first binding molecule, an antibody, or an antigen binding molecule thereof blocks, limits, inhibits, or otherwise reduces the ability of the reference binding molecule, reference antibody, or an antigen binding molecule thereof to interact with the antigen. Cross competition may be complete, e.g., binding of the binding molecule to the antigen completely blocks the ability of the reference binding molecule to bind the antigen, or it may be partial, e.g., binding of the binding molecule to the antigen reduces the ability of the reference binding molecule to bind the antigen. In some embodiments, an antigen binding molecule that cross-competes with a reference antigen binding molecule binds the same or an overlapping epitope as the reference antigen binding molecule. In other embodiments, the antigen binding molecule that cross-competes with a reference antigen binding molecule binds a different epitope as the reference antigen binding molecule. Numerous types of competitive binding assays may be used to determine if one antigen binding molecule competes with another, for example: solid phase direct or indirect radioimmunoassay (RIA); solid phase direct or indirect enzyme immunoassay (EIA); sandwich competition assay (Stahli et al., 1983, Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (Kirkland et al., 1986, J. Immunol. 137:3614-3619); solid phase direct labeled assay, solid phase direct labeled sandwich assay (Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (Morel et al., 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (Cheung, er al., 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer er al., 1990, Scand. J. Immunol. 32:77-82).
[184] As used herein, the terms “immunospecifically binds,” “immunospecifically recognizes,” “specifically binds,” and “specifically recognizes” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope or immune complex) as such binding is understood by one skilled in the art. For example, a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, BIACORE®, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or other assays known in the art. In a specific embodiment, molecules that specifically bind to an antigen bind to the antigen with a KA that is at least 2 logs, 2.5 logs, 3 logs, 4 logs or greater than the KA when the molecules bind to another antigen.
[185] An “antigen” refers to any molecule that provokes an immune response or is capable of being bound by an antibody or an antigen binding molecule. The immune response may involve either antibody production, or the activation of specific immunologically -competent cells, or both. A person of skill in the art would readily understand that any macromolecule, including virtually all proteins or peptides, may serve as an antigen. An antigen may be endogenously expressed, i.e. expressed by genomic DNA, or may be recombinantly expressed. An antigen may be specific to a certain tissue, such as a cancer cell, or it may be broadly expressed. In addition, fragments of larger molecules may act as antigens. In some embodiments, antigens are tumor antigens.
[186] The term “autologous” refers to any material derived from the same individual to which it is later to be re-introduced. For example, the engineered autologous cell therapy (eACT™) method described herein involves collection of lymphocytes from a patient, which are then engineered to express, e.g., a CAR construct, and then administered back to the same patient.
[187] The term “allogeneic” refers to any material derived from one individual which is then introduced to another individual of the same species, e.g., allogeneic T cell transplantation.
[188] A “cancer” refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and may also metastasize to distant parts of the body through the lymphatic system or bloodstream. A “cancer” or “cancer tissue” may include a tumor. Examples of cancers that may be treated by the methods disclosed herein include, but are not limited to, cancers of the immune system including lymphoma, leukemia, myeloma, and other leukocyte malignancies. In some embodiments, the methods disclosed herein may be used to reduce the tumor size of a tumor derived from, for example , bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, multiple myeloma, Hodgkin's Disease, non- Hodgkin's lymphoma (NHL), primary mediastinal large B cell lymphoma (PMBC), diffuse large B cell lymphoma (DLBCL), follicular lymphoma (FL), transformed follicular lymphoma, splenic marginal zone lymphoma (SMZL), cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, cancer of the urethra, cancer of the penis, chronic or acute leukemia, acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia (ALL) (including non T cell ALL), chronic lymphocytic leukemia (CLL), solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, epidermoid cancer, squamous cell cancer, T cell lymphoma, environmentally induced cancers including those induced by asbestos, other B cell malignancies, and combinations of said cancers. In some embodiments, the methods disclosed herein may be used to reduce the tumor size of a tumor derived from, for example, sarcomas and carcinomas, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, Kaposi's sarcoma, sarcoma of soft tissue, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, hepatocellular carcinomna, lung cancer, colorectal cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma (for example adenocarcinoma of the pancreas, colon, ovary, lung, breast, stomach, prostate, cervix, or esophagus), sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer, testicular tumor, bladder carcinoma, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, carcinoma of the renal pelvis, CNS tumors (such as a glioma, astrocytoma, medulloblastoma, craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma and retinoblastoma). The particular cancer may be responsive to chemo- or radiation therapy or the cancer may be refractory. A refractor cancer refers to a cancer that is not amendable to surgical intervention and the cancer is either initially unresponsive to chemo- or radiation therapy or the cancer becomes unresponsive over time.
[189] An “anti-tumor effect” as used herein, refers to a biological effect that may present as a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, a decrease in the number of metastases, an increase in overall or progression-free survival, an increase in life expectancy, or amelioration of various physiological symptoms associated with the tumor. An anti-tumor effect may also refer to the prevention of the occurrence of a tumor, e.g., a vaccine.
[190] A “cytokine,” as used herein, refers to a non-antibody protein that is released by one cell in response to contact with a specific antigen, wherein the cytokine interacts with a second cell to mediate a response in the second cell. “Cytokine” as used herein is meant to refer to proteins released by one cell population that act on another cell as intercellular mediators. A cytokine may be endogenously expressed by a cell or administered to a subject. Cytokines may be released by immune cells, including macrophages, dendritic cells, B cells, T cells, and mast cells to propagate an immune response. Cytokines may induce various responses in the recipient cell. Cytokines may include homeostatic cytokines, chemokines, pro- inflammatory cytokines, effectors, and acute-phase proteins. For example, homeostatic cytokines, including interleukin (IL) 7 and IL-15, promote immune cell survival and proliferation, and pro- inflammatory cytokines may promote an inflammatory response. Examples of homeostatic cytokines include, but are not limited to, IL-2, IL-4, IL-5, IL-7, IL-10, IL-12p40, IL-12p70, IL- 15, and interferon (IFN) gamma. Examples of pro-inflammatory cytokines include, but are not limited to, IL-la, IL-1b, IL- 6, IL-13, IL-17a, IL-23, IL-27, tumor necrosis factor (TNF)-alpha, TNF-beta, fibroblast growth factor (FGF) 2, granulocyte macrophage colony-stimulating factor (GM-CSF), soluble intercellular adhesion molecule 1 (SICAM-1), soluble vascular adhesion molecule 1 (sVCAM-1), vascular endothelial growth factor (VEGF), VEGF-C, VEGF-D, and placental growth factor (PLGF). Examples of effectors include, but are not limited to, granzyme A, granzyme B, soluble Fas ligand (sFasL), TGF-beta, IL-35, and perforin. Examples of acute phase-proteins include, but are not limited to, C-reactive protein (CRP) and serum amyloid A (SAA).
[191] The term “lymphocyte” as used herein includes natural killer (NK) cells, T cells, or B cells. NK cells are a type of cytotoxic (cell toxic) lymphocyte that represent a major component of the inherent immune system. NK cells reject tumors and cells infected by viruses. It works through the process of apoptosis or programmed cell death. They were termed “natural killers” because they do not require activation in order to kill cells. T cells play a major role in cell- mediated-immunity (no antibody involvement). Its T cell receptors (TCR) differentiate themselves from other lymphocyte types. The thymus, a specialized organ of the immune system, is primarily responsible for the T cell’s maturation. There are six types of T cells, namely: Helper T cells (e.g., CD4+ cells), Cytotoxic T cells (also known as TC, cytotoxic T lymphocyte, CTL, T-killer cell, cytolytic T cell, CD8+ T cells or killer T cell), Memory T cells ((i) stem memory TSCM cells, like naive cells, are CD45RO-, CCR7+, CD45RA+, CD62L+ (L-selectin), CD27+, CD28+ and IL-7Ra+, but they also express large amounts of CD95, IL- 2R[T CXCR3, and LFA-1, and show numerous functional attributes distinctive of memory cells); (ii) central memory TCM cells express L-selectin and the CCR7, they secrete IL-2, but not IFNy or IL-4, and (iii) effector memory TEM cells, however, do not express L-selectin or CCR7 but produce effector cytokines like IFNy and IL-4), Regulatory T cells (Tregs, suppressor T cells, or CD4+CD25+ or CD4+ FoxP3+ regulatory T cells), Natural Killer T cells (NKT) and Gamma Delta T cells. B-cells, on the other hand, play a principal role in humoral immunity (with antibody involvement). It makes antibodies and antigens and performs the role of antigen-presenting cells (APCs) and turns into memory B-cells and plasma cells, both short- lived and long-lived, after activation by antigen interaction. In mammals, immature B-cells are formed in the bone marrow, where its name is derived from.
[192] The term “genetically engineered” or “engineered” refers to a method of modifying the genome of a cell, including, but not limited to, deleting a coding or non-coding region or a portion thereof or inserting a coding region or a portion thereof. In some embodiments, the cell that is modified is a lymphocyte, e.g., a T cell, which may either be obtained from a patient or a donor. The cell may be modified to express an exogenous construct, such as, e.g., a chimeric antigen receptor (CAR) or a T cell receptor (TCR), which is incorporated into the cell's genome.
[193] An “immune response” refers to the action of a cell of the immune system (for example, T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells and neutrophils) and soluble macromolecules produced by any of these cells or the liver (including Abs, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and / or elimination from a vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
[194] A “costimulatory signal,” as used herein, refers to a signal, which in combination with a primary signal, such as TCR / CD3 ligation, leads to a T cell response, such as, but not limited to, proliferation and / or upregulation or down regulation of key molecules.
[195] A “costimulatory ligand,” as used herein, includes a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory molecule on a T cell. Binding of the costimulatory ligand provides a signal that mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like. A costimulatory ligand induces a signal that is in addition to the primary signal provided by a stimulatory molecule, for instance, by binding of a T cell receptor (TCR) / CD3 complex with a major histocompatibility complex (MHC) molecule loaded with peptide. A co-stimulatory ligand may include, but is not limited to, 3 / TR6, 4-IBB ligand, agonist or antibody that binds Toll ligand receptor, B7-1 (CD80), B7-2 (CD86), CD30 ligand, CD40, CD7, CD70, CD83, herpes virus entry mediator (HVEM), human leukocyte antigen G (HLA-G), ILT4, immunoglobulin-like transcript (ILT) 3, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), ligand that specifically binds with B7-H3, lymphotoxin beta receptor, MHC class I chain-related protein A (MICA), MHC class I chain-related protein B (MICB), 0X40 ligand, PD-L2, or programmed death (PD) LI. A co-stimulatory ligand includes, without limitation, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as, but not limited to, 4-1BB, B7-H3, CD2, CD27, CD28, CD30, CD40, CD7, ICOS, ligand that specifically binds with CD83, lymphocyte function- associated antigen-1 (LFA-1), natural killer cell receptor C (NKG2C), 0X40, PD-1, or tumor necrosis factor superfamily member 14 (TNFSF14 or LIGHT).
[196] A “costimulatory molecule” is a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules include, but are not limited to, A"costimulatory molecule” is a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules include, but are not limited to, 4- 1BB / CD137, B7-H3, BAFFR, BLAME (SLAMFS), BTLA, CD 33, CD 45, CD100 (SEMAAD), CD103, CD134, CD137, CD154, CD16, CD160 (BYS5), CD 18, CD19, CD19a, CD2, CD22, CD247, CD27, CD276 (B7-H3), CD28, CD29, CD3 (alpha; beta; delta; epsilon; gamma; zeta), CD30, CD37, CD4, CD4, CD40, CD49a, CD49D, CD49f, CDS, CD64, CD69, CD7, CD80, CD83 ligand, CD84, CD86, CD8alpha, CD8beta, CD9, CD96 (Tactile), CD1- la, CDI-Ib, CDl-lc, CDI-1d, CDS, CEACAM1, CRT AM, DAP-10, DNAM1 (CD226), Fc gamma receptor, GADS, GITR, HVEM (LIGHTR), IA4, ICAM-1, ICAM-1, ICOS, Ig alpha (CD79a), IL2R beta, IL2R gamma, IL7R alpha, integrin, ITGA4, ITGA4, ITGAS, IT GAD, ITGAE, ITGAL, ITGAM, ITGAX, ITGB2, ITGB7, ITGB1, KIRDS2, LAT, LFA-1, LFA-1, LIGHT, LIGHT (tumor necrosis factor superfamily member 14; TNFSF14), LTBR, Ly9 (CD229), lymphocyte function-associated antigen-1 (LFA-1 (CD1 1a / CD18), MHC class I molecule, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), 0X40, PAG / Cbp, PD-1, PSGLI1, SELPLG (CD162), signaling lymphocytic activation molecule, SLAM (SLAMFI; CD150; IPO-3), SLAMF4 (CD244; 2B4), SLAMF6 (NTB-A; Lyl08), SLAMF7, SLP-76, TNF, TNFr, TNFR2, Toll ligand receptor, TRANCE / RANKL, VLA1, or VLA-6, or fragments, truncations, or combinations thereof.
[197] The recitations “sequence identity” or, for example, comprising a “sequence 50% identical to,” as used herein, refer to the extent that sequences are identical on a nucleotide-by- nucleotide basis or an amino acid-by-amino acid basis over a window of comparison. Thus, a “percentage of sequence identity” may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. Included are nucleotides and polypeptides having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any of the reference sequences described herein, typically where the polypeptide variant maintains at least one biological activity of the reference polypeptide. 2. Vectors, precursor RNA, and circular RNA
[198] In certain aspects, provided herein are circular RNA polynucleotides comprising a 3’ post splicing group I intron fragment, optionally a first spacer, an Internal Ribosome Entry Site (IRES), an expression sequence, optionally a second spacer, and a 5’ post splicing group I intron fragment. In some embodiments, these regions are in that order. In some embodiments, the circular RNA is made by a method provided herein or from a vector provided herein.
[199] In certain embodiments, transcription of a vector provided herein (e.g., comprising a 5° homology region, a 3° group I intron fragment, optionally a first spacer, an Internal Ribosome Entry Site (IRES), an expression sequence, optionally a second spacer, a 5° group I intron fragment, and a 3° homology region) results in the formation of a precursor linear RNA polynucleotide capable of circularizing. In some embodiments, this precursor linear RNA polynucleotide circularizes when incubated in the presence of guanosine nucleotide or nucleoside (e.g., GTP) and divalent cation (e.g., Mg2+).
[200] In some embodiments, the vectors and precursor RNA polynucleotides provided herein comprise a first (5°) duplex forming region and a second (3’) duplex forming region. In certain embodiments, the first and second homology regions may form perfect or imperfect duplexes. Thus, in certain embodiments at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%. 97%, 98%, 99% or 100% of the first and second duplex forming regions may be base paired with one another. In some embodiments, the duplex forming regions are predicted to have less than 50% (e.g., less than 45%, less than 40%, less than 35%, less than 30%, less than 25%) base pairing with unintended sequences in the RNA (e.g., non-duplex forming region sequences). In some embodiments, including such duplex forming regions on the ends of the precursor RNA strand, and adjacent or very close to the group I intron fragment, bring the group I intron fragments in close proximity to each other, increasing splicing efficiency. In some embodiments, the duplex forming regions are 3 to 100 nucleotides in length (e.g., 3-75 nucleotides in length, 3-50 nucleotides in length, 20-50 nucleotides in length, 35-50 nucleotides in length, 5-25 nucleotides in length, 9-19 nucleotides in length). In some embodiments, the duplex forming regions are about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 nucleotides in length. In some embodiments, the duplex forming regions have a length of about 9 to about 50 nucleotides. In one embodiment, the duplex forming regions have a length of about 9 to about 19 nucleotides. In some embodiments, the duplex forming regions have a length of about 20 to about 40 nucleotides. In certain embodiments, the duplex forming regions have a length of about 30 nucleotides.
[201] In certain embodiments, the vectors, precursor RNA and circular RNA provided herein comprise a first (5°) and / or a second (3°) spacer. In some embodiments, including a spacer between the 3’ group I intron fragment and the IRES may conserve secondary structures in those regions by preventing them from interacting, thus increasing splicing efficiency. In some embodiments, the first (between 3’ group I intron fragment and IRES) and second (between the expression sequence and 5° group I intron fragment) spacers comprise additional base pairing regions that are predicted to base pair with each other and not to the first and second duplex forming regions. In some embodiments, such spacer base pairing brings the group I intron fragments in close proximity to each other, further increasing splicing efficiency. Additionally, in some embodiments, the combination of base pairing between the first and second duplex forming regions, and separately, base pairing between the first and second spacers, promotes the formation of a splicing bubble containing the group I intron fragments flanked by adjacent regions of base pairing (Figure 25). Typical spacers are contiguous sequences with one or more of the following qualities: 1) is predicted to avoid interfering with proximal structures, for example, the IRES, expression sequence, or intron; 2) is at least 7 nt long and no longer than 100 nt; 3) is located after and adjacent to the 3” intron fragment and / or before and adjacent to the 5° intron fragment; and 4) contains one or more of the following: a) an unstructured region at least 5 nt long, b) a region of base pairing at least 5 nt long to a distal sequence, including another spacer, and ¢) a structured region at least 7 nt long limited in scope to the sequence of the spacer. Spacers may have several regions, including an unstructured region, a base pairing region, a hairpin / structured region, and combinations thereof. In an embodiment, the spacer has a structured region with high GC content. In an embodiment, a region within a spacer base pairs with another region within the same spacer. In an embodiment, a region within a spacer base pairs with a region within another spacer. In an embodiment, a spacer comprises one or more hairpin structures. In an embodiment, a spacer comprises one or more hairpin structures with a stem of 4 to 12 nucleotides and a loop of 2 to 10 nucleotides. In an embodiment, there is an additional spacer between the 3’ group I intron fragment and the IRES. In an embodiment, this additional spacer prevents the structured regions of the IRES from interfering with the folding of the 3’ group I intron fragment or reduces the extent to which this occurs. In some embodiments, the 5° spacer sequence is at least 7, 8,9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25 or 30 nucleotides in length. In some embodiments, the 5° spacer sequence is no more than 100, 90, 80, 70, 60, 50, 45, 40, 35 or 30 nucleotides in length. In some embodiments the 5° spacer sequence is between 5 and 50, 10 and 50, 20 and 50, 20 and 40, and / or 25 and 35 nucleotides in length. In certain embodiments, the 5° spacer sequence is 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 nucleotides in length. In one embodiment, the 5° spacer sequence is a polyA sequence. In another embodiment, the 5° spacer sequence is a polyAC sequence. In one embodiment, a spacer comprises about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% polyAC content. In one embodiment, a spacer comprises about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% polypyrimidine (C / T or C / U) content.
[202] In certain embodiments, a 3° group I intron fragment is a contiguous sequence at least 75% homologous (e.g., at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homologous) to a 3’ proximal fragment of a natural group I intron including the 3’ splice site dinucleotide and optionally the adjacent exon sequence at least 1 nt in length (e.g., atleast 2, 3,4,5,6,7,8,9, 10, 15, 20, 25 or 30 nt in length) and at most the length of the exon. Typically, a5’ group I intron fragment is a contiguous sequence at least 75% homologous (e.g., at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 91%, 98%, 99% or 100% homologous) to a 5° proximal fragment of a natural group I intron including the 5° splice site dinucleotide and optionally the adjacent exon sequence at least 1 nt in length (e.g., at least 2, 3,4,5,6,7,8,9, 10, 15, 20, 25 or 30 nt in length) and at most the length of the exon. As described by Umekage et al. (2012), and illustrated in Figure 33, external portions of the 3’ group I intron fragment and 5° group I intron fragment are removed in circularization, causing the circular RNA provided herein to comprise only the portion of the 3’ group I intron fragment formed by the optional exon sequence of at least 1 nt in length and 5° group I intron fragment formed by the optional exon sequence of at least 1 nt in length, if such sequences were present on the non-circularized precursor RNA. The part of the 3° group I intron fragment that is retained by a circular RNA is referred to herein as the post splicing 3” group I intron fragment. The part of the 5° group I intron fragment that is retained by a circular RNA is referred to herein as the post splicing 5° group I intron fragment.
[203] In certain embodiments, the vectors, precursor RNA and circular RNA provided herein comprise an internal ribosome entry site (IRES). Inclusion of an IRES permits the translation of one or more open reading frames from a circular RNA (e.g., open reading frames that form the expression sequence). The IRES element attracts a eukaryotic ribosomal translation initiation complex and promotes translation initiation. See, e.g., Kaufman et al., Nuc. Acids Res. (1991) 19:4485-4490; Gurtu et al., Biochem. Biophys. Res. Comm. (1996) 229:295-298; Rees et al., BioTechniques (1996) 20: 102-110; Kobayashi et al., BioTechniques (1996) 21 :399-402; and Mosser et al., BioTechniques 1997 22 150-161).
[204] A multitude of IRES sequences are available and include sequences derived from a wide variety of viruses, such as from leader sequences of picornaviruses such as the encephalomyocarditis virus (EMCV) UTR (Jang et al. J. Virol. (1989) 63: 1651-1660), the polio leader sequence, the hepatitis A virus leader, the hepatitis C virus IRES, human rhinovirus type 2 IRES (Dobrikova et al., Proc. Natl. Acad. Sci. (2003) 100(25): 15125- 15130), an IRES element from the foot and mouth disease virus (Ramesh ez al., Nucl. Acid Res. (1996) 24:2697- 2700), a giardiavirus IRES (Garlapati et al., J. Biol. Chem. (2004) 279(5):3389-3397), and the like.
[205] In some embodiments, the IRES is an IRES sequence of Taura syndrome virus, Triatoma virus, Theiler's encephalomyelitis virus, Simian Virus 40, Solenopsis invicta virus 1, Rhopalosiphum padi virus, Reticuloendotheliosis virus, Human poliovirus 1, Plautia stali intestine virus, Kashmir bee virus, Human rhinovirus 2, Homalodisca coagulata virus- 1, Human Immunodeficiency Virus type 1, Himetobi P virus, Hepatitis C virus, Hepatitis A virus, Hepatitis GB virus , Foot and mouth disease virus, Human enterovirus 71, Equine rhinitis virus, Ectropis obliqua picorna-like virus, Encephalomyocarditis virus, Drosophila C Virus, Human coxsackievirus B3, Crucifer tobamovirus, Cricket paralysis virus, Bovine viral diarrhea virus 1, Black Queen Cell Virus, Aphid lethal paralysis virus, Avian encephalomyelitis virus, Acute bee paralysis virus, Hibiscus chlorotic ringspot virus, Classical swine fever virus, Human FGF2, Human SFTPA1, Human AMLI1 / RUNX]1, Drosophila antennapedia, Human AQP4, Human ATIR, Human BAG-1, Human BCL2, Human BiP, Human c-IAPl, Human c-myc, Human eIF4G, Mouse NDST4L, Human LEF1, Mouse HIF1 alpha, Human n.myc, Mouse Gtx, Human p27kipl, Human PDGF2 / c-sis, Human p53, Human Pim-1, Mouse Rbm3, Drosophila reaper, Canine Scamper, Drosophila Ubx, Human UNR, Mouse UtrA, Human VEGF-A, Human XIAP, Drosophila hairless, S. cerevisiae TFIID, S. cerevisiae YAP1, tobacco etch virus, turnip crinkle virus, EMCV-A, EMCV-B, EMCV-Bf, EMCV-Cf, EMCV pEC9, Picobirnavirus, HCV QC64, Human Cosavirus E / D, Human Cosavirus F, Human Cosavirus JMY, Rhinovirus NAT001, HRV14, HRV89, HRVC-02, HRV-A21, Salivirus A SHI, Salivirus FHB, Salivirus NG-J1, Human Parechovirus 1, Crohivirus B, Yc¢-3, Rosavirus M-7, Shanbavirus A, Pasivirus A, Pasivirus A 2, Echovirus E14, Human Parechovirus 5, Aichi Virus, Hepatitis A Virus HAL6, Phopivirus, CVAI1Q, Enterovirus C, Enterovirus D, Enterovirus J, Human Pegivirus 2, GBV-C GT110, GBV-C K1737, GBV-C Iowa, Pegivirus A 1220, Pasivirus A 3, Sapelovirus, Rosavirus B, Bakunsa Virus, Tremovirus A, Swine Pasivirus 1, PLV-CHN, Pasivirus A, Sicinivirus, Hepacivirus K, Hepacivirus A, BVDV1, Border Disease Virus, BVDV2, CSFV-PK15C, SF573 Dicistrovirus, Hubei Picorna-like Virus, CRPV, Salivirus A BN35, Salivirus A BN2, Salivirus A 02394, Salivirus A GUT, Salivirus A CH, Salivirus A SZI1, Salivirus FHB, CVB3, CVBI, Echovirus 7, CVB5, EVA71, CVA3, CVA12, EV24 or an aptamer to eIlF4G.
[206] In some embodiments, the polynucleotides herein comprise an expression sequence. In some embodiments, the expression sequence encodes a CAR. In some embodiments, a polynucleotide comprises more than 1 expression sequence, e.g., 2, 3, 4, or 5 expression sequences. In some embodiments, one such expression sequence encodes a CAR and another encodes another therapeutic protein, such as a checkpoint inhibitor, e.g., an inhibitor of PD-1 inhibitor, a PD-L1 inhibitor, or a CTLA-4 inhibitor. In some embodiments, a polynucleotide comprises a first expression sequence encoding a CAR and a second expression sequence encoding an inhibitor of Programmed Death 1 (PD-1), PD-L1, PD-L2, Cytotoxic T- Lymphocyte Antigen 4 (CTLA-4), TIM-3, CEACAM (e.g., CEACAM-1, -3 and / or -5), VISTA, BTLA, TIGIT, LAIR], CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GALS, adenosine, TGFR (e.g., TGFR beta), B7-H1, B7-H4 (VTCN1), 0X-40, CD137, CD40, or LAGS. In some embodiments, an inhibitor is nivolumab, pembrolizumab, Ipilimumab, or atezolizumab. In some embodiments, an expression sequence encodes a protein that is cleaved into 2 or more functional units, e.g., a CAR and another therapeutic protein. [2071 In certain embodiments, the polynucleotides provided herein comprise a CAR or TCR complex protein coding region. The CAR or TCR complex protein coding region is a sequence that encodes a chimeric antigen receptor (CAR) or any T cell receptor (TCR) complex protein. In some embodiments the CAR or TCR complex protein encodes a CAR. In some embodiments, the CAR or TCR complex protein coding region encodes two CARs in a bicistronic construct. In some embodiments, the CAR or TCR complex protein encodes TCRalpha, TCRbeta, TCRgamma, TCRdelta, CD3delta, CD3epsilon, CD3gamma, CD3zeta, CD4, and / or CDS. In some embodiments, the CAR or TCR complex protein encodes an artificial TCRalpha, TCRbeta, TCRgamma, TCRdelta, CD3delta, CD3epsilon, CD3gamma, CD3zeta, CD4, and / or CD8 variant. In some embodiments, the CAR or TCR complex protein encodes a natural TCRalpha, TCRbeta, TCRgamma, TCRdelta, CD3delta, CD3epsilon, CD3gamma, CD3zeta, CD4, and / or CD8§ variant. In some embodiments, the CAR or TCR complex coding region concludes with a stop codon. In some embodiments, the CAR or TCR complex coding region concludes with a stop cassette.
[208] In certain embodiments, the vectors provided herein comprise a 3° UTR. In some embodiments, the 3' UTR is from human beta globin, human alpha globin xenopus beta globin, xenopus alpha globin, human prolactin, human GAP- 43, human eEFlal, human Tau, human TNFa, dengue virus, hantavirus small mRNA, bunyavirus small mRNA, turnip yellow mosaic virus, hepatitis C virus, rubella virus, tobacco mosaic virus, human IL-8, human actin, human GAPDH, human tubulin, hibiscus chlorotic rinsgspot virus, woodchuck hepatitis virus post translationally regulated element, sindbis virus, turnip crinkle virus, tobacco etch virus, or Venezuelan equine encephalitis virus.
[209] In some embodiments, the vectors provided herein comprise a 5° UTR. In some embodiments, the 5' UTR is from human beta globin, Xenopus laevis beta globin, human alpha globin, Xenopus laevis alpha globin, rubella virus, tobacco mosaic virus, mouse Gtx, dengue virus, heat shock protein 70kDa protein 1A, tobacco alcohol dehydrogenase, tobacco etch virus, turnip crinkle virus, or the adenovirus tripartite leader.
[210] In some embodiments, the vector provided herein comprises a polyA region. In some embodiments the polyA region is at least 30 nucleotides long or at least 60 nucleotides long.
[211] In some embodiments, the DNA (e.g., vector), linear RNA (e.g., precursor RNA), and / or circular RNA polynucleotide provided herein is between 300 and 10000, 400 and 9000, 500 and 8000, 600 and 7000, 700 and 6000, 800 and 5000, 900 and 5000, 1000 and 5000, 1100 and 5000, 1200 and 5000, 1300 and 5000, 1400 and 5000, and / or 1500 and 5000 nucleotides in length. In some embodiments, the polynucleotide is at least 300 nt, 400 nt, 500 nt, 600 nt, 700 nt, 800 nt, 900 nt, 1000 nt, 1100 nt, 1200 nt, 1300 nt, 1400 nt, 1500 nt, 2000 nt, 2500 nt, 3000 nt, 3500 nt, 4000 nt, 4500 nt, or 5000 nt in length. In some embodiments, the polynucleotide is no more than 3000 nt, 3500 nt, 4000 nt, 4500 nt, 5000 nt, 6000 nt, 7000 nt, 8000 nt, 9000 nt, or 10000 nt in length. In some embodiments, the length of a DNA, linear RNA, and / or circular RNA polynucleotide provided herein is about 300 nt, 400 nt, 500 nt, 600 nt, 700 nt, 800 nt, 900 nt, 1000 nt, 1100 nt, 1200 nt, 1300 nt, 1400 nt, 1500 nt, 2000 nt, 2500 nt, 3000 nt, 3500 nt, 4000 nt, 4500 nt, 5000 nt, 6000 nt, 7000 nt, 8000 nt, 9000 nt, or 10000 nt.
[212] In certain embodiments, the polynucleotides provided herein are circular RNA polynucleotides or are useful for making circular RNA polynucleotides. Such polynucleotides comprise CAR or TCR complex protein encoding domains. Certain current CAR and recombinant TCR treatments engineer cells with DNA encoding the CAR or recombinant TCR, causing greater toxicity when compared to transitory forms of CAR or recombinant TCR expression, and introducing the risk of harmful mutagenesis. An alternative is a linear RNA encoding a CAR or recombinant TCR complex protein. However, linear RNA suffers from short half-lives in vivo, limiting treatment efficacy. In certain embodiments, circular RNA polynucleotides provided herein encoding CARs or recombinant TCR complex proteins provides the toxicity advantages of transitory expression, while increasing the therapeutic efficacy of the treatment when compared to linear RNA. The methods of circularizing RNA described herein, including the addition of homology regions adjacent to the group I intron fragments, allow for high circularization efficiency and for the circularization of large RNA polynucleotides.
[213] In some embodiments, provided herein is a vector. In certain embodiments, the vector comprises, in the following order, a) a 5' homology region, b) a 3’ group I intron fragment, c) optionally, a first spacer sequence, d) an IRES, e) an expression sequence (e.g., CAR or TCR complex protein coding region) , f) optionally, a second spacer sequence, g) a 5’ group I intron fragment, and h) a 3' homology region. In some embodiments, the vector comprises a transcriptional promoter upstream of the 5° homology region.
[214] In some embodiments, provided herein is a precursor RNA. In certain embodiments, the precursor RNA is a linear RNA produced by in vitro transcription of a vector provided herein. In some embodiments, the precursor RNA comprises, in the following order, a) a 5' homology region, b) a 3’ group I intron fragment, ¢) optionally, a first spacer sequence, d) an IRES, e) an expression sequence (e.g., CAR or TCR complex protein coding region), f) optionally, a second spacer sequence, g) a 5’ group I intron fragment, and h) a 3' homology region. The precursor RNA can be unmodified, partially modified or completely modified.
[215] In certain embodiments, provided herein is a circular RNA. In certain embodiments, the circular RNA is a circular RNA produced by a vector provided herein. In some embodiments, the circular RNA is circular RNA produced by circularization of a precursor RNA provided herein. In some embodiments, the circular RNA comprises, in the following sequence, a) a first spacer sequence, b) an IRES, ¢) an expression sequence (e.g., CAR or TCR complex protein coding region), and d) a second spacer sequence. In some embodiments, the circular RNA further comprises the portion of the 3’ group I intron fragment that is 3’ of the 3’ splice site. In some embodiments, the circular RNA further comprises the portion of the 5’ group intron fragment that is 5° of the 5 splice site. In some embodiments, the circular RNA is at least 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000 or 4500 nucleotides in size. The circular RNA can be unmodified, partially modified or completely modified.
[216] In some embodiments, the circular RNA provided herein has higher functional stability than mRNA comprising the same expression sequence . In some embodiments, the circular RNA provided herein has higher functional stability than mRNA comprising the same expression sequence, SmoU modifications, an optimized UTR, a cap, and / or a polyA tail.
[217] In some embodiments, the circular RNA polynucleotide provided herein has a functional half-life of at least 5 hours, 10 hours, 15 hours, 20 hours. 30 hours, 40 hours, 50 hours, 60 hours, 70 hours or 80 hours. In some embodiments, the circular RNA polynucleotide provided herein has a functional half-life of 5-80, 10-70, 15-60, and / or 20-50 hours. In some embodiments, the circular RNA polynucleotide provided herein has a functional half-life greater than (e.g., at least 1.5-fold greater than, at least 2-fold greater than) that of an equivalent linear RNA polynucleotide encoding the same protein. In some embodiments, functional half- life can be assessed through the detection of functional protein synthesis.
[218] In some embodiments, the circular RNA polynucleotide provided herein has a half-life of at least 5 hours, 10 hours, 15 hours, 20 hours. 30 hours, 40 hours, 50 hours, 60 hours, 70 hours or 80 hours. In some embodiments, the circular RNA polynucleotide provided herein has a half-life of 5-80, 10-70, 15-60, and / or 20-50 hours. In some embodiments, the circular RNA polynucleotide provided herein has a half-life greater than (e.g., at least 1.5-fold greater than, at least 2-fold greater than) that of an equivalent linear RNA polynucleotide encoding the same protein.
[219] In some embodiments, the circular RNA provided herein may have a higher magnitude of expression than equivalent linear mRNA, e.g., a higher magnitude of expression 24 hours after administration of RNA to cells. In some embodiments, the circular RNA provided herein has a higher magnitude of expression than mRNA comprising the same expression sequence, SmoU modifications, an optimized UTR, a cap, and / or a polyA tail. In some embodiments, the circular RNA provided herein may have higher stability than an equivalent linear mRNA. In some embodiments, this may be shown by measuring receptor presence and density in vitro or in vivo post electroporation, with time points measured over 1 week. In some embodiments, this may be shown by measuring RNA presence via qPCR or ISH.
[220] In some embodiments, the circular RNA provided herein may be less immunogenic than an equivalent mRNA when exposed to an immune system of an organism or a certain type of immune cell. In some embodiments, the circular RNA provided herein is associated with modulated production of cytokines when exposed to an immune system of an organism or a certain type of immune cell. For example, in some embodiments, the circular RNA provided herein is associated with reduced production of IFN-B1, RIG-I, IL-2, IL-6, IFNy, and / or TNFa when exposed to an immune system of an organism or a certain type of immune cell as compared to mRNA comprising the same expression sequence. In some embodiments, the circular RNA provided herein is associated with less IFN-B1, RIG-I, IL-2, IL-6, IFNy, and / or TNFa transcript induction when exposed to an immune system of an organism or a certain type of immune cell as compared to mRNA comprising the same expression sequence. In some embodiments, the circular RNA provided herein is less immunogenic than mRNA comprising the same expression sequence. In some embodiments, the circular RNA provided herein is less immunogenic than mRNA comprising the same expression sequence, SmoU modifications, an optimized UTR, a cap, and / or a polyA tail. In certain embodiments, the circular RNA provided herein may result in lower toxicity than viral, e.g. lentiviral, engineering using DNA when expressing CARs or TCR complex proteins on immune cells, e.g., T cells, due to cytokine release syndrome (CRS). In some embodiments, this may be shown by measuring cytokine, e.g. IL6, release post infection / transfection in vitro, assessed by ELISA and / or qPCR.
[221] In certain embodiments, the circular RNA provided herein may result in lower toxicity than viral, e.g., lentiviral, engineering using DNA when expressing CARs or TCR complex proteins on immune cells, e.g., T cells, due to cytokine release syndrome (CRS). In some embodiments, this may be shown by measuring cytokine, e.g., IL6, release post infection / transfection in vitro, assessed by ELISA and / or qPCR.
[222] In some embodiments, the circular RNA provided herein may result in lower toxicity than viral, e.g., lentiviral, engineering using DNA when expressing CARs or TCR complex proteins on immune cells, e.g., T cells, due to a lack of insertional mutagenesis by circular RNA. In some embodiments, this may be shown by demonstrating that circular RNA does not integrate into the genome, while DNA delivered by lentiviruses does, by sequencing after administering circular RNA or DNA In certain embodiments, the circular RNA provided herein can be transfected into a cell as is, or can be transfected in DNA vector form and transcribed in the cell. Transcription of circular RNA from a transfected DNA vector can be via added polymerases or polymerases encoded by nucleic acids transfected into the cell, or preferably via endogenous polymerases.
[223] In certain embodiments, a circular RNA polynucleotide provided herein comprises modified RNA nucleotides and / or modified nucleosides. In some embodiments, the modified nucleoside is mC (5-methylcytidine). In another embodiment, the modified nucleoside is m*U (5-methyluridine). In another embodiment, the modified nucleoside is mA (N°- methyladenosine). In another embodiment, the modified nucleoside is s*U (2-thiouridine). In another embodiment, the modified nucleoside is ¥ (pseudouridine). In another embodiment, the modified nucleoside is Um (2'-O-methyluridine). In other embodiments, the modified nucleoside is m'A (1-methyladenosine); m?A (2-methyladenosine); Am (2’-O- methyladenosine); ms? mPA (2-methylthio-N®-methyladenosine); iA (N¢- isopentenyladenosine); ms%i6A (2-methylthio-N°isopentenyladenosine); i0®A (N®(cis- hydroxyisopentenyl)adenosine); ms?io®A (2-methylthio-N°-(cis- hydroxyisopentenyl)adenosine); gfA (N%-glycinylcarbamoyladenosine); tSA ~~ (N°- threonylcarbamoyladenosine); ms“°A (2-methylthio-N-threonyl carbamoyladenosine); mStA (NS-methyl-N-threonylcarbamoyladenosine); hnCA(N®- hydroxynorvalylcarbamoyladenosine); ms’hn®A (2-methylthio-NS-hydroxynorvalyl carbamoyladenosine); Ar(p) (2’-O-ribosyladenosine (phosphate); 1 (inosine); m'I (1- methylinosine); m'Im (1,2’-O-dimethylinosine); mC (3-methylcytidine); Cm (2’-O- methyleytidine); s2C (2-thiocytidine); ac*C (N*-acetyleytidine); fC (5-formyleytidine); m*Cm (5,2'-O-dimethyleytidine); ac*Cm (N“-acetyl-2’-O-methylcytidine); k*C (lysidine); m!G (1- methylguanosine); m?G (N*-methylguanosine); m’G (7-methylguanosine); Gm (2'-O- methylguanosine); m? 2G (N?N-dimethylguanosine); m*Gm (N?,2’-O-dimethylguanosine); m?,Gm (N2%,N22’-O-trimethylguanosine); Gr(p) (2’-O-ribosylguanosine(phosphate)); yW (wybutosine); 02yW (peroxywybutosine); OHyW (hydroxywybutosine); OHyW* (undermodified hydroxywybutosine); imG (wyosine); mimG (methylwyosine); Q (queuosine); 0Q (epoxyqueuosine); galQ (galactosyl-queuosine); manQ (mannosyl-quenosine); preQo (7- cyano-7-deazaguanosine); preQi (7-aminomethyl-7-deazaguanosine); G* (archaeosine); D (dihydrouridine); m’Um (5,2’-O-dimethyluridine); s*U (4-thiouridine); m*s*U (5-methyl-2- thiouridine); s?Um (2-thio-2’-O-methyluridine); acpU (3-(3-amino-3-carboxypropyl)uridine); ho’U (5-hydroxyuridine); mo®U (5-methoxyuridine); cmo’U (uridine 5-oxyacetic acid); memo’U (uridine 5-oxyacetic acid methyl ester); chm®U (5-(carboxyhydroxymethyl)uridine)); mchm®U (5-(carboxyhydroxymethyl)uridine methyl ester); mem®U (5- methoxycarbonylmethyluridine); mem*Um (5-methoxycarbonylmethyl-2’-O-methyluridine); mem’s?U (5-methoxycarbonylmethyl-2-thiouridine); nm*S?U (5-aminomethyl-2-thiouridine); mnm°U (5-methylaminomethyluridine); mnm’s’U (5-methylaminomethyl-2-thiouridine); mnm’se?U (5-methylaminomethyl-2-selenouridine); nem’U (5-carbamoylmethyluridine); nem’ Um (5-carbamoylmethyl-2'-O-methyluridine); cmnm’U (5- carboxymethylaminomethyluridine); cmnm®Um (5-carboxymethylaminomethyl-2'-O- methyluridine); cmnm’s?U (5-carboxymethylaminomethyl-2-thiouridine); mS,A (N®,N°- dimethyladenosine); Im (2’-O-methylinosine); m*C (N*-methylcytidine); m*Cm (N*,2’-O- dimethylcytidine); hm’C (5-hydroxymethylcytidine); m®U (3-methyluridine); cm®U (5- carboxymethyluridine); m°Am (N°2’-O-dimethyladenosine); mS>Am (NSN%,0-2- trimethyladenosine); m>’G (N?,7-dimethylguanosine); m>>’G (N?N2,7-trimethylguanosine); m’Um (3,2’-O-dimethyluridine); mD (5-methyldihydrouridine); f°Cm (5-formyl-2’-O- methylcytidine); m'Gm (1,2’-O-dimethylgnanosine); m!Am (1,2’-O-dimethyladenosine); mm 3U (5-taurinomethyluridine); tm’s*U (S-taurinomethyl-2-thiouridine)); imG-14 (4- demethylwyosine); imG2 (isowyosine): or actA (N%-acetyladenosine).
[224] In some embodiments, the modified nucleoside may include a compound selected from the group of: pyridin-4-one ribonucleoside, 5-aza-uridine, 2-thio-5-aza-uridine, 2-thiouridine, 4-thio-psendouridine, ~~ 2-thio-pseudouridine, 5-hydroxyuridine, 3-methyluridine, 5- carboxymethyl-uridine, 1-carboxymethyl-pseudouridine, 5-propynyl-uridine, 1-propynyl- pseudouridine, 5-taurinomethyluridine, 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2- thio-uridine, 1-taurinomethyl-4-thio-uridine, 5-methyl-uridine, 1-methyl-psendouridine, 4- thio-1-methyl-pseudouridine, 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza- pseudouridine, 2-thio-1-methyl- 1-deaza-pseudouridine, dihydrouridine, dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-dihydropseudouridine, 2- methoxyuridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, 4-m ethoxy-2-thio- pseudouridine, 5-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine, N4-acetylcytidine, 5- formylcytidine, N4-methylcytidine, 5-hydroxymethylcytidine, 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine, 2-thio-5-methyl-cytidine, 4-thio- psendoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza- pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5- methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine, 2-methoxy-cytidine, 2- methoxy-5-methyl-cytidine, 4-methoxy-pseudoisocytidine, 4-methoxy-1-methyl- pseudoisocytidine, 2-aminopurine, 2, 6-diaminopurine, 7-deaza-adenine, 7-deaza-8-aza- adenine, 7-deaza-2-aminopurine, 7-deaza-8-aza-2-aminopurine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyladenosine, N6-methyladenosine, N6- isopentenyladenosine, N6-(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N6-(cis- hydroxyisopentenyl) adenosine, Né6-glycinylcarbamoyladenosine, N6- threonylcarbamoyladenosine, 2-methylthio-N6-threonyl ~~ carbamoyladenosine, N6,N6- dimethyladenosine, 7-methyladenine, 2-methylthio-adenine, 2-methoxy-adenine, inosine, 1- methyl-inosine, wyosine, wybutosine, 7-deaza-guanosine, 7-deaza-8-aza-guanosine, 6-thio- guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine, 6- thio-7-methyl-guanosine, 7-methylinosine, 6-methoxy-guanosine, l-methylguanosine, N2- methylguanosine, N2,N2-dimethylguanosine, 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1- methyl-6-thio-guanosine, ~~ N2-methyl-6-thio-guanosine, and N2,N2-dimethyl-6-thio- guanosine. In another embodiment, the modifications are independently selected from the group consisting of 5-methylcytosine, pseudouridine and 1-methylpseudouridine.
[225] In some embodiments, the modified ribonucleosides include 5-methylcytidine, 5- methoxyuridine, 1-methyl-pseudouridine, N6-methyladenosine, and / or pseudouridine. In some embodiments, such modified nucleosides provide additional stability and resistance to immune activation.
[226] In particular embodiments, polynucleotides may be codon-optimized. A codon optimized sequence may be one in which codons in a polynucleotide encoding a polypeptide have been substituted in order to increase the expression, stability and / or activity of the polypeptide. Factors that influence codon optimization include, but are not limited to one or more of: (i) variation of codon biases between two or more organisms or genes or synthetically constructed bias tables, (ii) variation in the degree of codon bias within an organism, gene, or set of genes, (iii) systematic variation of codons including context, (iv) variation of codons according to their decoding tRNAs, (v) variation of codons according to GC %, either overall or in one position of the triplet, (vi) variation in degree of similarity to a reference sequence for example a naturally occurring sequence, (vii) variation in the codon frequency cutoff, (viii) structural properties of mRNAs transcribed from the DNA sequence, (ix) prior knowledge about the function of the DNA sequences upon which design of the codon substitution set is to be based, and / or (x) systematic variation of codon sets for each amino acid. In some embodiments, a codon optimized polynucleotide may minimize ribozyme collisions and / or limit structural interference between the expression sequence and the IRES.
[227] In certain embodiments circular RNA provided herein is produced inside a cell. In some embodiments, precursor RNA is transcribed using a DNA template (e.g., in some embodiments, using a vector provided herein) in the cytoplasm by a bacteriophage RNA polymerase, or in the nucleus by host RNA polymerase II and then circularized.
[228] In certain embodiments, the circular RNA provided herein is injected into an animal (e.g., a human), such that a polypeptide encoded by the circular RNA molecule (e.g., a CAR or TCR complex protein) is expressed inside the animal. 3. Payload
[229] In some embodiments, the expression sequence encodes a therapeutic protein. embodiments, the therapeutic protein is selected from the proteins listed in Table 1. Table 1 — Protein Expression Sequences and Delivery Formulations NEKIAPSFAVESIEDALKAAD TIGYPVMIRSAYALGGLGSGI CPNRETLMDLSTKAFAMTN QILVEKSVTGWKEIEYEVVR DADDNCVTVCNMENVDAM GVHTGDSVVVAPAQTLSNA EFQMLRRTSINVVRHLGIVG ECNIQFALHPTSMEYCIEVN ARLSRSSALASKATGYPLAFI AAKIALGIPLPEIKNVVSGKT SACFEPSLDYMVTKIPRWDL DRFHGTSSRIGSSMKSVGEV MAIGRTFEESFQKALRMCHP SIEGFTPRLPMNKEWPSNLD SIEGFTPRLPMNKEWPSNLD | LRKELSEPSSTRIYAIAKAID DNMSLDEIEKLTYIDKWFLY KMRDILNMEKTLKGLNSES MTEETLKRAKEIGFSDKQISK | CLGLTEAQTRELRLKKNIHP WVKQIDTLAAEYPSVTNYL YVTYNGQEHDVNFDDHGM MVLGCGPYHIGSSVEFDWC AVSSIRTLRQLGKKTVVVNC NPETVSTDFDECDKLYFEEL SLERILDIYHQEACGGCISV GGQIPNNLAVPLYKNGVKIM GTSPLQIDRAEDRSIFSAVLD ELKVAQAPWKAVNTLNEAL EFAKSVDYPCLLRPSYVLSG SAMNVVFSEDEMKKFLEEA TRVSQEHPVVLTKFVEGARE VEMDAVGKDGRVISHAISEH VEDAGVHSGDATLMLPTQTI SQGAIEKVKDATRKIAKAFA ISGPFNVQFLVKGNDVLVIEC NLRASRSFPFVSKTLGVDFID VATKVMIGENVDEKHLPTL | DHPIIPADYVAIKAPMESWPR LRDADPILRCEMASTGEVAC FGEGIHTAFLKAMLSTGFKIP QKGILIGIQQSFRPRFLGVAE QLHNEGFKLFATEATSDWL NANNVPATPVAWPSQEGQN PSLSSIRKLIRDGSIDLVINLP NNNTKFVHDNYVIRRTAVD | SGIPLLTNFQVTKLFAEAVQ KSRKVDSKSLFHYRQYSAG KAA that are encoded by more than one gene. For example, the protein may be a heterodimer, wherein each chain or subunit of the protein is encoded by a separate gene. It is possible that more than one circRNA molecule is delivered in the transfer vehicle and each circRN A encodes a separate subunit of the protein. Alternatively, a single circRNA may be engineered to encode more than one subunit. In certain embodiments, separate circRNA molecules encoding the individual subunits may be administered in separate transfer vehicles. 4. Tonizable lipids
[231] In certain embodiments disclosed herein are lipids that may be used as a component of a transfer vehicle to facilitate or enhance the delivery and release of circular RNA to one or more target cells (e.g., by permeating or fusing with the lipid membranes of such target cells).
[232] In some embodiments, a lipid or transfer vehicle is a lipid as described in pages 32-55 of International Patent Application No. PCT / US2010 / 061058, paragraphs 86-117 of US Application Publication No. US2019 / 0314524, pages 43-146 of International Patent Application No. PCT / US2018 / 058555, pages 46-51 of International Patent Application No. PCT / US2018 / 053569, paragraphs 195-217 of International Patent Application No. PCT / US2017 / 028981, paragraphs 82-95 of US Application Publication No. US2019 / 0321489, paragraphs 5-19 and / or 38-77 of US Application Publication No. US2019 / 0314284, Tables 1- 4 of International Patent Application No. PCT / US2019 / 025246, paragraphs 92-107 of US Application Publication No 20190091164, pages 78-97, 109-164, and / or 190-217 of International Patent Application No. PCT / US2019 / 015913, the contents of each of which are herein incorporated by reference in their entireties.
[233] In some embodiments, a lipid or transfer vehicle is an ionizable lipid. In certain embodiments, an ionizable lipid comprises one or more cleavable functional groups (e.g., a disulfide) that allow, for example, a hydrophilic functional head-group to dissociate from a lipophilic functional tail-group of the compound (e.g., upon exposure to oxidative, reducing or acidic conditions), thereby facilitating a phase transition in the lipid bilayer of the one or more target cells. In some embodiments, an ionizable lipid is a lipid as represented by formula 1 or as listed in Tables 1 or 2 of US Patent No. 9,708,628, the content of which is herein incorporated by reference in its entirety. In some embodiments, an ionizable lipid is as described in pages 7-13 of US Patent No. 9,765,022 or as represented by formula 1 of US Patent No. 9,765,022, the content of which is herein incorporated by reference in its entirety. In some embodiments, an ionizable lipid is described in pages 12-24 of International Patent Application No. PCT / US2019 / 016362 or as represented by formula 1 of International Patent Application PCT / US2019 / 016362, the contents of which are herein incorporated by reference in their entirety.
[234] In some embodiments, a lipid or transfer vehicle is a lipid as described in International Patent Application Nos. PCT / US2010 / 061058, PCT / US2018 / 058555, PCT / US2018 / 053569, PCT / US2017 / 028981, PCT / US2019 / 025246, PCT / US2019 / 015913, PCT / US2019 / 016362, PCT / US2019 / 016362, US Application Publication Nos. US2019 / 0314524, US2019 / 0321489, US2019 / 0314284, and US2019 / 0091164, and US Patent Nos. 9,708,628 and 9,765,022, the contents of which are herein incorporated by reference in their entireties.
[235] In some embodiments, a lipid that may be used as a component of a transfer vehicle to facilitate or enhance the delivery and release of circular RNA to one or more target cells may be one or more lipid listed in Table 2. Table 2 — Exemplary Lipids Number Lipid Structure ad T forms pdm domamsmdamm asm Number Lipid Structure 62 I harap, oem He 63 | ~ 0 NH 1 1 AA NON TNNTN NUTUTUNTUNN Number 71 5. PEG lipids
[236] The use and inclusion of polyethylene glycol (PEG)-modified phospholipids and derivatized lipids such as derivatized ceramides (PEG-CER), including N-Octanoyl-Sphingosine-1- [Succinyl(Methoxy Polyethylene Glycol)-2000] (C8 PEG-2000 ceramide) in the liposomal and pharmaceutical compositions described herein is contemplated, preferably in combination with one or more of the compounds and lipids disclosed herein. Contemplated PEG-modified lipids include, but are not limited to, a polyethylene glycol chain of up to 5 kDa in length covalently attached to a lipid with alkyl chain(s) of C6-C20 length. In some embodiments, the PEG-modified lipid employed in the compositions and methods of the invention is 1,2-dimyristoyl-sn-glycerol, methoxypolyethylene Glycol (2000 MW PEG) “DMG-PEG2000.” The addition of PEG-modified lipids to the lipid delivery vehicle may prevent complex aggregation and may also provide a means for increasing circulation lifetime and increasing the delivery of the lipid-polynucleotide composition to the target tissues, (Klibanov et al. (1990) FEBS Letters, 268 (1): 235-237), or they may be selected to rapidly exchange out of the formulation in vivo (see U.S. Pat. No. 5,885,613). Particularly useful exchangeable lipids are PEG- ceramides having shorter acyl chains (e.g, C14 or C18). The PEG-modified phospholipid and derivatized lipids of the present invention may comprise a molar ratio from about 0% to about 20%, about 0.5% to about 20%, about 1% to about 15%, about 4% to about 10%, or about 2% of the total lipid present in a liposomal lipid nanoparticle.
[237] In an embodiment, a PEG-modified lipid is described in international patent application PCT / US2019 / 015913. In an embodiment, a transfer vehicle comprises one or more PEG-modified lipids.
[238] Non-limiting examples of PEG-lipids include PEG-modified phosphatidylethanolamine and phosphatidic acid, PEG-ceramide conjugates (e.g., PEG-CerC14 or PEG-CerC20), PEG-modified dialkylamines and PEG-modified 1,2-diacyloxypropan-3-amines. Such lipids are also referred to as PEGylated lipids. For example, a PEG lipid can be PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG- DMPE, PEG-DPPC, or a PEG-DSPE lipid.
[239] In some embodiments, the PEG-lipid includes, but is not limited to 1,2-dimyristoyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N- [amino(polyethylene glycol)] (PEG-DSPE), PEG-disteryl glycerol (PEG-DSG), PEG-dipalmetoleyl, PEG-dioleyl, PEG-distearyl, PEG-diacylglycamide (PEG-DAG), PEG-dipalmitoyl phosphatidylethanolamine (PEG-DPPE), or PEG-1,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA).
[240] In one embodiment, the PEG-lipid is selected from the group consisting of a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG- modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and mixtures thereof.
[241] In some embodiments, the lipid moiety of the PEG-lipids includes those having lengths of from about C4 to about Cz, such as from about C4 to about Cys. In some embodiments, a PEG moiety, for example an mPEG-NH2, has a size of about 1000, 2000, 5000, 10,000, 15,000 or 20,000 daltons. In one embodiment, the PEG-lipid is PEG2k-DMG.
[242] In one embodiment, the lipid nanoparticles described herein can comprise a PEG lipid which is a non-diffusible PEG. Non-limiting examples of non-diffusible PEGs include PEG-DSG and PEG- DSPE.
[243] PEG-lipids are known in the art, such as those described in U.S. Patent No. 8158601 and International Publ. No. WO 2015 / 130584 A2, which are incorporated herein by reference in their entirety.
[244] In general, some of the other lipid components {e.g., PEG lipids) of various formulae, described herein may be synthesized as described International Patent Application No. PCT / US2016 / 000129, which is incorporated by reference in its entirety.
[245] The lipid component of a lipid nanoparticle composition may include one or more molecules comprising polyethylene glycol, such as PEG or PEG-modified lipids. Such species may be alternately referred to as PEGylated lipids. A PEG lipid is a lipid modified with polyethylene glycol. A PEG lipid may be selected from the non-limiting group including PEG-modified phosphatidylethanolamines, PEG-modified phosphatidic acids, PEG-modified ceramides, PEG-modified dialkylamines, PEG- modified diacylglycerols, PEG-modified dialkylglycerols, and mixtures thereof. For example, a PEG lipid may be PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG-DMPE, PEG-DPPC, or a PEG-DSPE lipid.
[246] In some embodiments the PEG-modified lipids are a modified form of PEG-DMG. PEG-DMG
[247] In one embodiment, PEG lipids useful in the present invention can be PEGylated lipids described in International Publication No. W(02012099755, the contents of which is herein incorporated by reference in its entirety. Any of these exemplary PEG lipids described herein may be modified to comprise a hydroxyl group on the PEG chain. In certain embodiments, the PEG lipid is a PEG-OH lipid. In certain embodiments, the PEG-OH lipid includes one or more hydroxyl groups on the PEG chain. In certain embodiments, a PEG-OH or hydroxy-PEGylated lipid comprises an —~OH group at the terminus of the PEG chain. Each possibility represents a separate embodiment of the present invention.
[248] In some embodiments, the PEG lipid is a compound of Formula (P1): or a salt or isomer thereof, wherein: r is an integer between 1 and 100; Ris Cio alkyl, C1040 alkenyl, or Cio. alkynyl; and optionally one or more methylene groups of R are independently replaced with Cs.10 carbocyclylene, 4 to 10 membered heterocyclylene, Ce.10 arylene, 4 to 10 membered heteroarylene, -N(RY)-, -O-, -S-, -C(0)-~C(O)NRN)-, -NRYC(0)-, - NRNC(O)NRY)-, ~C(0)0-, —OC(0)-, -0C(0)O— ,—OC(O)N(RY)-, -NR¥C(0)0-, ~C(0)S—, — SC(0)-, —C(=NRM-, -C(E=NRYNRY)-, -NRYC(=NRY)-, -NRYC(=NRY)NRM- ,-C(S)-, - C(S)NRM)—, -NRNC(S)-, -NRNC(S)N(RY)-, -S(0)-, -0S(0)—, -S(0)0O-, —0S(0)0-, -0S(0)2—, — S(0).0-, -0S8(0)0-, -NRMHSO)-, -S(ONRM-, -NRMSONRY)-, -OS(ONRN-, - NRYS(0)0-, ~S(0)2-, -NRMS(0)2—, ~S(O):NRN)-, “NR¥)S(0):NRN)—, —~OS(0):NRY)-, or — NRYS(0),0-; and each instance of RN is independently hydrogen, C1 alkyl, or a nitrogen protecting group.
[249] For example, R is C17 alkyl. For example, the PEG lipid is a compound of Formula (P1-a): or a salt or isomer thereof, wherein r is an integer between 1 and 100.
[250] For example, the PEG lipid is a compound of the following formula: “No, 6. Helper lipids
[251] Insome embodiments, the transfer vehicle (e.g., LNP) described herein comprises one or more non-cationic helper lipids. In some embodiments, the helper lipid is a phospholipid. In some embodiments, the helper lipid is a phospholipid substitute or replacement. In some embodiments, the phospholipid or phospholipid substitute can be, for example, one or more saturated or (poly)unsaturated phospholipids, or phospholipid substitutes, or a combination thereof. In general, phospholipids comprise a phospholipid moiety and one or more fatty acid moieties.
[252] A phospholipid moiety can be selected, for example, from the non-limiting group consisting of phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl glycerol, phosphatidyl serine, phosphatidic acid, 2-lysophosphatidyl choline, and a sphingomyelin.
[253] A fatty acid moiety can be selected, for example, from the non-limiting group consisting of lauric acid, myristic acid, myristoleic acid, palmitic acid, palmitoleic acid, stearic acid, oleic acid, linoleic acid, alpha-linolenic acid, erucic acid, phytanoic acid, arachidic acid, arachidonic acid, eicosapentaenoic acid, behenic acid, docosapentaenoic acid, and docosahexaenoic acid.
[254] Phospholipids include, but are not limited to, glycerophospholipids such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylserines, phosphatidylinositols, phosphatidy glycerols, and phosphatidic acids. Phospholipids also include phosphosphingolipid, such as sphingomyelin.
[255] In some embodiments, the helper lipid is a 1,2-distearoyl-177-glycero-3-phosphocholine (DSPC) analog, a DSPC substitute, oleic acid, or an oleic acid analog.
[256] In some embodiments, a helper lipid is a non-phosphatidyl choline (PC) zwitterionic lipid, a DSPC analog, oleic acid, an oleic acid analog, or a DSPC substitute.
[257] In some embodiments, a helper lipid is described in PCT / US2018 / 053569. Helper lipids suitable for use in a lipid composition of the disclosure include, for example, a variety of neutral, uncharged or zwitterionic lipids. Such helper lipids are preferably used in combination with one or more of the compounds and lipids disclosed herein. Examples of helper lipids include, but are not limited to, S-heptadecylbenzene-1,3-diol (resorcinol), dipalmitoylphosphatidylcholine (DPPC), distearoylphosphatidylcholine (DSPC), pohsphocholine (DOPC), dimyristoylphosphatidylcholine (DMPC), phosphatidylcholine (PLPC), 1,2-distearoylsn-glycero-3-phosphocholine (DAPC), phosphatidylethanolamine (PE), egg phosphatidylcholine (EPC), dilauryloylphosphatidylcholine (DLPC), dimyristoylphosphatidylcholine (DMPC), 1-myristoyl-2-palmitoyl phosphatidylcholine (MPPC), 1-paimitoyl-2-myristoyl ~~ phosphatidylcholine ~~ (PMPC), 1-palmitoyl-2-stearoyl phosphatidylcholine (PSPC), 1,2-diarachidoyl-sn-glycero-3-phosphocholine (DBPC), 1-stearoyl-2- palmitoyl phosphatidylcholine (SPPC), 1,2-dieicosenoyl-sn-glycero-3-phosphocholine (DEPC), paimitoyioieoyl phosphatidylcholine (POPC), lysophosphatidyl choline, dioleoyl phosphatidylethanol amine (DOPE) dilinoleoylphosphatidylcholine ~~ distearoylphosphatidylethanolamine (DSPE), dimyristoyl phosphatidylethanolamine (DMPE), dipalmitoyl phosphatidylethanolamine (DPPE), palmitoyloleoyl phosphatidylethanolamine (POPE), lysophosphatidylethanolamine and combinations thereof. In one embodiment, the helper lipid may be distearoylphosphatidylcholine (DSPC) or dimyristoyl phosphatidyl ethanolamine (DMPE). In another embodiment, the helper lipid may be distearoylphosphatidylcholine (DSPC). Helper lipids function to stabilize and improve processing of the transfer vehicles. Such helper lipids are preferably used in combination with other excipients, for example, one or more of the ionizable lipids disclosed herein. In some embodiments, when used in combination with an ionizable lipid, the helper lipid may comprise a molar ratio of 5% to about 90%, or about 10% to about 70% of the total lipid present in the lipid nanoparticle. 7. Structural lipids
[258] In an embodiment, a structural lipid is described in international patent application PCT / US2019 / 015913.
[259] The transfer vehicles described herein comprise one or more structural lipids. Incorporation of structural lipids in the lipid nanoparticle may help mitigate aggregation of other lipids in the particle. Structural lipids can include, but are not limited to, cholesterol, fecosterol, ergosterol, bassicasterol, tomatidine, tomatine, ursolic, alpha-tocopherol, and mixtures thereof. In certain embodiments, the structural lipid is cholesterol. In certain embodiments, the structural lipid includes cholesterol and a corticosteroid (such as, for example, prednisolone, dexamethasone, prednisone, and hydrocortisone), or a combination thereof.
[260] In some embodiments, the structural lipid is a sterol. In certain embodiments, the structural lipid is a steroid. In certain embodiments, the structural lipid is cholesterol. In certain embodiments, the structural lipid is an analog of cholesterol. In certain embodiments, the structural lipid is alpha- tocopherol.
[261] The transfer vehicles described herein comprise one or more structural lipids. Incorporation of structural lipids in a transfer vehicle, e.g., a lipid nanoparticle, may help mitigate aggregation of other lipids in the particle. In certain embodiments, the structural lipid includes cholesterol and a corticosteroid (such as, for example, prednisolone, dexamethasone, prednisone, and hydrocortisone), or a combination thereof.
[262] In some embodiments, the structural lipid is a sterol. Structural lipids can include, but are not limited to, sterols {e.g., phytosterols or zoosterols).
[263] In certain embodiments, the structural lipid is a steroid. For example, sterols can include, but are not limited to, cholesterol, B-sitosterol, fecosterol, ergosterol, sitosterol, campesterol, stigmasterol, brassicasterol, ergosterol, tomatidine, tomatine, ursolic acid, or alpha-tocopherol. 8. Chimeric antigen receptors
[264] Chimeric antigen receptors (CARs or CAR-Ts) are genetically-engineered receptors. These engineered receptors may be inserted into and expressed by immune cells, including T cells via circular RNA as described herein. With a CAR, a single receptor may be programmed to both recognize a specific antigen and, when bound to that antigen, activate the immune cell to attack and destroy the cell bearing that antigen. When these antigens exist on tumor cells, an immune cell that expresses the CAR may target and kill the tumor cell. In some embodiments, the CAR encoded by the polynucleotide comprises (i) an antigen-binding molecule that specifically binds to a target antigen, (ii) a hinge domain, a transmembrane domain, and an intracellular domain, and (iii) an activating domain.
[265] In certain aspects, provided herein are vectors, precursor RNAs and circular RNA polynucleotides that comprise a protein coding region that encodes a chimeric antigen receptor (CAR) or a T cell receptor (TCR) complex protein.
[266] A CAR is an artificially constructed hybrid protein or polypeptide containing an antigen binding domain (e.g., single chain variable fragment (scFv)) linked to T-cell signaling domains. Characteristics of CARs include their ability to redirect T-cell specificity and reactivity toward at least one selected target (e.g., in a non-MHC-restricted manner), exploiting the antigen-binding properties of monoclonal antibodies. The ability CARs to recognize non-MHC restricted antigen gives T cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape. A bispecific CAR is specific to two different antigens. In an embodiment, certain polynucleotides provided herein encode bispecific CARs. [2671 In some embodiments, the CAR comprises a transmembrane domain. In an embodiment, the transmembrane domain comprises a CD8 transmembrane domain. In some embodiments, the CAR comprises a CD8a (CD8 alpha) hinge and transmembrane domain. In a preferred embodiment, the CD8 is human. The CAR may comprise less than the whole CDS protein.. In an embodiment, the transmembrane domain comprises a CD28 transmembrane domain. In some embodiments, the CAR comprises a CD28 hinge and transmembrane domain. In a preferred embodiment, the CD28 is human. The CAR may comprise less than the whole CD28 protein.
[268] In some embodiments, an orientation of the CARs in accordance with the disclosure comprises an antigen binding domain (such as an scFv) in tandem with a costimulatory domain and an activating domain. The costimulatory domain may comprise one or more of an extracellular portion, a transmembrane portion, and an intracellular portion. In other embodiments, multiple costimulatory domains may be utilized in tandem.
[269] In some embodiments, the CAR comprises a CAR protein spacer. The CAR protein spacer may be between any aforementioned domains. In an embodiment, the CAR comprises an IgG heavy chain constant domain (CH2CH3) spacer. In a further embodiment, the CAR protein spacer can be between the scFv and the transmembrane domain. In a preferred embodiment, the sequence of the spacer, e.g., CH2CH3, is human.
[270] In some embodiments, the CAR or TCR complex protein is a TCR complex protein (i.e., a protein that makes up part of the TCR complex). In some embodiments, the TCR complex protein is a recombinant, naturally occurring protein. In some embodiments, the TCR complex protein is an artificial version of a protein that makes up part of the TCR complex. In some embodiments, the TCR complex protein is TCRalpha, TCRbeta, TCRgamma, TCRdelta, CD3epsilon, CD3gamma, CD3delta, CD3zeta, CD4, or CD8. In some embodiments, the TCR complex protein comprises an artificial binding domain, and / or a costimulatory domain.
[271] In certain embodiments, the TCR complex protein comprises a sequence that is at least 90%, at least 91%), at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or 100% identical to an amino acid sequence of a natural TCR Va, Vp, Ca, and / or CB. In some embodiments, each CDR or the TCR complex protein comprises zero changes or at most one, two, or three changes, from a TCR or fragment or derivative thereof that specifically binds to a target of interest. Antigen binding domain
[272] CARs may be engineered to bind to an antigen (such as a cell-surface antigen) by incorporating an antigen binding molecule that interacts with that targeted antigen. In some embodiments, the antigen binding molecule is an antibody fragment thereof, e.g., one or more single chain antibody fragment (scFv). An scFv is a single chain antibody fragment having the variable regions of the heavy and light chains of an antibody linked together. See U.S. Patent Nos. 7,741,465, and 6,319,494 as well as Eshhar er al., Cancer Immunol Immunotherapy (1997) 45: 131-136. An scFv retains the parent antibody's ability to specifically interact with target antigen. scFvs are useful in chimeric antigen receptors because they may be engineered to be expressed as part of a single chain along with the other CAR components. Id. See also Krause et al., J. Exp. Med., Volume 188, No. 4, 1998 (619-626); Finney et al., Journal of Immunology, 1998, 161 : 2791-2797. It will be appreciated that the antigen binding molecule is typically contained within the extracellular portion of the CAR such that it is capable of recognizing and binding to the antigen of interest. Bispecific and multispecific CARs are contemplated within the scope of the invention, with specificity to more than one target of interest. In some embodiments, an antigen binding domain is an aptamer or nanobody specific for a target antigen.
[273] In some embodiments, the antigen binding molecule comprises a single chain, wherein the heavy chain variable region and the light chain variable region are connected by a linker. In some embodiments, the VH is located at the N terminus of the linker and the VL is located at the C terminus of the linker. In other embodiments, the VL is located at the N terminus of the linker and the VH is located at the C terminus of the linker. In some embodiments, the linker comprises at least about 5, at least about 8, at least about 10, at least about 13, at least about 15, at least about 18, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, or at least about 100 amino acids.
[274] In some embodiments, the CAR or TCR comprises an antigen binding domain specific for an antigen selected from the group CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRvIII), ganglioside G2 (GD2), ganglioside GD3, TNF receptor family member B cell maturation (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate-specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER3, Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GMI, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGSS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD?2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein-coupled receptor class C group 5, member D (GPRCSD), chromosome X open reading frame 61 (CXORF61), CD97, CD179a, anaplastic lymphoma kinase (ALK), Polysialic acid, placenta- specific 1 (PLAC1), hexasaccharide portion of globoH glycoceramide (GloboH), mammary gland differentiation antigen (NY-BR-1), uroplakin 2 (UPK2), Hepatitis A virus cellular receptor 1 (HAVCR1), adrenoceptor beta 3 (ADRB3), pannexin 3 (PANX3), G protein- coupled receptor 20 (GPR20), lymphocyte antigen 6 complex, locus K 9 (LY6K), Olfactory receptor 51E2 (OR51E2), TCR Gamma Alternate Reading Frame Protein (TARP), Wilms tumor protein (WT1), Cancer / testis antigen 1 (NY-ESO-1), Cancer / testis antigen 2 (LAGE- la), MAGE family members (including MAGE-Al, MAGE-A3 and MAGE-A4), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), sperm protein 17 (SPA17), X Antigen Family, Member 1A (XAGEL1), angiopoietin-binding cell surface receptor 2 (Tie 2), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen-2 (MAD-CT-2), Fos-related antigen 1, tumor protein p53 (p53), p53 mutant, prostein, surviving, telomerase, prostate carcinoma tumor antigen-1, melanoma antigen recognized by T cells 1, Rat sarcoma (Ras) mutant, human Telomerase reverse transcriptase (hTERT), sarcoma translocation breakpoints, melanoma inhibitor of apoptosis (ML-IAP), ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene), N-Acetyl glucosaminyl-transferase V (NA17), paired box protein Pax-3 (PAX3), Androgen receptor, Cyclin Bl, v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Ras Homolog Family Member C (RhoC), Tyrosinase-related protein 2 (TRP-2), Cytochrome P450 1B1 (CYP1B1), CCCTC-Binding Factor (Zinc Finger Protein)-Like, Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3), Paired box protein Pax-5 (PAXS5), proacrosin binding protein sp32 (OY-TES1), lymphocyte-specific protein tyrosine kinase (LCK), A kinase anchor protein 4 (AKAP-4), synovial sarcoma, X breakpoint 2 (SSX2), Receptor for Advanced Glycation Endproducts (RAGE-1), renal ubiquitous 1 (RU1), renal ubiquitous 2 (RU2), legumain, human papilloma virus E6 (HPV E6), human papilloma virus E7 (HPV E7), intestinal carboxyl esterase, heat shock protein 70-2 mutated (mut hsp70-2), CD79a, CD79b, CD72, Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), Fc fragment of IgA receptor (FCAR or CD89), Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2), CD300 molecule-like family member f (CD300LF), C-type lectin domain family 12 member A (CLEC12A), bone marrow stromal cell antigen 2 (BST2), EGF-like module- containing mucin-like hormone receptor-like 2 (EMR2), lymphocyte antigen 75 (LY75), Glypican-3 (GPC3), Fc receptor-like 5 (FCRL5), MUCI16, 5T4, 8H9, avp6 integrin, avpB6 integrin, alphafetoprotein (AFP), B7-H6, ca-125, CA9, CD44, CD44v7 / 8, CD52, E-cadherin, EMA (epithelial membrane antigen), epithelial glycoprotein-2 (EGP-2), epithelial glycoprotein-40 (EGP-40), ErbB4, epithelial tumor antigen (ETA), folate binding protein (FBP), kinase insert domain receptor (KDR), k-light chain, L1 cell adhesion molecule, MUCI18, NKG2D, oncofetal antigen (h5T4), tumor / testis-antigen 1B, GAGE, GAGE-1, BAGE, SCP-1, CTZ9, SAGE, CAGE, CT10, MART-1, immunoglobulin lambda-like polypeptide 1 (IGLL1), Hepatitis B Surface Antigen Binding Protein (HBsAg), viral capsid antigen (VCA), early antigen (EA), EBV nuclear antigen (EBNA), HHV-6 p41 early antigen, HHV-6B U94 latent antigen, HHV-6B p98 late antigen , cytomegalovirus (CMV) antigen, large T antigen, small T antigen, adenovirus antigen, respiratory syncytial virus (RSV) antigen, haemagglutinin (HA), neuraminidase (NA), parainfluenza type 1 antigen, parainfluenza type 2 antigen, parainfluenza type 3 antigen, parainfluenza type 4 antigen, Human Metapneumovirus (HMPV) antigen, hepatitis C virus (HCV) core antigen, HIV p24 antigen, human T-cell lympotrophic virus (HTLV-1) antigen, Merkel cell polyoma virus small T antigen, Merkel cell polyoma virus large T antigen, and Kaposi sarcoma-associated herpesvirus (KSHV) lytic nuclear antigen and KSHV latent nuclear antigen.. Hinge / spacer domain
[275] In some embodiments, a CAR of the instant disclosure comprises a hinge or spacer domain. In some embodiments, the hinge / spacer domain may comprise a truncated hinge / spacer domain (THD) the THD domain is a truncated version of a complete hinge / spacer domain (“CHD”). In some embodiments, an extracellular domain is from or derived from (e.g., comprises all or a fragment of) ErbB2, glycophorin A (GpA), CD2, CD3 delta, CD3 epsilon, CD3 gamma, CD4, CD7, CD8a, CDS§[T CDl 1a (IT GAL), CDI 1b (IT GAM), CDI Ic (ITGAX), CDI 1d (IT GAD), CD18 (ITGB2), CD19 (B4), CD27 (TNFRSF7), CD28, CD28T, CD29 (ITGB1), CD30 (TNFRSF8), CD40 (TNFRSFS), CD48 (SLAMF2), CD49a (ITGA1), CD49d (ITGA4), CD49f (ITGA6), CD66a (CEACAM1), CD66b (CEACAMS), CD66¢c (CEACAMO), CD66d (CEACAM3), CD66e (CEACAMS), CD69 (CLEC2), CD79A (B-cell antigen receptor complex-associated alpha chain), CD79B (B-cell antigen receptor complex-associated beta chain), CD84 (SLAMF35), CD96 (Tactile), CD100 (SEMA4D), CD103 (ITGAE), CD134 (0X40), CD137 (4-1BB), CD150 (SLAMF1), CD158A (KIR2DL1), CD158B1 (KIR2DL2), CD158B2 (KIR2DL3), CD158C (KIR3DP1), CD158D (KIRDL4), CD158F1 (KIR2DL5A), CD158F2 (KIR2DLS5B), CD158K (KIR3DL2), CD160 (BY5S5), CD162 (SELPLG), CD226 (DNAM1), CD229 (SLAMF3), CD244 (SLAMF4), CD247 (CD3-zeta), CD258 (LIGHT), CD268 (BAFFR), CD270 (TNFSF14), CD272 (BTLA), CD276 (B7-H3), CD279 (PD-1), CD314 (NKG2D), CD319 (SLAMF7), CD335 (NK-p46), CD336 (NK-p44), CD337 (NK- p30), CD352 (SLAMF6), CD353 (SLAMFS8), CD355 (CRT AM), CD357 (TNFRSF18), inducible T cell co-stimulator (ICOS), LFA-1 (CDI 1a / CD18), NKG2C, DAP-10, ICAM-1, NKp80 (KLRF1), IL-2R beta, IL-2R gamma, IL-7R alpha, LFA-1, SLAMF9, LAT, GADS (GrpL), SLP-76 (LCP2), PAG1 / CBP, a CD83 ligand, Fc gamma receptor, MHC class 1 molecule, MHC class 2 molecule, a TNF receptor protein, an immunoglobulin protein, a cytokine receptor, an integrin, activating NK cell receptors, a Toll ligand receptor, and fragments or combinations thereof. A hinge or spacer domain may be derived either from a natural or from a synthetic source.
[276] In some embodiments, a hinge or spacer domain is positioned between an antigen binding molecule (e.g., an scFv) and a transmembrane domain. In this orientation, the hinge / spacer domain provides distance between the antigen binding molecule and the surface of a cell membrane on which the CAR is expressed. In some embodiments, a hinge or spacer domain is from or derived from an immunoglobulin. In some embodiments, a hinge or spacer domain is selected from the hinge / spacer regions of IgGl, IgG2, IgG3, IgG4, IgA, IgD, IgE, and IgM, or a fragment thereof. In some embodiments, a hinge or spacer domain comprises, is from, or is derived from the hinge / spacer region of CD8 alpha. In some embodiments, a hinge or spacer domain comprises, is from, or is derived from the hinge / spacer region of CD28. In some embodiments, a hinge or spacer domain comprises a fragment of the hinge / spacer region of CDS alpha or a fragment of the hinge / spacer region of CD28, wherein the fragment is anything less than the whole hinge / spacer region. In some embodiments, the fragment of the CDS alpha hinge / spacer region or the fragment of the CD28 hinge / spacer region comprises an amino acid sequence that excludes at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 amino acids at the N- terminus or C-Terminus, or both, of the CD8 alpha hinge / spacer region, or of the CD28 hinge / spacer region. Transmembrane domain
[277] The CAR of the present disclosure may further comprise a transmembrane domain and / or an intracellular signaling domain. The transmembrane domain may be designed to be fused to the extracellular domain of the CAR. It may similarly be fused to the intracellular domain of the CAR. In some embodiments, the transmembrane domain that naturally is associated with one of the domains in a CAR is used. In some instances, the transmembrane domain may be selected or modified (e.g ., by an amino acid substitution) to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex. The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
[278] Transmembrane regions may be derived from (i.e., comprise) a receptor tyrosine kinase (e.g., ErbB2), glycophorin A (GpA), 4-1BB / CD137, activating NK cell receptors, an Immunoglobulin protein, B7-H3, BAFFR, BFAME (SEAMES), BTEA, CD100 (SEMA4D), CD103, CD160(BY5S5), CD 18, CD 19, CD 19a, CD2, CD247, CD27, CD276 (B7-H3), CD28, CD29, CD3 delta, CD3 epsilon, CD3 gamma, CD30, CD4, CD40, CD49a, CD49D, CD49f, CD69, CD7, CD84, CD8alpha, CD8beta, CD96 (Tactile), CD1 la, CD1 1b, CD1 lc, CD1 Id, CDS, CEACAMI, CRT AM, cytokine receptor, DAP-10, DNAM1 (CD226), Fc gamma receptor, GADS, GITR, HVEM (EIGHTR), IA4, ICAM-1, ICAM-1, Ig alpha (CD79a), IE-2R beta, IE-2R gamma, IE-7R alpha, inducible T cell costimulator (ICOS), integrins, ITGA4, ITGA4, ITGA6, IT GAD, ITGAE, ITGAE, IT GAM, ITGAX, ITGB2, ITGB7, ITGB1, KIRDS?2, EAT, LFA-1, LFA-1, a ligand that specifically binds with CD83, LIGHT, LIGHT, LTBR, Ly9 (CD229), lymphocyte function-associated antigen-1 (LFA-1; CDI-1a / CD18), MHC class 1 molecule, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), 0X-40, PAG / Cbp, programmed death-1 (PD-1), PSGL1, SELPLG (CD162), Signaling Lymphocytic Activation Molecules (SLAM proteins), SLAM (SLAMF1; CD150; IPO-3), SLAMF4 (CD244; 2B4), SLAMF6 (NTB-A; Lyl08), SLAMF7, SLP-76, TNF receptor proteins, TNFR2, TNESF14, a Toll ligand receptor, TRANCE / RANKL, VLAl, or VLA-6, or a fragment, truncation, or a combination thereof.
[279] In some embodiments, a receptor tyrosine kinase may be derived from (e.g., comprise) Insulin receptor (InsR), Insulin-like growth factor I receptor (IGFIR), Insulin receptor-related receptor (IRR), platelet derived growth factor receptor alpha (PDGFRa), platelet derived growth factor receptor beta (PDGFRfi). KIT proto-oncogene receptor tyrosine kinase (Kit), colony stimulating factor 1 receptor (CSFR), fms related tyrosine kinase 3 (FLT3), fms related tyrosine kinase 1 (VEGFR-1), kinase insert domain receptor (VEGFR-2), fms related tyrosine kinase 4 (VEGFR-3), fibroblast growth factor receptor 1 (FGFR1), fibroblast growth factor receptor 2 (FGFR2), fibroblast growth factor receptor 3 (FGFR3), fibroblast growth factor receptor 4 (FGFR4), protein tyrosine kinase 7 (CCK4), neurotrophic receptor tyrosine kinase 1 (trkA), neurotrophic receptor tyrosine kinase 2 (trkB), neurotrophic receptor tyrosine kinase 3 (trkC), receptor tyrosine kinase like orphan receptor 1 (ROR1), receptor tyrosine kinase like orphan receptor 2 (ROR2), muscle associated receptor tyrosine kinase (MuSK), MET proto- oncogene, receptor tyrosine kinase (MET), macrophage stimulating 1 receptor (Ron), AXL receptor tyrosine kinase (Axl), TYRO3 protein tyrosine kinase (Tyro3), MER proto-oncogene, tyrosine kinase (Mer), tyrosine kinase with immunoglobulin like and EGF like domains 1 (TIE1), TEK receptor tyrosine kinase (TIE2), EPH receptor Al (EphAl), EPH receptor A2 (EphA2), (EPH receptor A3) EphA3, EPH receptor A4 (EphA4), EPH receptor A5 (EphAS), EPH receptor A6 (EphA6), EPH receptor A7 (EphA7), EPH receptor A8 (EphAS8), EPH receptor A10 (EphAlO), EPH receptor B1 (EphBl), EPH receptor B2 (EphB2), EPH receptor B3 (EphB3), EPH receptor B4 (EphB4), EPH receptor B6 (EphB6), ret proto oncogene (Ret), receptor-like tyrosine kinase (RYK), discoidin domain receptor tyrosine kinase 1 (DDRI1), discoidin domain receptor tyrosine kinase 2 (DDR2), c-ros oncogene 1, receptor tyrosine kinase (ROS), apoptosis associated tyrosine kinase (Lmrl), lemur tyrosine kinase 2 (Lmr2), lemur tyrosine kinase 3 (Lmr3), leukocyte receptor tyrosine kinase (LTK), ALK receptor tyrosine kinase (ALK), or serine / threonine / tyrosine kinase 1 (STYK1). Costimulatory Domain
[280] In certain embodiments, the CAR comprises a costimulatory domain. In some embodiments, the costimulatory domain comprises 4-1BB (CD137), CD28, or both, and / or an intracellular T cell signaling domain. In a preferred embodiment, the costimulatory domain is human CD28, human 4-1BB, or both, and the intracellular T cell signaling domain is human CD3 zeta (§). The 4-1BB, CD28, CD3 zeta, or any of these may comprise less than the whole 4-1BB, CD28 or CD3 zeta, respectively. Chimeric antigen receptors may incorporate costimulatory (signaling) domains to increase their potency. See U.S. Patent Nos. 7,741,465, and 6,319,494, as well as Krause et al. and Finney et al. (supra), Song et al., Blood 119:696- 706 (2012); Kalos et al., Sci Transl. Med. 3:95 (2011); Porter ez al., N. Engl. J. Med. 365:725- 33 (2011), and Gross ef al., Amur. Rev. Pharmacol. Toxicol. 56:59-83 (2016).
[281] In some embodiments, a costimulatory domain comprises the amino acid sequence of SEQ ID NO: 318 or 320. Intracellular signaling domain
[282] The intracellular (signaling) domain of the engineered T cells disclosed herein may provide signaling to an activating domain, which then activates at least one of the normal effector functions of the immune cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
[283] In some embodiments, suitable intracellular signaling domains include (e.g., comprise), but are not limited to 4-1BB / CD137, activating NK cell receptors, an Immunoglobulin protein, B7-H3, BAFFR, BLAME (SLAMF8), BTLA, CD100 (SEMA4D), CD103, CD160 (BY55), CD18, CD19, CD 19a, CD2, CD247, CD27, CD276 (B7-H3), CD28, CD29, CD3 delta, CD3 epsilon, CD3 gamma, CD30, CD4, CD40, CD49a, CD49D, CD49f, CD69, CD7, CD84, CD8alpha, CD8beta, CD96 (Tactile), CD1 la, CDI 1b, CD1 lc, CD1 Id, CDS, CEACAM1, CRT AM, cytokine receptor, DAP-10, DNAM1 (CD226), Fc gamma receptor, GADS, GITR, HVEM (LIGHTR), IA4, ICAM-1, ICAM-1, Ig alpha (CD79a), IL-2R beta, IL-2R gamma, IL- TR alpha, inducible T cell costimulator (ICOS), integrins, ITGA4, ITGA4, ITGAS, IT GAD, ITGAE, ITGAL, IT GAM, ITGAX, ITGB2, ITGB7, ITGB1, KIRDS2, LAT, LFA-1, LFA-1, ligand that specifically binds with CD83, LIGHT, LIGHT, LTBR, Ly9 (CD229), Lyl08), lymphocyte function-associated antigen- 1 (LFA-1; CDI-1a / CD18), MHC class 1 molecule, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), OX-40, PAG / Cbp, programmed death-1 (PD-1), PSGL1, SELPLG (CD162), Signaling Lymphocytic Activation Molecules (SLAM proteins), SLAM (SLAMF1; CD150; IPO-3), SLAMF4 (CD244; 2B4), SLAMEF6 (NTB-A, SLAMF7, SLP-76, TNF receptor proteins, TNFR2, TNFSF14, a Toll ligand receptor, TRANCE / RANKL, VLAl, or VLA-6, or a fragment, truncation, or a combination thereof.
[284] CD3 is an element of the T cell receptor on native T cells, and has been shown to be an important intracellular activating element in CARs. In some embodiments, the CD3 is CD3 zeta. In some embodiments, the activating domain comprises an amino acid sequence at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the polypeptide sequence of SEQ ID NO: 319. 9. Production of polynucleotides
[285] The vectors provided herein can be made using standard techniques of molecular biology. For example, the various elements of the vectors provided herein can be obtained using recombinant methods, such as by screening cDNA and genomic libraries from cells, or by deriving the polynucleotides from a vector known to include the same.
[286] The various elements of the vectors provided herein can also be produced synthetically, rather than cloned, based on the known sequences. The complete sequence can be assembled from overlapping oligonucleotides prepared by standard methods and assembled into the complete sequence. See, e.g., Edge, Nature (1981) 292:756; Nambair er al., Science (1984) 223: 1299; and Jay et al., J. Biol. Chem. (1984) 259:631 1.
[287] Thus, particular nucleotide sequences can be obtained from vectors harboring the desired sequences or synthesized completely, or in part, using various oligonucleotide synthesis techniques known in the art, such as site-directed mutagenesis and polymerase chain reaction (PCR) techniques where appropriate. One method of obtaining nucleotide sequences encoding the desired vector elements is by annealing complementary sets of overlapping synthetic oligonucleotides produced in a conventional, automated polynucleotide synthesizer, followed by ligation with an appropriate DNA ligase and amplification of the ligated nucleotide sequence via PCR. See, e.g., Jayaraman et al., Proc. Natl. Acad. Sci. USA (1991) 88:4084- 4088. Additionally, oligonucleotide-directed synthesis (Jones et al., Nature (1986) 54:75-82), oligonucleotide directed mutagenesis of preexisting nucleotide regions (Riechmann er al., Nature (1988) 332:323-327 and Verhoeyen et al, Science (1988) 239: 1534-1536), and enzymatic filling-in of gapped oligonucleotides using T4 DNA polymerase (Queen et al., Proc. Natl. Acad. Sci. USA (1989) 86: 10029-10033) can be used.
[288] The precursor RNA provided herein can be generated by incubating a vector provided herein under conditions permissive of transcription of the precursor RNA encoded by the vector. For example, in some embodiments a precursor RNA is synthesized by incubating a vector provided herein that comprises an RNA polymerase promoter upstream of its 5” duplex forming region and / or expression sequence with a compatible RNA polymerase enzyme under conditions permissive of in vitro transcription. In some embodiments, the vector is incubated inside of a cell by a bacteriophage RNA polymerase or in the nucleus of a cell by host RNA polymerase II.
[289] In certain embodiments, provided herein is a method of generating precursor RNA by performing in vitro transcription using a vector provided herein as a template (e.g., a vector provided herein with a RNA polymerase promoter positioned upstream of the 5’ homology region).
[290] In certain embodiments, the resulting precursor RNA can be used to generate circular RNA (e.g., a circular RNA polynucleotide provided herein) by incubating it in the presence of magnesium ions and guanosine nucleotide or nucleoside at a temperature at which RNA circularization occurs (e.g., between 20 °C and 60 °C).
[291] Thus, in certain embodiments provided herein is a method of making circular RNA. In certain embodiments, the method comprises synthesizing precursor RNA by transcription (e.g., run-off transcription) using a vector provided herein (e.g., a vector comprising, in the following order, a 5’ homology region, a 3’ group I intron fragment, a first spacer, an Internal Ribosome Entry Site (IRES), an expression sequence, a second spacer, a 5° group I intron fragment, and a 3’ homology region) as a template, and incubating the resulting precursor RNA in the presence of divalent cations (e.g., magnesium ions) and GTP such that it circularizes to form circular RNA. In some embodiments, an inventive precursor RNA is capable of circularizing in the absence of magnesium ions and GTP and / or without the step of incubation with magnesium ions and GTP. In some embodiments, transcription is carried out in the presence of an excess of GMP.
[292] In some embodiments, a composition comprising circular RNA has been purified. Circular RNA may be purified by any known method commonly used in the art, such as column chromatography, gel filtration chromatography, and size exclusion chromatography. In some embodiments, purification comprises one or more of the following steps: phosphatase treatment, HPLC size exclusion purification, and RNase R digestion. In some embodiments, purification comprises the following steps in order: RNase R digestion, phosphatase treatment, and HPLC size exclusion purification. In some embodiments, purification comprises reverse phase HPLC. In some embodiments, a purified composition contains less double stranded RNA, DNA splints, triphosphorylated RNA, phosphatase proteins, protein ligases, capping enzymes and / or nicked RNA than unpurified RNA. In some embodiments, a purified composition is less immunogenic than an unpurified composition. In some embodiments, immune cells exposed to a purified composition produce less IFN-B1, RIG-I, IL-2, IL-6, IFNy, and / or TNFa than immune cells exposed to an unpurified composition. 10. Nanoparticles
[293] In certain aspects, provided herein are pharmaceutical compositions comprising the circular RNA provided herein. In certain embodiments, such pharmaceutical compositions are formulated with nanoparticles to facilitate delivery.
[294] In certain embodiments, the circular RNA provided herein may be delivered and / or targeted to a cell in a transfer vehicle, e.g., a nanoparticle, or a composition comprising a nanoparticle. In some embodiments, the circular RNA may also be delivered to a subject in a transfer vehicle or a composition comprising a transfer vehicle. In some embodiments, the transfer vehicle is a nanoparticle. In some embodiments, the nanoparticle is a lipid nanoparticle, a non-lipid polymeric core-shell nanoparticle, or a biodegradable nanoparticle. In some embodiments, the transfer vehicle comprises one or more cationic lipids, non-cationic lipids, ionizable lipids, PEG-modified lipids, polyglutamic acid lipids, Hyaluronic acid lipids, poly B-amino esters, poly beta amino peptides, or positively charged peptides.
[295] In one embodiment, the transfer vehicle may be selected and / or prepared to optimize delivery of the circRNA to a target cell. For example, if the target cell is a hepatocyte the properties of the transfer vehicle (e.g., size, charge and / or pH) may be optimized to effectively deliver such transfer vehicle to the target cell, reduce immune clearance and / or promote retention in that target cell. Alternatively, if the target cell is the central nervous system (e.g., circRNA administered for the treatment of neurodegenerative diseases may specifically target brain or spinal tissue), selection and preparation of the transfer vehicle must consider penetration of; and retention within the blood brain barrier and / or the use of alternate means of directly delivering such transfer vehicle to such target cell. In one embodiment, the compositions of the present invention may be combined with agents that facilitate the transfer of exogenous circRNA (e.g., agents which disrupt or improve the permeability of the blood brain barrier and thereby enhance the transfer of exogenous circRNA to the target cells).
[296] The use of transfer vehicles to facilitate the delivery of nucleic acids to target cells is contemplated by the present invention. Liposomes (e.g., liposomal lipid nanoparticles) are generally useful in a variety of applications in research, industry, and medicine, particularly for their use as transfer vehicles of diagnostic or therapeutic compounds in vivo (Lasic, Trends Biotechnol., 16: 307-321, 1998; Drummond et al., Pharmacol. Rev., 51: 691-743, 1999) and are usually characterized as microscopic vesicles having an interior aqueous space sequestered from an outer medium by a membrane of one or more bilayers. Bilayer membranes of liposomes are typically formed by amphiphilic molecules, such as lipids of synthetic or natural origin that comprise spatially separated hydrophilic and hydrophobic domains (Lasic, Trends Biotechnol. 16: 307-321, 1998). Bilayer membranes of the liposomes can also be formed by amphiphilic polymers and surfactants (e.g., polymerosomes, niosomes, etc.).
[297] In the context of the present invention, a transfer vehicle typically serves to transport the circRNA to the target cell. For the purposes of the present invention, the transfer vehicles are prepared to contain the desired nucleic acids. The process of incorporation of a desired entity (e.g., a nucleic acid) into a liposome is often referred to as loading (Lasic, et al., FEBS Lett., 312: 255-258, 1992). The liposome-incorporated nucleic acids may be completely or partially located in the interior space of the liposome, within the bilayer membrane of the liposome, or associated with the exterior surface of the liposome membrane. The purpose of incorporating a circRNA into a transfer vehicle, such as a liposome, is often to protect the nucleic acid from an environment which may contain enzymes or chemicals that degrade nucleic acids and / or systems or receptors that cause the rapid excretion of the nucleic acids. Accordingly, in an embodiment of the present invention, the selected transfer vehicle is capable of enhancing the stability of the circRNA contained therein. The liposome can allow the encapsulated circRNA to reach the target cell and / or may allow the encapsulated circRNA to reach the target cell, or alternatively limit the delivery of such circRNA to other sites or cells where the presence of the administered circRNA may be useless or undesirable. Furthermore, incorporating the circRNA into a transfer vehicle, such as for example, a cationic liposome, also facilitates the delivery of such circRNA into a target cell.
[298] Ideally, transfer vehicles are prepared to encapsulate one or more desired circRNA such that the compositions demonstrate a high transfection efficiency and enhanced stability. While liposomes can facilitate introduction of nucleic acids into target cells, the addition of polycations (e.g., poly L-lysine and protamine), as a copolymer can facilitate, and in some instances markedly enhance the transfection efficiency of several types of cationic liposomes by 2-28 fold in a number of cell lines both in vitro and in vivo. (See N J. Caplen, er al., Gene Ther. 1995; 2: 603; S. Li, et al., Gene Ther. 1997; 4, 891.)
[299] In an embodiment of the present invention, the transfer vehicle is formulated as a lipid nanoparticle. In an embodiment, the lipid nanoparticles are formulated to deliver one or more circRNA to one or more target cells. Examples of suitable lipids include the phosphatidyl compounds (e.g, phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides). Also contemplated is the use of polymers as transfer vehicles, whether alone or in combination with other transfer vehicles. Suitable polymers may include, for example, polyacrylates, polyalkycyanoacrylates, polylactide, polylactide-polyglycolide copolymers, polycaprolactones, dextran, albumin, gelatin, alginate, collagen, chitosan, cyclodextrins, dendrimers and polyethylenimine. In an embodiment, the transfer vehicle is formulated as a lipid as described in US patent application 16 / 065,067, incorporated herein in its entirety. In one embodiment, the transfer vehicle is selected based upon its ability to facilitate the transfection of a circRNA to a target cell.
[300] The invention contemplates the use of lipid nanoparticles as transfer vehicles comprising a cationic lipid to encapsulate and / or enhance the delivery of circRNA into the target cell that will act as a depot for protein production. The contemplated lipid nanoparticles may be prepared by including multi-component lipid mixtures of varying ratios employing one or more cationic lipids, non-cationic lipids and PEG-modified lipids. Several cationic lipids have been described in the literature, many of which are commercially available.
[301] Suitable cationic lipids for use in the compositions and methods of the invention include those described in international patent publication WO 2010 / 053572 and / or US patent application 15 / 809,680, e.g., C12-200. In certain embodiments, the compositions and methods of the invention employ a lipid nanoparticles comprising an ionizable cationic lipid described in U.S. provisional patent application 61 / 617,468, filed Mar. 29, 2012 (incorporated herein by reference), such as, e.g, (15Z,18Z)—N,N-dimethyl-6-(9Z,127Z)-octadeca-9,12-dien-1- yDtetracosa-15,18-dien-1-amine ~~ (HGT5000), (15Z,18Z)—N,N-dimethyl-6-((9Z,127Z)- octadeca-9,12-dien-1-yl)tetracosa-4,15,18-trien-1-amine (HGT5001), and (15Z,18Z)—N,N- dimethyl-6-((9Z,12Z)-octadeca-9,12-dien-1-yl)tetracosa-5,15,18-trien- 1-amine (HGT5002).
[302] In some embodiments, the cationic lipid N-[1-(2,3-dicleyloxy)propyl]-N,N,N- trimethylammonium chloride or “DOTMA?” is used. (Felgner et al. (Proc. Nat'l Acad. Sci. 84, 7413 (1987); U.S. Pat. No. 4,897,355). DOTMA can be formulated alone or can be combined with the neutral lipid, dioleoylphosphatidyl-ethanolamine or “DOPE” or other cationic or non- cationic lipids into a transfer vehicle or a lipid nanoparticle, and such liposomes can be used to enhance the delivery of nucleic acids into target cells. Other suitable cationic lipids include, for example, 5-carboxyspermylglycinedioctadecylamide or “DOGS,” 2,3-dioleyloxy-N- [2(spermine-carboxamido)ethyl]-N,N-dimethyl-1-propanaminium or “DOSPA” (Behr et al. Proc. Nat.'l Acad. Sci. 86, 6982 (1989); U.S. Pat. Nos. 5,171,678; 5,334,761), 1,2-Dioleoyl-3- Dimethylammonium-Propane or “DODAP,” 1,2-Dioleoyl-3-Trimethylammonium-Propane or “DOTAP.” Contemplated cationic lipids also include 1,2-distearyloxy-N,N-dimethyl-3- aminopropane or “DSDMA”, 1,2-dioleyloxy-N,N-dimethyl-3-aminopropane or “DODMA,” 1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane or “DLinDMA,” 1,2-dilinolenyloxy-N,N- dimethyl-3-aminopropane or “DLenDMA,” N-dioleyl-N,N-dimethylammonium chloride or “DODAC,” N,N-distearyl-N,N-dimethylammonium bromide or “DDAB,” N-(1,2- dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl ammonium bromide or “DMRIE,” 3- dimethylamino-2-(cholest-5-en-3-beta-ox ybutan-4-oxy)-1-(cis,cis-9,12- octadecadienoxy)propane or “CLinDMA,” 2-[5’-(cholest-5-en-3-beta-oxy)-3’-oxapentoxy)-3- dimethy 1-1-(cis,cis-9’, 1-2’-octadecadienoxy)propane or “CpLinDMA,” N,N-dimethyl-3,4- dioleyloxybenzylamine or “DMOBA,” 1,2-N,N’-dioleylcarbamyl-3-dimethylaminopropane or “DOcarbDAP,” 2,3-Dilinoleoyloxy-N,N-dimethylpropylamine or “DLinDAP,” 1,2-N,N’- Dilinoleylcarbamyl-3-dimethylaminopropane or “DLincarbDAP,” 1,2-Dilinoleoylcarbamyl-3- dimethylaminopropane or “DLinCDAP,” 2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]- dioxolane or “DLin-K-DMA,” 2,2-dilinoleyl-4-dimethylaminoethyl-[ 1,3]-dioxolane or “DLin- K-XTC2-DMA,” and 2-(2,2-di((9Z,12Z)-octadeca-9,12-dien-1-yl)-1,3-dioxolan-4-yl)-N,N- dimethylethanamine (DLin-KC2-DMA)) (See, WO 2010 / 042877; Semple et al., Nature Biotech. 28:172-176 (2010)), or mixtures thereof. (Heyes, J., er al., J Controlled Release 107: 276-287 (2005); Morrissey, D V., et al., Nat. Biotechnol. 23(8): 1003-1007 (2005); PCT Publication W02005 / 121348A1).
[303] The use of cholesterol-based cationic lipids is also contemplated by the present invention. Such cholesterol-based cationic lipids can be used, either alone or in combination with other cationic or non-cationic lipids. Suitable cholesterol-based cationic lipids include, for example, GL67, DC-Chol (N,N-dimethyl-N-ethylcarboxamidocholesterol), 1,4-bis(3-N- oleylamino-propyl)piperazine (Gao, er al. Biochem. Biophys. Res. Comm. 179, 280 (1991); Wolf et al. BioTechniques 23, 139 (1997); U.S. Pat. No. 5,744,335), or ICE.
[304] In addition, several reagents are commercially available to enhance transfection efficacy. Suitable examples include LIPOFECTIN (DOTMA:DOPE) (Invitrogen, Carlsbad, CA), LIPOFECTAMINE (DOSPA:DOPE) (Invitrogen), LIPOFECTAMINE2000. (Invitrogen), FUGENE (Promega, Madison, WI), TRANSFECTAM (DOGS) (Promega), and EFFECTENE (Qiagen, Valencia, CA).
[305] Also contemplated are cationic lipids such as the dialkylamino-based, imidazole-based, and guanidinium-based lipids, such as those described in US patent 10,413,618.
[306] In other embodiments the compositions and methods described herein are directed to lipid nanoparticles comprising one or more cleavable lipids, such as, for example, one or more cationic lipids or compounds that comprise a cleavable disulfide (S—S) functional group (e.g., HGT4001, HGT4002, HGT4003, HGT4004 and HGT4005), as further described in U.S. Provisional Application No. 61 / 494,7435, the entire teachings of which are incorporated herein by reference in their entirety.
[307] The use of polyethylene glycol (PEG)-modified phospholipids and derivatized lipids such as derivatized ceramides (PEG-CER), including N-Octanoyl-Sphingosine-1- [Succinyl(Methoxy Polyethylene Glycol)-2000] (C8 PEG-2000 ceramide) is also contemplated by the present invention, either alone or in combination with other lipids together which comprise the transfer vehicle (e.g., a lipid nanoparticle). Contemplated PEG-modified lipids include, but are not limited to, a polyethylene glycol chain of up to 5 kDa in length covalently attached to a lipid with alkyl chain(s) of C6-C20 length. The addition of such components may prevent complex aggregation and may also provide a means for increasing circulation lifetime and increasing the delivery of the lipid-nucleic acid composition to the target cell, (Klibanov et al. (1990) FEBS Letters, 268 (1): 235-237), or they may be selected to rapidly exchange out of the formulation in vivo (see U.S. Pat. No. 5,885,613). Particularly useful exchangeable lipids are PEG-ceramides having shorter acyl chains (e.g., C14 or C18). The PEG-modified phospholipid and derivatized lipids of the present invention may comprise a molar ratio from about 0% to about 20%, about 0.5% to about 20%, about 1% to about 15%, about 4% to about 10%, or about 2% of the total lipid present in the transfer vehicle.
[308] The present invention also contemplates the use of non-cationic lipids including those described in US patent application 15 / 809,680. Non-cationic lipids include, but are not limited to, distearoylphosphatidylcholine ~~ (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoylphosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoyl-phosphatidylethanolamine (POPE), dioleoyl-phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane-1- carboxylate (DOPE-mal), dipalmitoyl ~~ phosphatidyl ethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoyl-phosphatidyl-ethanolamine (DSPE), 16-O-monomethyl PE, 16-O-dimethyl PE, 18-1-trans PE, 1-stearoyl-2-oleoyl- phosphatidyethanolamine (SOPE), cholesterol, or a mixture thereof. Such non-cationic lipids may be used alone or in combination with other excipients, for example, cationic lipids. When used in combination with a cationic lipid, the non-cationic lipid may comprise a molar ratio of 5% to about 90%, or about 10% to about 70% of the total lipid present in the transfer vehicle.
[309] The transfer vehicle (e.g., a lipid nanoparticle) may be prepared by combining multiple lipid and / or polymer components. For example, a transfer vehicle may be prepared using C12- 200, DOPE, cholesterol, DMG-PEG2K at a molar ratio of 40:30:25:5, or DODAP, DOPE, cholesterol, DMG-PEG2K at a molar ratio of 18:56:20:6, or HGTS5000, DOPE, cholesterol, DMG-PEG2K at a molar ratio of 40:20:35:5, or HGT5001, DOPE, cholesterol, DMG-PEG2K at a molar ratio of 40:20:35:5. The selection of cationic lipids, non-cationic lipids and / or PEG- modified lipids which comprise the lipid nanoparticle, as well as the relative molar ratio of such lipids to each other, is based upon the characteristics of the selected lipid(s), the nature of the intended target cells, the characteristics of the circRNA to be delivered. Additional considerations include, for example, the saturation of the alkyl chain, as well as the size, charge, pH. pKa, fusogenicity and toxicity of the selected lipid(s). Thus, the molar ratios may be adjusted accordingly. For example, in some embodiments, the percentage of cationic lipid in the lipid nanoparticle may be greater than 10%, greater than 20%, greater than 30%, greater than 40%, greater than 50%, greater than 60%, or greater than 70%. The percentage of non- cationic lipid in the lipid nanoparticle may be greater than 5%, greater than 10%, greater than 20%, greater than 30%, or greater than 40%. The percentage of cholesterol in the lipid nanoparticle may be greater than 10%, greater than 20%, greater than 30%, or greater than 40%. The percentage of PEG-modified lipid in the lipid nanoparticle may be greater than 1%, greater than 2%, greater than 5%, greater than 10%, or greater than 20%.
[310] The transfer vehicles for use in the compositions of the invention can be prepared by various techniques which are presently known in the art. Multi-lamellar vesicles (MLV) may be prepared using conventional techniques, for example, by depositing a selected lipid on the inside wall of a suitable container or vessel, dissolving the lipid in an appropriate solvent, and then evaporating the solvent to leave a thin film on the inside of the vessel or by spray-drying. An aqueous phase may then be added to the vessel with a vortexing motion which results in the formation of MLVs. Uni-lamellar vesicles (ULV) can then be formed by homogenization, sonication or extrusion of the multi-lamellar vesicles. In addition, ULV can be formed by detergent removal techniques.
[311] In certain embodiments of this invention, the compositions of the present invention comprise a transfer vehicle wherein the circRNA is associated on both the surface of the transfer vehicle and encapsulated within the same transfer vehicle. For example, during preparation of the compositions of the present invention, cationic transfer vehicles may associate with the circRNA through electrostatic interactions.
[312] In certain embodiments, the compositions of the invention may be loaded with diagnostic radionuclide, fluorescent materials or other materials that are detectable in both in vitro and in vivo applications. For example, suitable diagnostic materials for use in the present invention may include Rhodamine-dioleoylphosphatidylethanolamine (Rh-PE), Green Fluorescent Protein circRNA (GFP circRNA), Renilla Luciferase circRNA and Firefly Luciferase circRNA.
[313] In some embodiments, selection of the appropriate size of a transfer vehicle takes into consideration the site of the target cell or tissue and to some extent the application for which the liposome is being made. In some embodiments, it may be desirable to limit transfection of the circRNA to certain cells or tissues. For example, to target hepatocytes a transfer vehicle may be sized such that its dimensions are smaller than the fenestrations of the endothelial layer lining hepatic sinusoids in the liver. Accordingly, the appropriately-sized transfer vehicle can readily penetrate such endothelial fenestrations to reach the target hepatocytes. Alternatively, a transfer vehicle may be sized such that the dimensions of the liposome are of a sufficient diameter to limit or expressly avoid distribution into certain cells or tissues. For example, a transfer vehicle may be sized such that its dimensions are larger than the fenestrations of the endothelial layer lining hepatic sinusoids to thereby limit distribution of the transfer vehicle to hepatocytes. Generally, the size of the transfer vehicle is within the range of about 25 to 250 nm. In some embodiments, the size of the transfer vehicle is less than about 250 nm, 175 nm, 150 nm, 125 nm, 100 nm, 75 nm, 50 nm, 25 nm or 10 nm.
[314] A variety of alternative methods known in the art are available for sizing of a population of transfer vehicles. One such sizing method is described in U.S. Pat. No. 4,737,323, incorporated herein by reference. Sonicating a liposome suspension either by bath or probe sonication produces a progressive size reduction down to small ULV less than about 0.05 microns in diameter. Homogenization is another method that relies on shearing energy to fragment large liposomes into smaller ones. In a typical homogenization procedure, MLV are recirculated through a standard emulsion homogenizer until selected liposome sizes, typically between about 0.1 and 0.5 microns, are observed. The size of the liposomal vesicles may be determined by quasi-electric light scattering (QELS) as described in Bloomfield, Ann. Rev. Biophys. Bioeng., 10:421-450 (1981), incorporated herein by reference. Average liposome diameter may be reduced by sonication of formed liposomes. Intermittent sonication cycles may be alternated with QELS assessment to guide efficient liposome synthesis.
[315] Additionally, in certain embodiments, the circular RNA provided herein can be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles. In one embodiment, the circular RNA may be formulated in a lipid nanoparticle such as those described in International Publication No. W02012170930, herein incorporated by reference in its entirety. In one embodiment, the lipid may be a cleavable lipid such as those described in International Publication No. W0O2012170889, herein incorporated by reference in its entirety. In one embodiment, the pharmaceutical compositions of the circular RNA may include at least one of the PEGylated lipids described in International Publication No. 2012099755, herein incorporated by reference. In one embodiment, a lipid nanoparticle formulation may be formulated by the methods described in International Publication Nos. W02011127255 or ‘W02008103276, each of which is herein incorporated by reference in their entirety. A lipid nanoparticle may be coated or associated with a co-polymer such as, but not limited to, a block co-polymer, such as a branched polyether-polyamide block copolymer described in International Publication No. W02013012476, herein incorporated by reference in its entirety. Liposomes, lipoplexes, or lipid nanoparticles may be used to improve the efficacy of circular RNA directed protein production as these formulations may be able to increase cell transfection by the circular RNA, increase the in vivo or in vitro half-life of the circular RNA, and / or allow for controlled release.
[316] In embodiments, a polynucleotide encodes a protein that is made up of subunits that are encoded by more than one gene. For example, the protein may be a heterodimer, wherein each chain or subunit of the protein is encoded by a separate gene. It is possible that more than one circRNA molecule is delivered in the transfer vehicle and each circRNA encodes a separate subunit of the protein. Alternatively, a single circRNA may be engineered to encode more than one subunit (e.g. in the case of a single-chain Fv antibody). In certain embodiments, separate circRNA molecules encoding the individual subunits may be administered in separate transfer vehicles.
[317] The present invention also contemplates the discriminatory targeting of target cells and tissues by both passive and active targeting means. The phenomenon of passive targeting exploits the natural distributions patterns of a transfer vehicle in vivo without relying upon the use of additional excipients or means to enhance recognition of the transfer vehicle by target cells. For example, transfer vehicles which are subject to phagocytosis by the cells of the reticulo-endothelial system are likely to accumulate in the liver or spleen, and accordingly, may provide a means to passively direct the delivery of the compositions to such target cells.
[318] Alternatively, the present invention contemplates active targeting, which involves the use of targeting moieties that may be bound (either covalently or non-covalently) to the transfer vehicle to encourage localization of such transfer vehicle at certain target cells or target tissues. For example, targeting may be mediated by the inclusion of one or more endogenous targeting moieties in or on the transfer vehicle to encourage distribution to the target cells or tissues. Recognition of the targeting moiety by the target tissues actively facilitates tissue distribution and cellular uptake of the transfer vehicle and / or its contents in the target cells and tissues (e.g., the inclusion of an apolipoprotein-E targeting ligand in or on the transfer vehicle encourages recognition and binding of the transfer vehicle to endogenous low density lipoprotein receptors expressed by hepatocytes). As provided herein, the composition can comprise a moiety capable of enhancing affinity of the composition to the target cell. Targeting moieties may be linked to the outer bilayer of the lipid particle during formulation or post-formulation. These methods are well known in the art. In addition, some lipid particle formulations may employ fusogenic polymers such as PEAA, hemagglutinin, other lipopeptides (see U.S. patent application Ser. No. 08 / 835,281, and 60 / 083,294, which are incorporated herein by reference) and other features useful for in vivo and / or intracellular delivery. In other some embodiments, the compositions of the present invention demonstrate improved transfection efficacies, and / or demonstrate enhanced selectivity towards target cells or tissues of interest. Contemplated therefore are compositions which comprise one or more moieties (e.g., peptides, aptamers, oligonucleotides, a vitamin or other molecules) that are capable of enhancing the affinity of the compositions and their nucleic acid contents for the target cells or tissues. Suitable moieties may optionally be bound or linked to the surface of the transfer vehicle. In some embodiments, the targeting moiety may span the surface of a transfer vehicle or be encapsulated within the transfer vehicle. Suitable moieties and are selected based upon their physical, chemical or biological properties (e.g., selective affinity and / or recognition of target cell surface markers or features). Cell-specific target sites and their corresponding targeting ligand can vary widely. Suitable targeting moieties are selected such that the unique characteristics of a target cell are exploited, thus allowing the composition to discriminate between target and non-target cells. For example, compositions of the invention may include surface markers (e.g., apolipoprotein- B or apolipoprotein-E) that selectively enhance recognition of, or affinity to hepatocytes (e.g., by receptor-mediated recognition of and binding to such surface markers). As an example, the use of galactose as a targeting moiety would be expected to direct the compositions of the present invention to parenchymal hepatocytes, or alternatively the use of mannose containing sugar residues as a targeting ligand would be expected to direct the compositions of the present invention to liver endothelial cells (e.g., mannose containing sugar residues that may bind preferentially to the asialoglycoprotein receptor present in hepatocytes). (See Hillery A M, et al. “Drug Delivery and Targeting: For Pharmacists and Pharmaceutical Scientists” (2002) Taylor & Francis, Inc.) The presentation of such targeting moieties that have been conjugated to moieties present in the transfer vehicle (e.g., a lipid nanoparticle) therefore facilitate recognition and uptake of the compositions of the present invention in target cells and tissues. Examples of suitable targeting moieties include one or more peptides, proteins, aptamers, vitamins and oligonucleotides.
[319] In particular embodiments, a transfer vehicle comprises a targeting moiety. In some embodiments, the targeting moiety mediates receptor-mediated endocytosis selectively into a specific population of cells. In some embodiments, the targeting moiety is capable of binding to a T cell antigen. In some embodiments, the targeting moiety is capable of binding to a NK, NKT, dendritic cell, or macrophage antigen. In some embodiments, the targeting moiety is capable of binding to a protein selected from the group CD3, CD4, CD8, PD-1, 4-1BB, CD35, CD7, Clg, and CD2. In some embodiments, the targeting moiety is an single chain Fv (scFv) fragment, nanobody, peptide, peptide-based macrocycle, minibody, heavy chain variable region, light chain variable region or fragment thereof. In some embodiments, the targeting moiety is selected from anti T-cell receptor motif antibodies, anti T-cell « chain antibodies, anti T-cell B chain antibodies, anti T-cell y chain antibodies, anti T-cell § chain antibodies, anti CCR?7 antibodies, anti CD3 antibodies, anti CD4 antibodies, anti CD35 antibodies, anti CD7 antibodies, anti CD8 antibodies, anti CD11b antibodies, anti CD11c antibodies, anti CD16 antibodies, anti CD19 antibodies, anti CD20 antibodies, anti CD21 antibodies, anti CD22 antibodies, anti CD23 antibodies, anti CD28 antibodies, anti CD34 antibodies, anti CD35 antibodies, anti CD40 antibodies, anti CD45RA antibodies, anti CD45RO antibodies, anti CD52 antibodies, anti CD56 antibodies, anti CD62L antibodies, anti CD68 antibodies, anti CD80 antibodies, anti CD95 antibodies, anti CD117 antibodies, anti CD127 antibodies, anti CD133 antibodies, anti CD137 (4-1BB) antibodies, anti CD163 antibodies, anti Clq antibodies, anti F4 / 80 antibodies, anti IL-4R¢ antibodies, anti Sca-1 antibodies, anti CTLA-4 antibodies, anti GITR antibodies anti GARP antibodies, anti LAP antibodies, anti granzyme B antibodies, anti LFA-1 antibodies, anti transferrin receptor antibodies, and fragments thereof.
[320] In some embodiments, circular RNA is formulated according to a process described in US patent application 15 / 809,680. In some embodiments, the present invention provides a process of encapsulating circular RNA in lipid nanoparticles comprising the steps of forming lipids into pre-formed lipid nanoparticles (i.e., formed in the absence of RNA) and then combining the pre-formed lipid nanoparticles with RNA. In some embodiments, the novel formulation process results in an RNA formulation with higher potency (peptide or protein expression) and higher efficacy (improvement of a biologically relevant endpoint) both in vitro and in vivo with potentially better tolerability as compared to the same RNA formulation prepared without the step of preforming the lipid nanoparticles (e.g., combining the lipids directly with the RNA). In some embodiments, the targeting moiety is a small molecule binder of an ectoenzyme on lymphocytes. Small molecule binders of ectoenzymes include A2A inhibitors CD73 inhibitors, CD39 or adesines receptors A2aR and A2bR. Potential small molecules include AB928.
[321] In some embodiments, transfer vehicles are formulated and / or targeted as described in Shobaki N, Sato Y, Harashima H. Mixing lipids to manipulate the ionization status of lipid nanoparticles for specific tissue targeting. Int J] Nanomedicine. 2018;13:8395-8410. Published 2018 Dec 10. In some embodiments, a transfer vehicle is made up of 3 lipid types. In some embodiments, a transfer vehicle is made up of 4 lipid types. In some embodiments, a transfer vehicle is made up of 5 lipid types. In some embodiments, a transfer vehicle is made up of 6 lipid types.
[322] For certain cationic lipid nanoparticle formulations of RNA, in order to achieve high encapsulation of RNA, the RNA in buffer (e.g., citrate buffer) has to be heated. In those processes or methods, the heating is required to occur before the formulation process (i.e., heating the separate components) as heating post-formulation (post-formation of nanoparticles) does not increase the encapsulation efficiency of the RNA in the lipid nanoparticles. In contrast, in some embodiments of the processes of the present invention, the order of heating of RNA does not appear to affect the RNA encapsulation percentage. In some embodiments, no heating (i.e. maintaining at ambient temperature) of one or more of the solution comprising the pre- formed lipid nanoparticles, the solution comprising the RNA and the mixed solution comprising the lipid nanoparticle encapsulated RNA is required to occur before or after the formulation process.
[323] RNA may be provided in a solution to be mixed with a lipid solution such that the RNA may be encapsulated in lipid nanoparticles. A suitable RNA solution may be any aqueous solution containing RNA to be encapsulated at various concentrations. For example, a suitable RNA solution may contain an RNA at a concentration of or greater than about 0.01 mg / ml, 0.05 mg / ml, 0.06 mg / ml, 0.07 mg / ml, 0.08 mg / ml, 0.09 mg / ml, 0.1 mg / ml, 0.15 mg / ml, 0.2 mg / ml, 0.3 mg / ml, 0.4 mg / ml, 0.5 mg / ml, 0.6 mg / ml, 0.7 mg / ml, 0.8 mg / ml, 0.9 mg / ml, or 1.0 mg / ml. In some embodiments, a suitable RNA solution may contain an RNA at a concentration in a range from about 0.01-1.0 mg / ml, 0.01-0.9 mg / ml, 0.01-0.8 mg / ml, 0.01-0.7 mg / ml, 0.01- 0.6 mg / ml, 0.01-0.5 mg / ml, 0.01-0.4 mg / ml, 0.01-0.3 mg / ml, 0.01-0.2 mg / ml, 0.01-0.1 mg / ml, 0.05-1.0 mg / ml, 0.05-0.9 mg / ml, 0.05-0.8 mg / ml, 0.05-0.7 mg / ml, 0.05-0.6 mg / ml, 0.05-0.5 mg / ml, 0.05-0.4 mg / ml, 0.05-0.3 mg / ml, 0.05-0.2 mg / ml, 0.05-0.1 mg / ml, 0.1-1.0 mg / ml, 0.2- 0.9 mg / ml, 0.3-0.8 mg / ml, 0.4-0.7 mg / ml, or 0.5-0.6 mg / ml.
[324] Typically, a suitable RNA solution may also contain a buffering agent and / or salt. Generally, buffering agents can include HEPES, ammonium sulfate, Tris, sodium bicarbonate, sodium citrate, sodium acetate, potassium phosphate or sodium phosphate. In some embodiments, a suitable concentration of the buffering agent may be in a range from about 0.1 mM to 100 mM, 0.5 mM to 90 mM, 1.0 mM to 80 mM, 2 mM to 70 mM, 3 mM to 60 mM, 4 mM to 50 mM, 5 mM to 40 mM, 6 mM to 30 mM, 7 mM to 20 mM, 8 mM to 15 mM, or 9 to 12 mM.
[325] Exemplary salts can include sodium chloride, magnesium chloride, and potassium chloride. In some embodiments, suitable concentration of salts in an RNA solution may be in a range from about 1 mM to 500 mM, 5 mM to 400 mM, 10 mM to 350 mM, 15 mM to 300 mM, 20 mM to 250 mM, 30 mM to 200 mM, 40 mM to 190 mM, 50 mM to 180 mM, 50 mM to 170 mM, 50 mM to 160 mM, 50 mM to 150 mM, or 50 mM to 100 mM.
[326] In some embodiments, a suitable RNA solution may have a pH in a range from about 3.5-6.5,3.5-6.0, 3.5-5.5, 3.5-5.0, 3.5-4.5, 4.0-5.5, 4.0-5.0, 4.0-4.9, 4.0-4.8, 4.0-4.7, 4.0-4.6, or 4.0-4.5.
[327] Various methods may be used to prepare an RNA solution suitable for the present invention. In some embodiments, RNA may be directly dissolved in a buffer solution described herein. In some embodiments, an RNA solution may be generated by mixing an RNA stock solution with a buffer solution prior to mixing with a lipid solution for encapsulation. In some embodiments, an RNA solution may be generated by mixing an RNA stock solution with a buffer solution immediately before mixing with a lipid solution for encapsulation.
[328] According to the present invention, a lipid solution contains a mixture of lipids suitable to form transfer vehicles for encapsulation of RNA. In some embodiments, a suitable lipid solution is ethanol based. For example, a suitable lipid solution may contain a mixture of desired lipids dissolved in pure ethanol (i.e. 100% ethanol). In another embodiment, a suitable lipid solution is isopropyl alcohol based. In another embodiment, a suitable lipid solution is dimethylsulfoxide-based. In another embodiment, a suitable lipid solution is a mixture of suitable solvents including, but not limited to, ethanol, isopropyl alcohol and dimethylsulfoxide.
[329] A suitable lipid solution may contain a mixture of desired lipids at various concentrations. In some embodiments, a suitable lipid solution may contain a mixture of desired lipids at a total concentration in a range from about 0.1-100 mg / ml, 0.5-90 mg / ml, 1.0- 80 mg / ml, 1.0-70 mg / ml, 1.0-60 mg / ml, 1.0-50 mg / ml, 1.0-40 mg / ml, 1.0-30 mg / ml, 1.0-20 mg / ml, 1.0-15 mg / ml, 1.0-10 mg / ml, 1.0-9 mg / ml, 1.0-8 mg / ml, 1.0-7 mg / ml, 1.0-6 mg / ml, or 1.0-5 mg / ml.
[330] Any desired lipids may be mixed at any ratios suitable for encapsulating RNAs. In some embodiments, a suitable lipid solution contains a mixture of desired lipids including cationic lipids, helper lipids (e.g., non cationic lipids and / or cholesterol lipids) and / or PEGylated lipids. In some embodiments, a suitable lipid solution contains a mixture of desired lipids including one or more cationic lipids, one or more helper lipids (e.g., non cationic lipids and / or cholesterol lipids) and one or more PEGylated lipids. 11. Target cells
[331] In some embodiments, the target cells are deficient in a protein or enzyme of interest. For example, where it is desired to deliver a nucleic acid to a hepatocyte, the hepatocyte represents the target cell. In some embodiments, the compositions of the invention transfect the target cells on a discriminatory basis (i.e., do not transfect non-target cells). The compositions of the invention may also be prepared to preferentially target a variety of target cells, which include, but are not limited to, hepatocytes, epithelial cells, hematopoietic cells, epithelial cells, endothelial cells, lung cells, bone cells, stem cells, mesenchymal cells, neural cells (e.g., meninges, astrocytes, motor neurons, cells of the dorsal root ganglia and anterior horn motor neurons), photoreceptor cells (e.g., rods and cones), retinal pigmented epithelial cells, secretory cells, cardiac cells, adipocytes, vascular smooth muscle cells, cardiomyocytes, skeletal muscle cells, beta cells, pituitary cells, synovial lining cells, ovarian cells, testicular cells, fibroblasts, B cells, T cells, dendritic cells, macrophages, reticulocytes, leukocytes, granulocytes and tumor cells.
[332] The compositions of the invention may be prepared to preferentially distribute to target cells such as in the heart, lungs, kidneys, liver, and spleen. In some embodiments, the compositions of the invention distribute into the cells of the liver to facilitate the delivery and the subsequent expression of the circRNA comprised therein by the cells of the liver (e.g., hepatocytes). The targeted cells may function as a biological “reservoir” or “depot” capable of producing, and systemically excreting a functional protein or enzyme. Accordingly, in one embodiment of the invention the transfer vehicle may target hepatocytes and / or preferentially distribute to the cells of the liver upon delivery. In an embodiment, following transfection of the target hepatocytes, the circRNA loaded in the vehicle are translated and a functional protein product is produced, excreted and systemically distributed. In other embodiments, cells other than hepatocytes (e.g., lung, spleen, heart, ocular, or cells of the central nervous system) can serve as a depot location for protein production.
[333] In one embodiment, the compositions of the invention facilitate a subject's endogenous production of one or more functional proteins and / or enzymes. In an embodiment of the present invention, the transfer vehicles comprise circRNA which encode a deficient protein or enzyme. Upon distribution of such compositions to the target tissues and the subsequent transfection of such target cells, the exogenous circRNA loaded into the transfer vehicle (e.g., a lipid nanoparticle) may be translated in vivo to produce a functional protein or enzyme encoded by the exogenously administered circRNA (e.g., a protein or enzyme in which the subject is deficient). Accordingly, the compositions of the present invention exploit a subject's ability to translate exogenously- or recombinantly-prepared circRNA to produce an endogenously- translated protein or enzyme, and thereby produce (and where applicable excrete) a functional protein or enzyme. The expressed or translated proteins or enzymes may also be characterized by the in vivo inclusion of native post-translational modifications which may often be absent in recombinantly-prepared proteins or enzymes, thereby further reducing the immunogenicity of the translated protein or enzyme.
[334] The administration of circRNA encoding a deficient protein or enzyme avoids the need to deliver the nucleic acids to specific organelles within a target cell. Rather, upon transfection of a target cell and delivery of the nucleic acids to the cytoplasm of the target cell, the circRNA contents of a transfer vehicle may be translated and a functional protein or enzyme expressed.
[335] In some embodiments, a circular RNA comprises one or more miRNA binding sites. In some embodiments, a circular RNA comprises one or more miRNA binding sites recognized by miRNA present in one or more non-target cells or non-target cell types (e.g., Kupffer cells) and not present in one or more target cells or target cell types (e.g., hepatocytes). In some embodiments, a circular RNA comprises one or more miRNA binding sites recognized by miRNA present in an increased concentration in one or more non-target cells or non-target cell types (e.g., Kupffer cells) compared to one or more target cells or target cell types (e.g. hepatocytes). miRNAs are thought to function by pairing with complementary sequences within RNA molecules, resulting in gene silencing. 12. Pharmaceutical compositions
[336] In certain embodiments, provided herein are compositions (e.g. pharmaceutical compositions) comprising a therapeutic agent provided herein. In some embodiments, the therapeutic agent is a circular RNA polynucleotide provided herein. In some embodiments the therapeutic agent is a vector provided herein. In some embodiments, the therapeutic agent is a cell comprising a circular RNA or vector provided herein (e.g., a human cell, such as a human T cell). In certain embodiments, the composition further comprises a pharmaceutically acceptable carrier. In some embodiments, the compositions provided herein comprise a therapeutic agent provided herein in combination with other pharmaceutically active agents or drugs, such as anti-inflammatory drugs or antibodies capable of targeting B cell antigens, e.g., anti-CD20 antibodies, e.g., rituximab, chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. In a preferred embodiment, the pharmaceutical composition comprises a cell provided herein or populations thereof.
[337] With respect to pharmaceutical compositions, the pharmaceutically acceptable carrier can be any of those conventionally used and is limited only by chemico-physical considerations, such as solubility and lack of reactivity with the active agent(s), and by the route of administration. The pharmaceutically acceptable carriers described herein, for example, vehicles, adjuvants, excipients, and diluents, are well-known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one which is chemically inert to the therapeutic agent(s) and one which has no detrimental side effects or toxicity under the conditions of use.
[338] The choice of carrier will be determined in part by the particular therapeutic agent, as well as by the particular method used to administer the therapeutic agent. Accordingly, there are a variety of suitable formulations of the pharmaceutical compositions provided herein.
[339] In certain embodiments, the pharmaceutical composition comprises a preservative. In certain embodiments, suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. Optionally, a mixture of two or more preservatives may be used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition.
[340] In some embodiments, the pharmaceutical composition comprises a buffering agent. In some embodiments, suitable buffering agents may include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. A mixture of two or more buffering agents optionally may be used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition.
[341] In some embodiments, the concentration of therapeutic agent in the pharmaceutical composition can vary, e.g., less than about 1%, or at least about 1%, 2%, 3%, 4%, 5%, 6%, 1%, 8%, 9% 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or about 50% or more by weight, and can be selected primarily by fluid volumes, and viscosities, in accordance with the particular mode of administration selected.
[342] The following formulations for oral, aerosol, parenteral (e.g., subcutaneous, intravenous, intraarterial, intramuscular, intradermal, intraperitoneal, and intrathecal), and topical administration are merely exemplary and are in no way limiting. More than one route can be used to administer the therapeutic agents provided herein, and in certain instances, a particular route can provide a more immediate and more effective response than another route.
[343] Formulations suitable for oral administration can comprise or consist of (a) liquid solutions, such as an effective amount of the therapeutic agent dissolved in diluents, such as water, saline, or orange juice; (b) capsules, sachets, tablets, lozenges, and troches, each containing a predetermined amount of the active ingredient, as solids or granules; (c) powders; (d) suspensions in an appropriate liquid; and (e) suitable emulsions. Liquid formulations may include diluents, such as water and alcohols, for example, ethanol, benzyl alcohol and the polyethylene alcohols, either with or without the addition of a pharmaceutically acceptable surfactant. Capsule forms can be of the ordinary hard or soft shelled gelatin type containing, for example, surfactants, lubricants, and inert fillers, such as lactose, sucrose, calcium phosphate, and corn starch. Tablet forms can include one or more of lactose, sucrose, mannitol, corn starch, potato starch, alginic acid, microcrystalline cellulose, acacia, gelatin, gnar gum, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, calcium stearate, zinc stearate, stearic acid, and other excipients, colorants, diluents, buffering agents, disintegrating agents, moistening agents, preservatives, flavoring agents, and other pharmacologically compatible excipients. Lozenge forms can comprise the therapeutic agent with a flavorant, usually sucrose, acacia or tragacanth. Pastilles can comprise the therapeutic agent with an inert base, such as gelatin and glycerin, or sucrose and acacia, emulsions, gels, and the like containing, in addition to, such excipients as are known in the art.
[344] Formulations suitable for parenteral administration include aqueous and nonaqueous isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and nonaqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. In some embodiments, the therapeutic agents provided herein can be administered in a physiologically acceptable diluent in a pharmaceutical carrier, such as a sterile liquid or mixture of liquids including water, saline, aqueous dextrose and related sugar solutions, an alcohol such as ethanol or hexadecyl alcohol, a glycol such as propylene glycol or polyethylene glycol, dimethylsulfoxide, glycerol, ketals such as 2,2- dimethyl-1,3-dioxolane-4-methanol, ethers, poly(ethyleneglycol) 400, oils, fatty acids, fatty acid esters or glycerides, or acetylated fatty acid glycerides with or without the addition of a pharmaceutically acceptable surfactant such as a soap or a detergent, suspending agent such as pectin, carbomers, methylcellulose, hydroxypropylmethylcellulose, or carboxymethylcellulose, or emulsifying agents and other pharmaceutical adjuvants.
[345] Oils, which can be used in parenteral formulations in some embodiments, include petroleum, animal oils, vegetable oils, or synthetic oils. Specific examples of oils include peanut, soybean, sesame, cottonseed, com, olive, petrolatum, and mineral oil. Suitable fatty acids for use in parenteral formulations include oleic acid, stearic acid, and isostearic acid. Ethyl oleate and isopropyl myristate are examples of suitable fatty acid esters.
[346] Suitable soaps for use in certain embodiments of parenteral formulations include fatty alkali metal, ammonium, and triethanolamine salts, and suitable detergents include (a) cationic detergents such as, for example, dimethyl dialkyl ammonium halides. and alkyl pyridinium halides, (b) anionic detergents such as, for example, alkyl, aryl, and olefin sulfonates, alky, olefin, ether, and monoglyceride sulfates, and sulfosuccinates, (¢) nonionic detergents such as, for example, fatty amine oxides, fatty acid alkanolamides, and polyoxyethylenepolypropylene copolymers, (d) amphoteric detergents such as, for example, alkyl-B-aminopropionates, and 2- alkyl-imidazoline quaternary ammonium salts, and (e) mixtures thereof.
[347] In some embodiments, the parenteral formulations will contain, for example, from about 0.5% to about 25% by weight of the therapeutic agent in solution. Preservatives and buffers may be used. In order to minimize or eliminate irritation at the site of injection, such compositions may contain one or more nonionic surfactants having, for example, a hydrophile- lipophile balance (HLB) of from about 12 to about 17. The quantity of surfactant in such formulations will typically range, for example, from about 5% to about 15% by weight. Suitable surfactants include polyethylene glycol, sorbitan fatty acid esters such as sorbitan monooleate, and high molecular weight adducts of ethylene oxide with a hydrophobic base formed by the condensation of propylene oxide with propylene glycol. The parenteral formulations can be presented in unit-dose or multi-dose sealed containers, such as ampoules or vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of a sterile liquid excipient, for example, water, for injections, immediately prior to use. Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
[348] In certain embodiments, injectable formulations are provided herein. The requirements for effective pharmaceutical carriers for injectable compositions are well-known to those of ordinary skill in the art (see, e.g., Pharmaceutics and Pharmacy Practice, J.B. Lippincott Company, Philadelphia, PA, Banker and Chalmers, eds., pages 238-250 (1982), and ASHP Handbook on Injectable Drugs, Toissel, 4th ed, pages 622-630 (1986)).
[349] In some embodiments, topical formulations are provided herein. Topical formulations, including those that are useful for transdermal drug release, are suitable in the context of certain embodiments provided herein for application to skin. In some embodiments, the therapeutic agent alone or in combination with other suitable components, can be made into aerosol formulations to be administered via inhalation. These aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like. They also may be formulated as pharmaceuticals for non-pressured preparations, such as in a nebulizer or an atomizer. Such spray formulations also may be used to spray mucosa.
[350] In certain embodiments, the therapeutic agents provided herein can be formulated as inclusion complexes, such as cyclodextrin inclusion complexes, or liposomes. Liposomes can serve to target the therapeutic agents to a particular tissue. Liposomes also can be used to increase the half-life of the therapeutic agents. Many methods are available for preparing liposomes, as described in, for example, Szoka er al., Ann. Rev. Biophys. Bioeng., 9, 467 (1980) and U.S. Patents 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
[351] In some embodiments, the therapeutic agents provided herein are formulated in time- released, delayed release, or sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Such systems can avoid repeated administrations of the therapeutic agent, thereby increasing convenience to the subject and the physician, and may be particularly suitable for certain composition embodiments provided herein. In one embodiment, the compositions of the invention are formulated such that they are suitable for extended-release of the circRNA contained therein. Such extended-release compositions may be conveniently administered to a subject at extended dosing intervals. For example, in one embodiment, the compositions of the present invention are administered to a subject twice a day, daily or every other day. In an embodiment, the compositions of the present invention are administered to a subject twice a week, once a week, every ten days, every two weeks, every three weeks, every four weeks, once a month, every six weeks, every eight weeks, every three months, every four months, every six months, every eight months, every nine months or annually.
[352] In some embodiments, a protein encoded by an inventive polynucleotide is produced by a target cell for sustained amounts of time. For example, the protein may be produced for more than one hour, more than four, more than six, more than 12, more than 24, more than 48 hours, or more than 72 hours after administration. In some embodiments the polypeptide is expressed at a peak level about six hours after administration. In some embodiments the expression of the polypeptide is sustained at least at a therapeutic level. In some embodiments the polypeptide is expressed at least at a therapeutic level for more than one, more than four, more than six, more than 12, more than 24, more than 48, or more than 72 hours after administration. In some embodiments, the polypeptide is detectable at a therapeutic level in patient serum or tissue (e.g., liver or lung). In some embodiments, the level of detectable polypeptide is from continuous expression from the circRNA composition over periods of time of more than one, more than four, more than six, more than 12, more than 24, more than 48, or more than 72 hours after administration.
[353] In certain embodiments, a protein encoded by an inventive polynucleotide is produced at levels above normal physiological levels. The level of protein may be increased as compared to a control. In some embodiments, the control is the baseline physiological level of the polypeptide in a normal individual or in a population of normal individuals. In other embodiments, the control is the baseline physiological level of the polypeptide in an individual having a deficiency in the relevant protein or polypeptide or in a population of individuals having a deficiency in the relevant protein or polypeptide. In some embodiments, the control can be the normal level of the relevant protein or polypeptide in the individual to whom the composition is administered. In other embodiments, the control is the expression level of the polypeptide upon other therapeutic intervention, e.g., upon direct injection of the corresponding polypeptide, at one or more comparable time points.
[354] In certain embodiments, the levels of a protein encoded by an inventive polynucleotide are detectable at 3 days, 4 days, 5 days, or 1 week or more after administration. Increased levels of secreted protein may be observed in the serum and / or in a tissue (e.g., liver or lung).
[355] In some embodiments, the method yields a sustained circulation half-life of a protein encoded by an inventive polynucleotide. For example, the protein may be detected for hours or days longer than the half-life observed via subcutaneous injection of the protein or mRNA encoding the protein. In some embodiments, the half-life of the protein is 1 day, 2 days, 3 days, 4 days, 5 days, or 1 week or more.
[356] Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer based systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Patent 5,075,109. Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters, and fatty acids or neutral fats such as mono-di-and tri-glycerides; hydrogel release systems; sylastic systems; peptide based systems: wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which the active composition is contained in a form within a matrix such as those described in U.S. Patents 4,452,775, 4,667,014, 4,748,034, and 5,239,660 and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Patents 3,832,253 and 3,854,480. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
[357] In some embodiments, the therapeutic agent can be conjugated either directly or indirectly through a linking moiety to a targeting moiety. Methods for conjugating therapeutic agents to targeting moieties is known in the art. See, for instance, Wadwa et al, J, Drug Targeting 3:111 (1995) and U.S. Patent 5,087,616.
[358] In some embodiments, the therapeutic agents provided herein are formulated into a depot form, such that the manner in which the therapeutic agent is released into the body to which it is administered is controlled with respect to time and location within the body (see, for example, U.S. Patent 4,450,150). Depot forms of therapeutic agents can be, for example, an implantable composition comprising the therapeutic agents and a porous or non-porous material, such as a polymer, wherein the therapeutic agents are encapsulated by or diffused throughout the material and / or degradation of the non-porous material. The depot is then implanted into the desired location within the body and the therapeutic agents are released from the implant at a predetermined rate. 13. Therapeutic methods
[359] In certain aspects, provided herein is a method of treating and / or preventing a condition, e.g., cancer, comprising introducing pharmaceutical composition provided herein into a subject in need thereof (e.g., a subject with cancer). In some embodiments, the pharmaceutical composition comprises a circular RNA polynucleotide provided herein. In some embodiments, the pharmaceutical composition comprises a vector provided herein. In some embodiments, the pharmaceutical composition comprises a cell (e.g., human cell, such as a human T cell) comprising a polynucleotide provided herein (e.g., a circular RNA or a vector provided herein).
[360] Thus, in certain embodiments, provided herein are methods of treating and / or preventing a disease in a subject (e.g., mammalian subject, such as a human subject). Without being bound to a particular theory or mechanism, the CARs and TCR complex proteins have biological activity, e.g., ability to recognize an antigen, e.g., CD19, such that the CAR or TCR, when expressed by a cell, is able to mediate an immune response against the cell expressing the antigen, e.g., CD19, for which the CAR or TCR is specific. In this regard, an embodiment provided herein provides a method of treating or preventing cancer in a mammal, comprising administering to the mammal the therapeutic agents thereof, and / or the pharmaceutical compositions provided herein in an amount effective to treat or prevent cancer in the mammal.
[361] In certain embodiments, the therapeutic agents provided herein are coadministered with one or more additional therapeutic agents (e.g., in the same pharmaceutical composition or in separate pharmaceutical compositions). In some embodiments, the therapeutic agent provided herein can be administered first and the one or more additional therapeutic agents can be administered second, or vice versa. Alternatively, the therapeutic agent provided herein and the one or more additional therapeutic agents can be administered simultaneously. In some embodiments, the additional therapeutic agent that can be co-administered with the therapeutic agents provided herein is a T cell active cytokine, such as IL-2, IL-7, IL-15 and / or IL-21.
[362] In certain embodiments, the therapeutic agent is a cell or population of cells comprising a circular RNA or a vector provided herein that expresses a CAR or TCR complex protein encoded by the circular RNA or vector. In some embodiments, the administered cells are allogeneic to the subject being treated. In some embodiments, the administered cells are autologous to the subject being treated.
[363] In certain embodiments, the methods further comprise lymphodepleting the subject prior to administering the therapeutic agent. Examples of lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc.
[364] In some embodiments, the subject is a mammal. In some embodiments, the mammal referred to herein can be any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, or mammals of the order Logomorpha, such as rabbits. The mammals may be from the order Carnivora, including Felines (cats) and Canines (dogs). The mammals may be from the order Artiodactyla, including Bovines (cows) and Swines (pigs), or of the order Perssodactyla, including Equines (horses). The mammals may be of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). Preferably, the mammal is a human. 14. Sequences Table 3 - Exemplary IRES sequences. 2 3 Sequence ceeeccteteecteeceecctaacgttactggecgaageegettggaataaggeeggt gtecgtttgtetatatgttattttccaccatattgeegtettttggeaatgtgagggeeegg aaacctggecctgtettettgacgageattectaggggtetttcecctetcgecaaagg aatgcaaggtetgttgaatgtegtgaaggaageagttectetggaagettettgaagac aaacaacgtetgtagegaccetttgeaggeageggaaceeeeeacctggegacagg tgectetgeggecaaaagecacgtatataagatacacetgcaaaggeggeacaace ccagtgecacgttgtgagttggatagttgtggaaagagtcaaatggetetectcaage gtattcaacaaggggetgaaggatgeccagaaggtaccccattgtatgggatetgate tggggeeteggtgeacatgetttacatgtgtttagtcgaggttaaaaaacgtetaggee ccecgaaccacggggacgtggttttcetttgaaaaacacgatgataatatggecacaa [1 EMCV-A | cc cteceecteccececcttactatactggecgaageeacttggaataaggeegggtge gittgtetacatgetattttctaccgeattacegtettatggtaatgtgagggtecagaace tgaccetgtettettgacgaacactectaggggtetttceectetcgacaaaggagtgta aggtetgttgaatgtegtgaaggaageagttcctetggaagettcttaaagacaaacaa cgtetgtagegaceetttgeaggeageggaaceeeecacetggtgacaggtgecetet geggeeaaaagecacgtgtataagatacacctgeaaaggeggeacaaccecagtge cacgttgtgagttggatagttgtggaaagagtcaaatggctctcetcaagegtattcaa caaggggctgaaggatgeccagaaggtaccecattgtatgggatetgatetggggee teggtgeacgtgetttacacgtgtigagtcgaggtgaaaaaacgtetaggeeeeeega 2 EMCV-B accacggggacgtggttttcetttgaaaaccacgattacaat ttgccagtetgetegatatcgeaggetgggteegtgactacccacteeeectttcaacg tgaaggctacgatagtgecagggegggtactgecgtaagtgecaccecaaacaaca acaacaaaacaaactcceccteeecccecttactatactggecgaagecacttggaat aaggecggtgtgegtttgtctacatgetatttictaccgeattacegtettatggtaatgtg agggtccagaacctgaccetgtettcttgacgaacactcctaggggtettteecctete gacaaaggagtgtaaggtctgttgaatgtegtgaaggaageagttcctctggaagett cttaaagacaaacaacgtctgtagegaccetttgecaggeageggaaceeeceacctg gtgacaggtgeetetgeggecaaaagecacgtgtataagatacacctgeaaaggeg geacaaccccagtgeeacgttgtgagttggatagttgtggaaagagtcaaatggetet cctcaagegtattcaacaaggggctgaaggatgeccagaaggtaccecattgtatgg gatctgatetggggecteggtgeacgtgetitacacgtgitgagtcgaggtgaaaaaa ls EMCV-Bf cgtctaggececccgaaccacggggacgtgettttectttgaaaaccacgattacaat l4 EMCV-Cf tgaaggctacgatagtgccaggpcgppatactgecgtaagtgccaceccaaaacaac l4 EMCV EC9 Human Cosavirus E / D Human Cosavirus IMY Salivirus SH1 Salivirus FHB Salivirus NG-J1 Human s1 Crohivirus B ” Ye-3 Rosavirns M7 Echovirus El4 Enterovirus c i Enterovirus D Yi Enterovirus J GBV-C K1737 GBV-C Towa 3 Bakunsa Virus Tremovirus A Swine Pasivirus 1 Border Disease Virus BVDV2 CSFV- PK15C SF573 S Hubei Virus CRPV Salivirus BNS5 Salivirus BN2 Salivirus 02394 Salivirus GUT Salivirus CH Salivirus SZ1 Salivirus FHB CVB3 CVB1 CVB5 CVA3 ttaaaacagectgtgggttgtacceacceacagggeecactgggegetageactetg gtactacggtacctttgtgtgectgttttaageeectaceecceactegtaacttagaag getteteacactcgatcaatagtaggtgtggeacgecagtcacacegtgatcaageac ttetgttacceeggtetgagtaccaataagetgetaacgeggetgaaggggaaaacga tegttatceggetaactacttcgagaaacceagtaccaccatgaacgttgeagggtgtt tegeteggeacaaccecagtgtagatcaggtegatgagteaccgtatteeecacggg cgacegtggeggtggetgegttggeggectgeccatggggtgaceeatgggacget ctaatactgacatggtgcgaagagtctattgagetagttagtagtecteeggeeeetga atgeggctaatcetaactgeggageacatacecttaatccaaagggeagtgtgtegta acgggcaactctgeageggaacegactactttgggtgteegtgtttecttttattettaca ttggetgettatggtgacaattgaaaagttgitaccatatagetattggattggecateeg gtgacaaatagagctattgtatatetititgttggttacgtaccecttaattacaaagtggtt 71 CVAI2 tcaactttgaaatacatcctaacactaaattgtagaaa ttaaaacagectgtgggttgeacecacccacagggeecacagggegetageactetg gtatcacggtacetitgtgegectgttttattaccecttceccaattgaaaattagaagea atgcacaccgatcaacageaggegtggegeaccagteacgtetcgatcaageacttc tgttteceeggaccgagtatcaatagactgetcacgeggttgaaggagaaagtgttegt tatccggetaaccacttcgagaaacccagtaacaccatgaaagttgeagggtgttteg cteageacttceccagtgtagatcaggtegatgagteacegegticeccacgggega cegtggeggtggetgegttggeggectgectatgggttaacecataggacgetetaat acagacatggtgcgaagagtttattgagetggttagtatcectecggeeectgaatgeg getaatectaactgeggageacgtgectceaatccagggggttgeatgtegtaacgg graactetgeageggaacegactactitgggtgteegtgtttectttattcttatactgge tgettatggtgacaatcgaggaattgttaccatatagetattggattggecateeggtgte taacagagcegattatatacctctttgttggatttatgeagetcaataccaccaactttaaca 72 EV24 cattgaaatatatcttaaagttaaacacagcaaa
[365] In some embodiments, an IRES of the invention is an IRES having a sequence as listed in Table 3 (SEQ ID NO: 1-72). In some embodiments, an IRES is a Salivirus IRES. In some embodiments, an IRES is a Salivirus SZ1 IRES. Table 4. - Anabaena permutation site 5° intron fragment sequences. SEQ ID NO. | Permutation | Sequence site GAAGAAATTCTTTAAGTGGATGCTCTCAAACTCAGG GAAACCTAAATCTAGTTATAGACAAGGCAATCCTG AGCCAAGCCGAAGTAGTAATTAGTAAGTTAACAAT AGATGACTTACAACTAATCGGAAGGTGCAGAGACT | CGACGGGAGCTACCCTAACGTCAAGACGAGGGTAA AGAGAGAGTCCAATTCTCAAAGCCAATAGGCAGTA i L2-1 GCGAAAGCTGCAAGAGAATGAAAATCCGT AAGAAATTCTTTAAGTGGATGCTCTCAAACTCAGGG AAACCTAAATCTAGTTATAGACAAGGCAATCCTGA GCCAAGCCGAAGTAGTAATTAGTAAGTTAACAATA GATGACTTACAACTAATCGGAAGGTGCAGAGACTC 74 12-2 GACGGGAGCTACCCTAACGTCAAGACGAGGGTAAA Table 4. Typically, a construct containing a 5° intron fragment listed in Table 4 will contain a corresponding 3’ intron fragment as listed in Table 5 (e.g., both representing fragments with the L.9a-8 permutation site). Table 5 - Anabaena permutation site 3” intron fragment sequences. L140 L9a-7 CTTTAAGTGGATGCTCTCAAACTCAGGGAAACCTAA ATCTAGTTATAGACAAGGCAATCCTGAGCCAAGCC GAAGTAGTAATTAGTAAGTTAACAATAGATGACTTA CAACTAATCGGAAGGTGCAGAGACTCGACGGGAGC TACCCTAACGTCAAGACGAGGGTAAAGAGAGAGTC CAATTCTCAAAGCCAATAGGCAGTAGCGAAAGCTG CA ACGGACTTAAATAATTGAGCCTTAAAGAAGAAATT CTTTAAGTGGATGCTCTCAAACTCAGGGAAACCTAA ATCTAGTTATAGACAAGGCAATCCTGAGCCAAGCC GAAGTAGTAATTAGTAAGTTAACAATAGATGACTTA CAACTAATCGGAAGGTGCAGAGACTCGACGGGAGC TACCCTAACGTCAAGACGAGGGTAAAGAGAGAGTC CAATTCTCAAAGCCAATAGGCAGTAGCGAAAGCTG 147 19-9 CAA ACGGACTTAAATAATTGAGCCTTAAAGAAGAAATT CTTTAAGTGGATGCTCTCAAACTCAGGGAAACCTAA ATCTAGTTATAGACAAGGCAATCCTGAGCCAAGCC GAAGTAGTAATTAGTAAGTTAACAATAGATGACTTA CAACTAATCGGAAGGTGCAGAGACTCGACGGGAGC TACCCTAACGTCAAGACGAGGGTAAAGAGAGAGTC 148 L9a-6 CAATTCTCAAAGCCAATAG ACGGACTTAAATAATTGAGCCTTAAAGAAGAAATT CTTTAAGTGGATGCTCTCAAACTCAGGGAAACCTAA ATCTAGTTATAGACAAGGCAATCCTGAGCCAAGCC GAAGTAGTAATTAGTAAGTTAACAATAGATGACTTA CAACTAATCGGAAGGTGCAGAGACTCGACGGGAGC TACCCTAACGTCAAGACGAGGGTAAAGAGAGAGTC 149 L9a-7 CAATTCTCAAAGCCAATAGGC ACGGACTTAAATAATTGAGCCTTAAAGAAGAAATT CTTTAAGTGGATGCTCTCAAACTCAGGGAAACCTAA ATCTAGTTATAGACAAGGCAATCCTGAGCCAAGCC GAAGTAGTAATTAGTAAGTTAACAATAGATGACTTA CAACTAATCGGAAGGTGCAGAGACTCGACGGGAGC TACCCTAACGTCAAGACGAGGGTAAAGAGAGAGTC 150 1.9a-8 CAATTCTCAAAGCCAATAGGCA
[367] In some embodiments, a 3’ intron fragment is a fragment having a sequence listed in Table 5. In some embodiments, a construct containing a 3” intron fragment listed in Table 5 will contain a corresponding 5’ intron fragment as listed in Table 4 (e.g., both representing fragments with the L9a-8 permutation site). Table 6 - Non-anabaena permutation site 5’ intron fragment sequences. Sequence tgegeegatgaaggtgtagagactagacggeacceacctaaggeaaacgetatggt 151 Azopl gaaggcatagtccagggagtegcgaaagtcacacaaaccggaatccgt 152 Azop2 Luss L156 [157 Liss [159 L160 LSUp! Lu61 Phipl L162 L163 L164 L165 gagactagacggeacccacctaaggeaaacgetatggtgaaggeatagtecaggga gtggcgaaagtcacacaaaccggaatcegt acggeacccacctaaggeaaacgetatggtgaaggeatagtccagggagtggega 153 Azop3 aagtcacacaaaccggaatcegt acgetatggtgaaggeatagtccagggagtggegaaagtcacacaaaccggaatee 154 Azop4 gt attaaagttatagaattatcagagaatgatatagtccaagecttatggtaacatgaggge 155 S795p1 acttgaccctggtag aagatgtaggcaatcctgagetaagetettagtaataagagaaagtgeaacgactatte cgataggaagtagggtcaagtgactcgaaatggggattaccetictagggtagtgata tagtctgaacatatatggaaacatatagaaggataggagtaacgaacctattcgtaaca 156 Twortpl taattgaacttttagttat taataagagaaagtgcaacgactattccgataggaagtagggtcaagtgactcgaaat ggggattaccettctagggtagtgatatagtctgaacatatatggaaacatatagaagg 157 Twortp2 ataggagtaacgaacctattcgtaacataattgaacttttagttat taggaagtagggtcaagtgactcgaaatggggattaceettctagggtagtgatatagt ctgaacatatatggaaacatatagaaggataggagtaacgaacctattcgtaacataat 158 Twortp3 tgaacttttagttat ctagggtagtgatatagtctgaacatatatggaaacatatagaaggataggagtaacg 159 Twortp4 aacctattcgtaacataattgaacttttagttat agttaataaagatgatgaaatagtctgaaccattttgagaaaagtggaaataaaagaaa 160 LSUpl atcttttatgataacataaattgaacaggctaa caaagactgatgatatagtccgacactcctagtaataggagaatacagaaaggatgaa 161 Phipl atee agtcgagggtaaagggagagtceaatictcaaagectattggeagtagegaaagetg 162 Nostoc cggpagaatgaaaatecgt agccgagggtaaagggagagtccaattctcaaagecaataggeagtagegaaaget 163 Nostoc gegggagaatgaaaatcegt agccgagggtaaagggagagtecaattctcaaagecgaaggttattaaaacetggea 164 Nodularia gcagtgaaagctgcgggagaatgaaaatcegt agctgagggtaaagagagagtccaattctcaaagecageagatggeagtagegaaa 165 Pleurocapsa | getgegggagaatgaaaatecgt agccgagggtaaagagagagtccaattctcaaagecaattggtagtagegaaageta 166 Planktothrix | cgggagaatgaaaatcegt
[368] In some embodiments, a 5° intron fragment is a fragment having a sequence listed in Table 6. A construct containing a 5° intron fragment listed in Table 6 will contain a corresponding 3’ intron fragment as listed in Table 7 (e.g., both representing fragments with the Azopl intron). Table 7 - Non-anabaena permutation site 3” intron fragment sequences. SEQ ID NO. | Intron 167 Azopl 168 Azop2 Sequence geggacteatatttegatgtgecttgegeegggaaaccacgeaagggatggtgtcaa attcggegaaacctaagegeecgeeegggegtatggeaacgeegagecaagettcg gegee Azop3 Azop4 LSUpl Phipl Table 7. A construct containing a 3” intron fragment listed in Table 7 will contain the corresponding 5’ intron fragment as listed in Table 6 (e.g., both representing fragments with the Azopl intron). Table 8 - Spacer and Anabaena 5’ intron fragment sequences. T25 ] IMM T25 ] 3MM T25 ] SMM T25 ] SMM T25 L3 OffTarget 10 T25 L3 OffTarget 20 T25 L3 OffTarget 30 T25 L 125-10 T25 L 125-20 T25 L 150-10 T25 L 150-20 T25 L 180-20 T25 L3 150-20 T25 L3 180-20 [240 T25 L3 125-10 [241 T25 L3 125-20 [242 [243 T25 L3 150-10 [26a T25 L3 150-20 ctgaaattatacttatactcagtatatgacaaacaaaccacAAGACGAGGGT T25 L30b | AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG 240 10-0 TAGCGAAAGCTGCAAGAGAATGAAAATCCGT ctgaaattatacttatactcagtatatgacaaacaaaccacCAAGACGAGGGT AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG T25 L30b | TAGCGAAAGCTGCAAGAGAATGAAAATCCGTgattaaa 241 125-10 ca ctgaaattatacttatactcagtatatgacaaacaaaccacCAAGACGAGGGT AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG T25 L30b | TAGCGAAAGCTGCAAGAGAATGAAAATCCGTgattcac 242 125-20 aatataaattac ctgaaattatacttatactcagtatatgacaaacaaaccacCAAGACGAGGGT AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG T25 L30b | TAGCGAAAGCTGCAAGAGAATGAAAATCCGTggatcat 243 150-10 age ctgaaattatacttatactcagtatatgacaaacaaaccacAAGACGAGGGT AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG T25 L30b | TAGCGAAAGCTGCAAGAGAATGAAAATCCGTggatcge 244 150-20 agcataatatec ctgaaattatacttatactcagtatatgacaaacaaaccacAAGACGAGGGT AAAGAGAGAGTCCAATTCTCAAAGCCAATAGGCAG T25 L30b | TAGCGAAAGCTGCAAGAGAATGAAAATCCGTggctege 245 180-20 agcgegectace
[370] In some embodiments, a spacer and 5° intron fragment are spacers and fragments having sequences as listed in Table 8. Table 9 - Spacer and Anabaena 3’ intron fragment sequences. [247 l2e8 Sequence getgcgagccACGGACTTAAATAATTGAGCCTTAAAGAA GAAATTCTTTAAGTGGATGCTCTCAAACTCAGGGAA ACCTAAATCTAGTTATAGACAAGGCAATCCTGAGCC AAGCCGAAGTAGTAATTAGTAAGTTAACAAcacaaaca 246 T25L10 caacttatatact getgegagecACGGACTTAAATAATTGAGCCTTAAAGAA GAAATTCTTTAAGTGGATGCTCTCAAACTCAGGGAA ACCTAAATCTAGTTATAGACAAGGCAATCCTGAGCC AAGCCGAAGTAGTAATTAGTAAGTTAACAAcacaaaca 247 T25 L20 caagagtataagtataatttcag getgegagecACGGACTTAAATAATTGAGCCTTAAAGAA GAAATTCTTTAAGTGGATGCTCTCAAACTCAGGGAA T25 L30 | ACCTAAATCTAGTTATAGACAAGGCAATCCTGAGCC (180-10) AAGCCGAAGTAGTAATTAGTAAGTTAACAAcacaaaca 248 Control caagtcatatactgagtataagtataatttcag getgegagccACGGACTTAAATAATTGAGCCTTAAAGAA GAAATTCTTTAAGTGGATGCTCTCAAACTCAGGGAA ACCTAAATCTAGTTATAGACAAGGCAATCCTGAGCC 249 T25 L40 AAGCCGAAGTAGTAATTAGTAAGTTAACAAcacaaaca 249 T25 ] IMM T25 ] 3MM T25 ] SMM T25 ] SMM T25 L3i OffTarget 10 T25 L3 OffTarget 20 T25 L3 OffTarget 30 T23 L 125-10 T25 L 125-20 T25 L 150-10 TOLO T25 L3 125-20 T25 L3 150-10 T25 L3 150-20 T25 L3 180-20 T25 | 10-0 T25 L3 125-10 [30s [306 T25 L3 150-10 [207 T25 L3 150-20 ACTTACAACTAATCGGAAGGTGCAGAGACTCGACG GGAGCTACCCTAACGTCcacaaacacaagtcatatactgagtataagt ataatttca, cgtaatttatattgtgaatt ACGGACTTAAATAATTGAGCCTTAA AGAAGAAATTCTTTAAGTGGATGCTCTCAAACTCAG GGAAACCTAAATCTAGTTATAGACAAGGCAATCCT GAGCCAAGCCGAAGTAGTAATTAGTAAGTTAACAA TAGATGACTTACAACTAATCGGAAGGTGCAGAGAC T25 L30b | TCGACGGGAGCTACCCTAACGTC Ccacaaacacaagtcatatact 305 125-20 agtataagtataatttcas getatgatcc ACGGACTTAAATAATTGAGCCTTAAAGAA GAAATTCTTTAAGTGGATGCTCTCAAACTCAGGGAA ACCTAAATCTAGTTATAGACAAGGCAATCCTGAGCC AAGCCGAAGTAGTAATTAGTAAGTTAACAATAGAT GACTTACAACTAATCGGAAGGTGCAGAGACTCGAC T25 L30b | GGGAGCTACCCTAACGTC Ccacaaacacaagtcatatactgagtataa 306 150-10 tataatttca; cggatattatgctgegatcc ACGGACTTAAATAATTGAGCCTTA AAGAAGAAATTCTTTAAGTGGATGCTCTCAAACTCA GGGAAACCTAAATCTAGTTATAGACAAGGCAATCC TGAGCCAAGCCGAAGTAGTAATTAGTAAGTTAACA ATAGATGACTTACAACTAATCGGAAGGTGCAGAGA T25 L30b | CTCGACGGGAGCTACCCTAACGTC Ccacaaacacaagtcatata | 307 150-20 ctgagtataagtataatttca, cgetaggcgcgetgcgagccACGGACTTAAATAATTGAGCCTT AAAGAAGAAATTCTTTAAGTGGATGCTCTCAAACTC AGGGAAACCTAAATCTAGTTATAGACAAGGCAATC CTGAGCCAAGCCGAAGTAGTAATTAGTAAGTTAAC AATAGATGACTTACAACTAATCGGAAGGTGCAGAG T25 L30b | ACTCGACGGGAGCTACCCTAACGTCcacaaacacaagtcatat 308 180-20 actgagtataagtataatttca
[371] In some embodiments, a spacer and 3’ intron fragment is a spacer and intron fragment having sequences as listed in Table 9. Table 10 - CAR sequences. SEQID NO. | CAR Sequence ATGCTGCTGCTGGTCACATCTCTGCTGCTGTGCGAG CTGCCCCATCCTGCCTTTCTGCTGATCCCCGACATCC AGATGACCCAGACCACAAGCAGCCTGTCTGCCAGC CTGGGCGATAGAGTGACCATCAGCTGTAGAGCCAG | CCAGGACATCAGCAAGTACCTGAACTGGTATCAGC AAAAGCCCGACGGCACCGTGAAGCTGCTGATCTAC CACACCAGCAGACTGCACAGCGGCGTGCCAAGCAG ATTTTCTGGCAGCGGCTCTGGCACCGACTACAGCCT GACAATCAGCAACCTGGAACAAGAGGATATCGCTA CCTACTTCTGCCAGCAAGGCAACACCCTGCCTTACA CCTTTGGCGGAGGCACCAAGCTGGAAATCACCGGC TCTACAAGCGGCAGCGGCAAACCTGGATCTGGCGA GGGATCTACCAAGGGCGAAGTGAAACTGCAAGAGT CTGGCCCTGGACTGGTGGCCCCATCTCAGTCTCTGA GCGTGACCTGTACAGTCAGCGGAGTGTCCCTGCCTG ATTACGGCGTGTCCTGGATCAGACAGCCTCCTCGGA AAGGCCTGGAATGGCTGGGAGTGATCTGGGGCAGC GAGACAACCTACTACAACAGCGCCCTGAAGTCCCG GCTGACCATCATCAAGGACAACTCCAAGAGCCAGG TGTTCCTGAAGATGAACAGCCTGCAGACCGACGAC ACCGCCATCTACTATTGCGCCAAGCACTACTACTAC | GGCGGCAGCTACGCCATGGATTATTGGGGCCAGGG CACCAGCGTGACCGTTTCTTCTGCCGCCGCTATCGA AGTGATGTACCCTCCTCCTTACCTGGACAACGAGAA GTCCAACGGCACCATCATCCACGTGAAGGGCAAGC ACCTGTGTCCTTCTCCACTGTTCCCCGGACCTAGCA AGCCTTTCTGGGTGCTCGTTGTTGTTGGCGGCGTGC TGGCCTGTTACAGCCTGCTGGTTACCGTGGCCTTCA TCATCTTTTGGGTCAAGAGAGGCCGGAAGAAACTTC | TTTATATATTCAAGCAGCCCTTTATGCGACCCGTTC FMC63- - | AGACTACCCAAGAGGAAGATGGATGCAGTTGCCGC 1BB TTTCCAGAAGAGGAGGAGGGCGGGTGCGAACTGtaa ATGCTGCTGCTGGTCACATCTCTGCTGCTGTGCGAG CTGCCCCATCCTGCCTTTCTGCTGATCCCCGACATCC AGATGACCCAGACCACAAGCAGCCTGTCTGCCAGC CTGGGCGATAGAGTGACCATCAGCTGTAGAGCCAG | CCAGGACATCAGCAAGTACCTGAACTGGTATCAGC AAAAGCCCGACGGCACCGTGAAGCTGCTGATCTAC CACACCAGCAGACTGCACAGCGGCGTGCCAAGCAG ATTTTCTGGCAGCGGCTCTGGCACCGACTACAGCCT GACAATCAGCAACCTGGAACAAGAGGATATCGCTA CCTACTTCTGCCAGCAAGGCAACACCCTGCCTTACA CCTTTGGCGGAGGCACCAAGCTGGAAATCACCGGC TCTACAAGCGGCAGCGGCAAACCTGGATCTGGCGA GGGATCTACCAAGGGCGAAGTGAAACTGCAAGAGT CTGGCCCTGGACTGGTGGCCCCATCTCAGTCTCTGA GCGTGACCTGTACAGTCAGCGGAGTGTCCCTGCCTG ATTACGGCGTGTCCTGGATCAGACAGCCTCCTCGGA AAGGCCTGGAATGGCTGGGAGTGATCTGGGGCAGC GAGACAACCTACTACAACAGCGCCCTGAAGTCCCG GCTGACCATCATCAAGGACAACTCCAAGAGCCAGG TGTTCCTGAAGATGAACAGCCTGCAGACCGACGAC ACCGCCATCTACTATTGCGCCAAGCACTACTACTAC | GGCGGCAGCTACGCCATGGATTATTGGGGCCAGGG CACCAGCGTGACCGTTTCTTCTGCCGCCGCTATCGA AGTGATGTACCCTCCTCCTTACCTGGACAACGAGAA GTCCAACGGCACCATCATCCACGTGAAGGGCAAGC ACCTGTGTCCTTCTCCACTGTTCCCCGGACCTAGCA AGCCTTTCTGGGTGCTCGTTGTTGTTGGCGGCGTGC TGGCCTGTTACAGCCTGCTGGTTACCGTGGCCTTCA TCATCTTTTGGGTCCGAAGCAAGCGGAGCCGGCTGC TGCACTCCGACTACATGAACATGACCCCTAGACGGC FMC63- CCGGACCAACCAGAAAGCACTACCAGCCTTACGCT CD28 CCTCCTAGAGACTTCGCCGCCTACCGGTCCtaa ATGCTGCTGCTGGTCACATCTCTGCTGCTGTGCGAG CTGCCCCATCCTGCCTTTCTGCTGATCCCCGACATCC AGATGACCCAGACCACAAGCAGCCTGTCTGCCAGC CTGGGCGATAGAGTGACCATCAGCTGTAGAGCCAG | CCAGGACATCAGCAAGTACCTGAACTGGTATCAGC AAAAGCCCGACGGCACCGTGAAGCTGCTGATCTAC CACACCAGCAGACTGCACAGCGGCGTGCCAAGCAG ATTTTCTGGCAGCGGCTCTGGCACCGACTACAGCCT GACAATCAGCAACCTGGAACAAGAGGATATCGCTA CCTACTTCTGCCAGCAAGGCAACACCCTGCCTTACA CCTTTGGCGGAGGCACCAAGCTGGAAATCACCGGC TCTACAAGCGGCAGCGGCAAACCTGGATCTGGCGA GGGATCTACCAAGGGCGAAGTGAAACTGCAAGAGT CTGGCCCTGGACTGGTGGCCCCATCTCAGTCTCTGA GCGTGACCTGTACAGTCAGCGGAGTGTCCCTGCCTG ATTACGGCGTGTCCTGGATCAGACAGCCTCCTCGGA AAGGCCTGGAATGGCTGGGAGTGATCTGGGGCAGC GAGACAACCTACTACAACAGCGCCCTGAAGTCCCG GCTGACCATCATCAAGGACAACTCCAAGAGCCAGG TGTTCCTGAAGATGAACAGCCTGCAGACCGACGAC ACCGCCATCTACTATTGCGCCAAGCACTACTACTAC | GGCGGCAGCTACGCCATGGATTATTGGGGCCAGGG CACCAGCGTGACCGTTTCTTCTGCCGCCGCTATCGA AGTGATGTACCCTCCTCCTTACCTGGACAACGAGAA GTCCAACGGCACCATCATCCACGTGAAGGGCAAGC ACCTGTGTCCTTCTCCACTGTTCCCCGGACCTAGCA AGCCTTTCTGGGTGCTCGTTGTTGTTGGCGGCGTGC TGGCCTGTTACAGCCTGCTGGTTACCGTGGCCTTCA TCATCTTTTGGGTCCGAAGCAAGCGGAGCCGGCTGC TGCACTCCGACTACATGAACATGACCCCTAGACGGC CCGGACCAACCAGAAAGCACTACCAGCCTTACGCT CCTCCTAGAGACTTCGCCGCCTACCGGTCCAGAGTG AAGTTCAGCAGATCCGCCGATGCTCCCGCCTATCAG CAGGGCCAAAACCAGCTGTACAACGAGCTGAACCT GGGGAGAAGAGAAGAGTACGACGTGCTGGACAAGC GGAGAGGCAGAGATCCTGAAATGGGCGGCAAGCCC AGACGGAAGAATCCTCAAGAGGGCCTGTATAATGA GCTGCAGAAAGACAAGATGGCCGAGGCCTACAGCG AGATCGGAATGAAGGGCGAGCGCAGAAGAGGCAA GGGACACGATGGACTGTACCAGGGACTGAGCACCG FMC63- CCACCAAGGATACCTATGACGCCCTGCACATGCAG CD28-zeta | GCCCTGCCTCCAAGAtaa ATGCTGCTGCTGGTCACATCTCTGCTGCTGTGCGAG CTGCCCCATCCTGCCTTTCTGCTGATCCCCGACATCC AGATGACCCAGACCACAAGCAGCCTGTCTGCCAGC CTGGGCGATAGAGTGACCATCAGCTGTAGAGCCAG | CCAGGACATCAGCAAGTACCTGAACTGGTATCAGC AAAAGCCCGACGGCACCGTGAAGCTGCTGATCTAC CACACCAGCAGACTGCACAGCGGCGTGCCAAGCAG ATTTTCTGGCAGCGGCTCTGGCACCGACTACAGCCT GACAATCAGCAACCTGGAACAAGAGGATATCGCTA CCTACTTCTGCCAGCAAGGCAACACCCTGCCTTACA CCTTTGGCGGAGGCACCAAGCTGGAAATCACCGGC TCTACAAGCGGCAGCGGCAAACCTGGATCTGGCGA GGGATCTACCAAGGGCGAAGTGAAACTGCAAGAGT CTGGCCCTGGACTGGTGGCCCCATCTCAGTCTCTGA GCGTGACCTGTACAGTCAGCGGAGTGTCCCTGCCTG ATTACGGCGTGTCCTGGATCAGACAGCCTCCTCGGA AAGGCCTGGAATGGCTGGGAGTGATCTGGGGCAGC GAGACAACCTACTACAACAGCGCCCTGAAGTCCCG GCTGACCATCATCAAGGACAACTCCAAGAGCCAGG TGTTCCTGAAGATGAACAGCCTGCAGACCGACGAC ACCGCCATCTACTATTGCGCCAAGCACTACTACTAC | GGCGGCAGCTACGCCATGGATTATTGGGGCCAGGG CACCAGCGTGACCGTTTCTTCTGCCGCCGCTATCGA AGTGATGTACCCTCCTCCTTACCTGGACAACGAGAA GTCCAACGGCACCATCATCCACGTGAAGGGCAAGC ACCTGTGTCCTTCTCCACTGTTCCCCGGACCTAGCA AGCCTTTCTGGGTGCTCGTTGTTGTTGGCGGCGTGC TGGCCTGTTACAGCCTGCTGGTTACCGTGGCCTTCA TCATCTTTTGGGTCAGAGTGAAGTTCAGCAGATCCG | CCGATGCTCCCGCCTATCAGCAGGGCCAAAACCAG CTGTACAACGAGCTGAACCTGGGGAGAAGAGAAGA GTACGACGTGCTGGACAAGCGGAGAGGCAGAGATC CTGAAATGGGCGGCAAGCCCAGACGGAAGAATCCT CAAGAGGGCCTGTATAATGAGCTGCAGAAAGACAA GATGGCCGAGGCCTACAGCGAGATCGGAATGAAGG GCGAGCGCAGAAGAGGCAAGGGACACGATGGACTG TACCAGGGACTGAGCACCGCCACCAAGGATACCTA FMC63-zeta | TGACGCCCTGCACATGCAGGCCCTGCCTCCAAGAtaa ATGGCTCTCCCGGTCACAGCCCTTCTCCTGCCCCTG GCACTCTTGCTGCATGCGGCACGACCCGACATCCAG ATGACCCAGACCACAAGCAGCCTGTCTGCCAGCCTG GGCGATAGAGTGACCATCAGCTGTAGAGCCAGCCA GGACATCAGCAAGTACCTGAACTGGTATCAGCAAA AGCCCGACGGCACCGTGAAGCTGCTGATCTACCAC ACCAGCAGACTGCACAGCGGCGTGCCAAGCAGATT TTCTGGCAGCGGCTCTGGCACCGACTACAGCCTGAC AATCAGCAACCTGGAACAAGAGGATATCGCTACCT ACTTCTGCCAGCAAGGCAACACCCTGCCTTACACCT TTGGCGGAGGCACCAAGCTGGAAATCACCGGTGGA GGTGGTTCTGGCGGAGGGGGATCTGGTGGAGGCGG TTCAGAAGTGAAACTGCAAGAGTCTGGCCCTGGACT GGTGGCCCCATCTCAGTCTCTGAGCGTGACCTGTAC AGTCAGCGGAGTGTCCCTGCCTGATTACGGCGTGTC CTGGATCAGACAGCCTCCTCGGAAAGGCCTGGAAT GGCTGGGAGTGATCTGGGGCAGCGAGACAACCTAC TACAACAGCGCCCTGAAGTCCCGGCTGACCATCATC AAGGACAACTCCAAGAGCCAGGTGTTCCTGAAGAT GAACAGCCTGCAGACCGACGACACCGCCATCTACT ATTGCGCCAAGCACTACTACTACGGCGGCAGCTACG CCATGGATTATTGGGGCCAGGGCACCAGCGTGACC GTTTCTTCTACCACAACGCCCGCCCCGCGACCGCCT ACTCCCGCTCCCACAATTGCATCACAACCCCTGTCT TTGAGACCCGAAGCTTGTCGACCAGCTGCCGGTGGC GCGGTTCACACGCGGGGGCTCGATTTCGCCTGTGAT ATATATATATGGGCCCCATTGGCTGGAACATGCGGA GTATTGCTTCTGAGCCTGGTGATTACCCTCTACTGTA AGAGAGGCCGGAAGAAACTTCTTTATATATTCAAGC AGCCCTTTATGCGACCCGTTCAGACTACCCAAGAGG AAGATGGATGCAGTTGCCGCTTTCCAGAAGAGGAG GAGGGCGGGTGCGAACTGAGAGTGAAGTTCAGCAG ATCCGCCGATGCTCCCGCCTATCAGCAGGGCCAAAA CCAGCTGTACAACGAGCTGAACCTGGGGAGAAGAG AAGAGTACGACGTGCTGGACAAGCGGAGAGGCAGA GATCCTGAAATGGGCGGCAAGCCCAGACGGAAGAA TCCTCAAGAGGGCCTGTATAATGAGCTGCAGAAAG ACAAGATGGCCGAGGCCTACAGCGAGATCGGAATG AAGGGCGAGCGCAGAAGAGGCAAGGGACACGATG GACTGTACCAGGGACTGAGCACCGCCACCAAGGAT CircKymria | ACCTATGACGCCCTGCACATGCAGGCCCTGCCTCCA h-Q388 AGAtaa ATGGCTCTCCCGGTCACAGCCCTTCTCCTGCCCCTG GCACTCTTGCTGCATGCGGCACGACCCGACATCCAG ATGACCCAGACCACAAGCAGCCTGTCTGCCAGCCTG GGCGATAGAGTGACCATCAGCTGTAGAGCCAGCCA GGACATCAGCAAGTACCTGAACTGGTATCAGCAAA AGCCCGACGGCACCGTGAAGCTGCTGATCTACCAC ACCAGCAGACTGCACAGCGGCGTGCCAAGCAGATT TTCTGGCAGCGGCTCTGGCACCGACTACAGCCTGAC AATCAGCAACCTGGAACAAGAGGATATCGCTACCT ACTTCTGCCAGCAAGGCAACACCCTGCCTTACACCT TTGGCGGAGGCACCAAGCTGGAAATCACCGGTGGA GGTGGTTCTGGCGGAGGGGGATCTGGTGGAGGCGG TTCAGAAGTGAAACTGCAAGAGTCTGGCCCTGGACT GGTGGCCCCATCTCAGTCTCTGAGCGTGACCTGTAC AGTCAGCGGAGTGTCCCTGCCTGATTACGGCGTGTC CTGGATCAGACAGCCTCCTCGGAAAGGCCTGGAAT GGCTGGGAGTGATCTGGGGCAGCGAGACAACCTAC TACAACAGCGCCCTGAAGTCCCGGCTGACCATCATC AAGGACAACTCCAAGAGCCAGGTGTTCCTGAAGAT GAACAGCCTGCAGACCGACGACACCGCCATCTACT ATTGCGCCAAGCACTACTACTACGGCGGCAGCTACG CCATGGATTATTGGGGCCAGGGCACCAGCGTGACC GTTTCTTCTACCACAACGCCCGCCCCGCGACCGCCT ACTCCCGCTCCCACAATTGCATCACAACCCCTGTCT TTGAGACCCGAAGCTTGTCGACCAGCTGCCGGTGGC GCGGTTCACACGCGGGGGCTCGATTTCGCCTGTGAT ATATATATATGGGCCCCATTGGCTGGAACATGCGGA GTATTGCTTCTGAGCCTGGTGATTACCCTCTACTGTA AGAGAGGCCGGAAGAAACTTCTTTATATATTCAAGC AGCCCTTTATGCGACCCGTTCAGACTACCCAAGAGG AAGATGGATGCAGTTGCCGCTTTCCAGAAGAGGAG GAGGGCGGGTGCGAACTGAGAGTGAAGTTCAGCAG ATCCGCCGATGCTCCCGCCTATAAGCAGGGCCAAA ACCAGCTGTACAACGAGCTGAACCTGGGGAGAAGA GAAGAGTACGACGTGCTGGACAAGCGGAGAGGCAG AGATCCTGAAATGGGCGGCAAGCCCAGACGGAAGA ATCCTCAAGAGGGCCTGTATAATGAGCTGCAGAAA GACAAGATGGCCGAGGCCTACAGCGAGATCGGAAT | GAAGGGCGAGCGCAGAAGAGGCAAGGGACACGAT GGACTGTACCAGGGACTGAGCACCGCCACCAAGGA CircKymria | TACCTATGACGCCCTGCACATGCAGGCCCTGCCTCC h - K388 AAGAtaa CircM971 CD22 CircCD19_ 22 Bispecific 29 _ ACTTCTTTATATATTCAAGCAGCCCTTTATGCGACCC GTTCAGACTACCCAAGAGGAAGATGGATGCAGTTG CCGCTTTCCAGAAGAGGAGGAGGGCGGGTGCGAAC TGAGAGTGAAGTTCAGCAGATCCGCCGATGCTCCCG CCTATAAGCAGGGCCAAAACCAGCTGTACAACGAG CTGAACCTGGGGAGAAGAGAAGAGTACGACGTGCT GGACAAGCGGAGAGGCAGAGATCCTGAAATGGGCG GCAAGCCCAGACGGAAGAATCCTCAAGAGGGCCTG TATAATGAGCTGCAGAAAGACAAGATGGCCGAGGC CTACAGCGAGATCGGAATGAAGGGCGAGCGCAGAA GAGGCAAGGGACACGATGGACTGTACCAGGGACTG AGCACCGCCACCAAGGATACCTATGACGCCCTGCA CATGCAGGCCCTGCCTCCAAGAtaa CircCD19_ 22 Bispecific 30 _ ATGCGGAGTATTGCTTCTGAGCCTGGTGATTACCCT CTACTGTAAGAGAGGCCGGAAGAAACTTCTTTATAT ATTCAAGCAGCCCTTTATGCGACCCGTTCAGACTAC CCAAGAGGAAGATGGATGCAGTTGCCGCTTTCCAG AAGAGGAGGAGGGCGGGTGCGAACTGAGAGTGAA GTTCAGCAGATCCGCCGATGCTCCCGCCTATAAGCA GGGCCAAAACCAGCTGTACAACGAGCTGAACCTGG GGAGAAGAGAAGAGTACGACGTGCTGGACAAGCGG AGAGGCAGAGATCCTGAAATGGGCGGCAAGCCCAG ACGGAAGAATCCTCAAGAGGGCCTGTATAATGAGC TGCAGAAAGACAAGATGGCCGAGGCCTACAGCGAG ATCGGAATGAAGGGCGAGCGCAGAAGAGGCAAGG GACACGATGGACTGTACCAGGGACTGAGCACCGCC | ACCAAGGATACCTATGACGCCCTGCACATGCAGGC CCTGCCTCCAAGAtaa
[372] In some embodiments, a CAR has a sequence as listed in Table 10. Table 11 - CAR domain sequences. mr 2 Protein Sequence 318 4-1BB KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEG GCEL 319 CD3( RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLD intracellular | KRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAY domain SEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQ ALPPR 320 CD28 QVQLVQSGAEVEKPGASVKVSCKASGYTFTDYYMH intracellular | WVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTM signaling TRDTSISTAYMELSRLRSDDTAVYYCASGWDFDYWG domain QGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIVMTQS PSSLSASVGDRVTITCRASQSIRY YLSWYQQKPGKAPK LLIYTASILQNGVPSRFSGSGSGTDFTLTISSLQPEDFAT YYCLQTYTTPDEGPGTKVEIK 321 FMC63 VH | EVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIR QPPRKGLEWLGVIWGSETTYYNSALKSRLTIKDNSKS QVFLKMNSLQTDDTAIY YCAKHYYYGGSYAMDYWG GTSVTVSS 322 FMC63 VL | DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQ KPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISN LEQEDIATYFCQQGNTLPYTFGGGTKLEIT
[373] In some embodiments, a CAR domain encoded by an inventive polynucleotide has a sequence as listed in Table 11.
[374] Preferred embodiments are described herein. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context. EXAMPLES
[375] Wesselhoeft er al. (2019) RNA Circularization Diminishes Immunogenicity and Can Extend Translation Duration In Vivo. Molecular Cell. 74(3), 508-520 and Wesselhoeft er al. (2018) Engineering circular RNA for Potent and Stable Translation in Eukaryotic Cells. Nature Communications. 9, 2629 are incorporated by reference in their entirety.
[376] The invention is further described in detail by reference to the following examples but are not intended to be limited to the following examples. These examples encompass any and all variations of the illustrations with the intention of providing those of ordinary skill in the art with complete disclosure and description of how to make and use the subject invention and are not intended to limit the scope of what is regarded as the invention. EXAMPLE 1 Example 1A: External homology regions allow for circularization of long precursor RNA using the permuted intron exon (PIE) circularization strategy.
[377] A 1.1kb sequence containing a full-length encephalomyocarditis virus (EMCV) IRES, a Gaussia luciferase (GLuc) expression sequence, and two short exon fragments of the permuted intron-exon (PIE) construct were inserted between the 3’ and 5’ introns of the permuted group I catalytic intron in the thymidylate synthase (Td) gene of the T4 phage. Precursor RNA was synthesized by run-off transcription. Circularization was attempted by heating the precursor RNA in the presence of magnesium ions and GTP, but splicing products were not obtained.
[378] Perfectly complementary 9 nucleotide and 19 nucleotide long homology regions were designed and added at the 5° and 3’ ends of the precursor RNA. Addition of these homology arms increased splicing efficiency from 0 to 16% for 9 nucleotide homology regions and to 48% for 19 nucleotide homology regions as assessed by disappearance of the precursor RNA band.
[379] The splicing product was treated with RNase R. Sequencing across the putative splice junction of RNase R-treated splicing reactions revealed ligated exons, and digestion of the RNase R-treated splicing reaction with oligonucleotide-targeted RNase H produced a single band in contrast to two bands yielded by RNase H-digested linear precursor. This shows that circular RNA is a major product of the splicing reactions of precursor RNA containing the 9 or 19 nucleotide long external homology regions. Example 1B: Spacers that conserve secondary structures of IRES and PIE splice sites increase circularization efficiency.
[380] A series of spacers was designed and inserted between the 3’ PIE splice site and the IRES. These spacers were designed to either conserve or disrupt secondary structures within intron sequences in the IRES, 3’ PIE splice site, and / or 5° splice site. The addition of spacer sequences designed to conserve secondary structures resulted in 87% splicing efficiency, while the addition of a disruptive spacer sequences resulted in no detectable splicing. EXAMPLE 2 Example 2A: Internal homology regions in addition to external homology regions creates a splicing bubble and allows for translation of several expression sequences.
[381] Spacers were designed to be unstructured, non-homologous to the intron and IRES sequences, and to contain spacer-spacer homology regions. These were inserted between the 5’ exon and IRES and between the 3’ exon and expression sequence in constructs containing external homology regions, EMCV IRES, and expression sequences for Gaussia luciferase (total length: 1289 nt), Firefly luciferase (2384 nt), eGFP (1451 nt), human erythropoietin (1313 nt), and Cas9 endonuclease (4934 nt). Circularization of all 5 constructs was achieved. Circularization of constructs utilizing T4 phage and Anabaena introns were roughly equal. Circularization efficiency was higher for shorter sequences. To measure translation, each construct was transfected into HEK293 cells. Gaussia and Firefly luciferase transfected cells produced a robust response as measured by luminescence, human erythropoietin was detectable in the media of cells transfected with erythropoietin circRNA, and EGFP fluorescence was observed from cells transfected with EGFP circRNA. Co-transfection of Cas9 circRNA with sgRNA directed against GFP into cells constitutively expressing GFP resulted in ablated fluorescence in up to 97% of cells in comparison to an sgRNA-only control. Example 2B: Use of CVB3 IRES increases protein production.
[382] Constructs with internal and external homology regions and differing IRES containing either Gaussia luciferase or Firefly luciferase expression sequences were made. Protein production was measured by luminescence in the supernatant of HEK293 cells 24 hours after transfection. The Coxsackievirus B3 (CVB3) IRES construct produced the most protein in both cases. Example 2C: Use of polyA or polyAC spacers increases protein production.
[383] Thirty nucleotide long polyA or polyAC spacers were added between the IRES and splice junction in a construct with each IRES that produced protein in example 2B. Gaussia luciferase activity was measured by luminescence in the supernatant of HEK293 cells 24 hours after transfection. Both spacers improved expression in every construct over control constructs without spacers. EXAMPLE 3 HEK293 or HeLa cells transfected with circular RNA produce more protein than those transfected with comparable unmodified or modified linear RNA.
[384] HPLC-purified Gaussia luciferase-coding circRNA (CVB3-GLuc-pAC) was compared with a canonical unmodified 5’ methylguanosine-capped and 3’ polyA-tailed linear GLuc mRNA, and a commercially available nucleoside-modified (pseudouridine, 5-methylcytosine) linear GLuc mRNA (from Trilink). Luminescence was measured 24 h post-transfection, revealing that circRNA produced 811.2% more protein than the unmodified linear mRNA in HEK293 cells and 54.5% more protein than the modified mRNA. Similar results were obtained in HeLa cells and a comparison of optimized circRNA coding for human erythropoietin with linear mRNA modified with 5-methoxyuridine.
[385] Luminescence data was collected over 6 days. In HEK293 cells, circRNA transfection resulted in a protein production half-life of 80 hours, in comparison with the 43 hours of unmodified linear mRNA and 45 hours of modified linear mRNA. In HeLa cells, circRNA transfection resulted in a protein production half-life of 116 hours, in comparison with the 44 hours of unmodified linear mRNA and 49 hours of modified linear mRNA. CircRNA produced substantially more protein than both the unmodified and modified linear mRNAs over its lifetime in both cell types. EXAMPLE 4 Example 4A: Purification of circRNA by RNase digestion, HPLC purification, and phosphatase treatment decreases immunogenicity. Completely purified circular RNA is significantly less immunogenic than unpurified or partially purified circular RNA. Protein expression stability and cell viability are dependent on cell type and circular RNA purity.
[386] Human embryonic kidney 293 (HEK293) and human lung carcinoma A549 cells were transfected with: a. products of an unpurified GLuc circular RNA splicing reaction, b. products of RNase R digestion of the splicing reaction, c. products of RNase R digestion and HPLC purification of the splicing reaction, or d. products of RNase digestion, HPLC purification, and phosphatase treatment of the splicing reaction.
[387] RNase R digestion of splicing reactions was insufficient to prevent cytokine release in A549 cells in comparison to untransfected controls.
[388] The addition of HPLC purification was also insufficient to prevent cytokine release, although there was a significant reduction in interleukin-6 (IL-6) and a significant increase in interferon-al (IFN-al) compared to the unpurified splicing reaction.
[389] The addition of a phosphatase treatment after HPLC purification and before RNase R digestion dramatically reduced the expression of all upregulated cytokines assessed in A549 cells. Secreted monocyte chemoattractant protein 1 (MCP1), IL-6, IFN-al, tumor necrosis factor a (TNFa), and IFNy inducible protein-10 (IP-10) fell to undetectable or un-transfected baseline levels.
[390] There was no substantial cytokine release in HEK293 cells. A549 cells had increased GLuc expression stability and cell viability when transfected with higher purity circular RNA. Completely purified circular RNA had a stability phenotype similar to that of transfected 293 cells. Example 4B: Circular RNA does not cause significant immunogenicity and is not a RIG-I ligand.
[391] A549 cells were transfected with the products of a splicing reaction.
[392] A549 cells were transfected with: a. unpurified circular RNA, b. high molecular weight (linear and circular concatenations) RNA, ¢. circular (nicked) RNA, d. an early fraction of purified circular RNA (more overlap with nicked RNA peak), e. a late fraction of purified circular RNA (less overlap with nicked RNA peak), f. introns excised during circularization, or g. vehicle (i.e. untransfected control).
[393] Precursor RNA was separately synthesized and purified in the form of the splice site deletion mutant (DS) due to difficulties in obtaining suitably pure linear precursor RNA from the splicing reaction. Cytokine release and cell viability was measured in each case.
[394] Robust IL-6, RANTES, and IP-10 release was observed in response to most of the species present within the splicing reaction, as well as precursor RNA. Early circRNA fractions elicited cytokine responses comparable to other non-circRNA fractions, indicating that even relatively small quantities of linear RNA contaminants are able to induce a substantial cellular immune response in A549 cells. Late circRNA fractions elicited no cytokine response in excess of that from untransfected controls. A549 cell viability 36 hours post-transfection was significantly greater for late circRNA fractions compared with all of the other fractions.
[395] RIG-I and IFN-B1 transcript induction upon transfection of A549 cells with late circRNA HPLC fractions, precursor RNA or unpurified splicing reactions were analyzed. Induction of both RIG-I and IFN-1 transcripts were weaker for late circRNA fractions than precursor RNA and unpurified splicing reactions. RNase R treatment of splicing reactions alone was not sufficient to ablate this effect. Addition of very small quantities of the RIG-I ligand 3p-hpRNA to circular RNA induced substantial RIG-I transcription. In HeLa cells, transfection of RNase R-digested splicing reactions induced RIG-I and IFN-B1, but purified circRNA did not. Overall, HeLa cells were less sensitive to contaminating RNA species than A549 cells.
[396] A time course experiment monitoring RIG-I, IFN-B1, IL-6, and RANTES transcript induction within the first 8 hours after transfection of A549 cells with splicing reactions or fully purified circRNA did not reveal a transient response to circRNA. Purified circRNA similarly failed to induce pro-inflammatory transcripts in RAW264.7 murine macrophages. [3971 A549 cells were transfected with purified circRNA containing an EMCV IRES and EGFP expression sequence. This failed to produce substantial induction of pro-inflammatory transcripts. These data demonstrate that non-circular components of the splicing reaction are responsible for the immunogenicity observed in previous studies and that circRNA is not a natural ligand for RIG-1. EXAMPLES Circular RNA avoids detection by TLRs.
[398] TLR 3,7, and 8 reporter cell lines were transfected with multiple linear or circular RNA constructs and secreted embryonic alkaline phosphatase (SEAP) was measured.
[399] Linearized RNA was constructed by deleting the intron and homology arm sequences. The linear RNA constructs were then treated with phosphatase (in the case of capped RNAs, after capping) and purified by HPLC.
[400] None of the attempted transfections produced a response in TLR7 reporter cells. TLR3 and TLRS reporter cells were activated by capped linearized RNA, polyadenylated linearized RNA, the nicked circRNA HPLC fraction, and the early circRNA fraction. The late circRNA fraction and m1y-mRNA did not provoke TLR-mediated response in any cell line.
[401] In a second experiment, circRNA was linearized using two methods: treatment of circRNA with heat in the presence of magnesium ions and DNA oligonucleotide-guided RNase H digestion. Both methods yielded a majority of full-length linear RNA with small amounts of intact circRNA. TLR3, 7, and 8 reporter cells were transfected with circular RNA, circular RNA degraded by heat, or circular RNA degraded by RNase H, and SEAP secretion was measured 36 hours after transfection. TLRS reporter cells secreted SEAP in response to both forms of degraded circular RNA, but did not produce a greater response to circular RNA transfection than mock transfection. No activation was observed in TLR3 and TLR7 reporter cells for degraded or intact conditions, despite the activation of TLR3 by in vitro transcribed linearized RNA. EXAMPLE 6 Unmodified circular RNA produces increased sustained in vivo protein expression than linear RNA.
[402] Mice were injected and HEK293 cells were transfected with unmodified and mly- modified human erythropoietin (hEpo) linear mRNAs and circRNAs. Equimolar transfection of mly-mRNA and unmodified circRNA resulted in robust protein expression in HEK293 cells. hEpo linear mRNA and circRNA displayed similar relative protein expression patterns and cell viabilities in comparison to GLuc linear mRNA and circRNA upon equal weight transfection of HEK293 and A549 cells.
[403] In mice, hEpo was detected in serum after the injection of hEpo circRNA or linear mRNA into visceral adipose. hEpo detected after the injection of unmodified circRNA decayed more slowly than that from unmodified or m1y-mRNA and was still prese...
Claims
WHAT IS CLAIMED IS:
1. A pharmaceutical composition comprising: a. acircular RNA polynucleotide comprising, in the following order, a 3” group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or T cell receptor (TCR) complex protein, and a 5° group I intron fragment, and b. a transfer vehicle comprising at least one of (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG-modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell present in a human subject, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell.
2. The pharmaceutical composition of claim 1, formulated for intravenous administration to the human subject in need thereof.
3. The pharmaceutical composition of claims 1 or 2, wherein the 3” group I intron fragment and 5° group I intron fragment are Anabaena group I intron fragments.
4. The pharmaceutical composition of claim 3, wherein the 3’ intron fragment and 5° intron fragment are defined by the L9a-5 permutation site in the intact intron.
5. The pharmaceutical composition of claim 3, wherein the 3’ intron fragment and 5’ intron fragment are defined by the L8-2 permutation site in the intact intron.
6. The pharmaceutical composition of any one of claims 1 - 5, wherein the IRES is from Taura syndrome virus, Triatoma virus, Theiler's encephalomyelitis virus, Simian Virus 40, Solenopsis invicta virus 1, Rhopalosiphum padi virus, Reticuloendotheliosis virus, Human poliovirus 1, Plautia stali intestine virus, Kashmir bee virus, Human rhinovirus 2, Homalodisca coagulata virus- 1, Human Immunodeficiency Virus type 1, Homalodisca coagulata virus- 1, Himetobi P virus, Hepatitis C virus, Hepatitis A virus, Hepatitis GB virus , Foot and mouth disease virus, Human enterovirus 71, Equine rhinitis virus, Ectropis obliqua picorna-like virus, Encephalomyocarditis virus, Drosophila C Virus, Human coxsackievirus B3, Crucifer tobamovirus, Cricket paralysis virus, Bovine viral diarrhea virus 1, Black Queen Cell Virus, Aphid lethal paralysis virus, Avian encephalomyelitis virus, Acute bee paralysis virus, Hibiscus chlorotic ringspot virus, Classical swine fever virus, Human FGF2, Human SFTPA1, Human AML1 / RUNX]1, Drosophila antennapedia, Human AQP4, Human ATIR, Human BAG-1, Human BCL2, Human BiP, Human c¢-IAP], Human c-myc, Human elF4G, Mouse NDST4L, Human LEF1, Mouse HIF1 alpha, Human n.myc, Mouse Gtx, Human p27kipl, Human PDGF2 / c-sis, Human p53, Human Pim-1, Mouse Rbm3, Drosophila reaper, Canine Scamper, Drosophila Ubx, Human UNR, Mouse UtrA, Human VEGF-A, Human XIAP, Drosophila hairless, S. cerevisiae TFIID, S. cerevisiae YAPI, tobacco etch virus, turnip crinkle virus, EMCV-A, EMCV-B, EMCV-Bf, EMCV-Cf, EMCV pEC9, Picobirnavirus, HCV QC64, Human Cosavirus E / D, Human Cosavirus F, Human Cosavirus JMY, Rhinovirus NAT001, HRV 14, HRVS89, HRVC-02, HRV-A21, Salivirus A SH1, Salivirus FHB, Salivirus NG-J1, Human Parechovirus 1, Crohivirus B, Yc¢-3, Rosavirus M-7, Shanbavirus A, Pasivirus A, Pasivirus A 2, Echovirus E14, Human Parechovirus 5, Aichi Virus, Hepatitis A Virus HA16, Phopivirus, CVA10, Enterovirus C, Enterovirus D, Enterovirus J, Human Pegivirus 2, GBV-C GT110, GBV-C K1737, GBV-C Iowa, Pegivirus A 1220, Pasivirus A 3, Sapelovirus, Rosavirus B, Bakunsa Virus, Tremovirus A, Swine Pasivirus 1, PLV-CHN, Pasivirus A, Sicinivirus, Hepacivirus K, Hepacivirus A, BVDV1, Border Disease Virus, BVDV2, CSFV-PK15C, SF573 Dicistrovirus, Hubei Picorna-like Virus, CRPV, Salivirus A BNS, Salivirus A BN2, Salivirus A 02394, Salivirus A GUT, Salivirus A CH, Salivirus A SZ1, Salivirus FHB, CVB3, CVBI1, Echovirus 7, CVBS5, EVA71, CVA3, CVAIL2, EV24 or an aptamer to eIF4G.
7. The pharmaceutical composition of claim 6, wherein the IRES comprises a CVB3 IRES or a fragment or variant thereof, or wherein the IRES comprises a sequence according to SEQ ID NO:
65.
8. The pharmaceutical composition of claim 6, wherein the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof.
9. The pharmaceutical composition of claim 8, wherein the IRES comprises a sequence according to SEQ ID NO:
63.
10. The pharmaceutical composition of any one of claims 1 - 9, comprising a first internal spacer between the 3’ group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment.
11. The pharmaceutical composition of claim 10, wherein the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
12. The pharmaceutical composition of any one of claims 1 - 11, wherein the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin- like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRVIII), disialoganglioside GD2, disialoganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate- specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER 3, Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GM1, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGSS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl- GD2 ganglioside (OAcGD?2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein- coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179a.
13. The pharmaceutical composition of claim 12, wherein the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19.
14. The pharmaceutical composition of any one of claims 1 - 13, wherein the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, MYDS88, CD2, SLAM, and combinations thereof.
15. The pharmaceutical composition of any one of claims 1 - 14, wherein the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain.
16. The pharmaceutical composition of any one of claims 1 - 15, wherein the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain.
17. The pharmaceutical composition of any one of claims 1 - 16, wherein the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain.
18. The pharmaceutical composition of any one of claims 1 - 17, wherein the CAR or TCR complex protein comprises a CAR comprising: a. an antigen binding domain, b. a spacer domain, c. a transmembrane domain, d. a costimulatory domain, and e. an intracellular T cell signaling domain.
19. The pharmaceutical composition of any one of claims 1 - 18, wherein the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens.
20. The pharmaceutical composition of any one of claims 1 - 19, wherein the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta.
21. The pharmaceutical composition of any one of claims 1 - 20, wherein the transfer vehicle comprises a lipid nanoparticle, a core-shell nanoparticle, a biodegradable nanoparticle, a biodegradable lipid nanoparticle, a polymer nanoparticle, or a biodegradable polymer nanoparticle.
22. The pharmaceutical composition of any one of claims 1 - 21, further comprising a targeting moiety.
23. The pharmaceutical composition of claim 22, wherein the targeting moiety mediates receptor-mediated endocytosis or direct fusion into selected cells of a selected cell population or tissue in the absence of cell isolation or purification.
24. The pharmaceutical composition of claim 22, wherein the targeting moiety is capable of binding to a protein selected from the group CD3, CD4, CD8, CD35, CD7, PD-1, 4- 1BB, CD28, Clq, and CD2.
25. The pharmaceutical composition of claim 22, wherein the targeting moiety comprises an antibody specific for a macrophage, dendritic cell, NK cell, NKT, or T cell antigen.
26. The pharmaceutical composition of any one of claims 22 - 25, wherein the targeting moiety comprises a scFv, nanobody, peptide, minibody, polynucleotide aptamer, heavy chain variable region, light chain variable region or fragment thereof.
27. The pharmaceutical composition of any one of claims 1 - 26, in an amount effective to treat cancer in the human subject.
28. The pharmaceutical composition of any one of claims 1 - 27, wherein the pharmaceutical composition has an enhanced safety profile when compared to a pharmaceutical composition comprising T cells or vectors comprising exogenous DNA encoding the same CAR.
29. The pharmaceutical composition of any one of claims 1 - 28, wherein less than 1%, by weight, of the polynucleotides in the composition are double stranded RNA, DNA splints, or triphosphorylated RNA.
30. The pharmaceutical composition of any of claims 1 - 29, wherein less than 1%, by weight, of the polynucleotides and proteins in the pharmaceutical composition are double stranded RNA, DNA splints, triphosphorylated RNA, phosphatase proteins, protein ligases, and capping enzymes.
31. The pharmaceutical composition of any one of claims 1 - 30, wherein the transfer vehicle comprises more than one circular RNA polynucleotide.
32. A circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment.
33. The circular RNA polynucleotide of claim 32, wherein the 3’ group I intron fragment and 5’ group I intron fragment are Anabaena group I intron fragments.
34. The circular RNA polynucleotide of claim 33, wherein the 3’ intron fragment and 5° intron fragment are defined by the L9a-5 permutation site in the intact intron.
35. The circular RNA polynucleotide of claim 33, wherein the 3’ intron fragment and 5’ intron fragment are defined by the L8-2 permutation site in the intact intron.
36. The circular RNA polynucleotide of any one of claims 32 - 35, wherein the IRES comprises a CVB3 IRES or a fragment or variant thereof.
37. The circular RNA polynucleotide of claim 36, wherein the IRES has a sequence according to SEQ ID NO:
65.
38. The circular RNA polynucleotide of claim 32, wherein the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof.
39. The circular RNA polynucleotide of claim 38, wherein the IRES has a sequence according to SEQ ID NO:
63.
40. The circular RNA polynucleotide of any one of claims 32 - 39, comprising a first internal spacer between the 3” group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment.
41. The circular RNA polynucleotide of claim 40, wherein the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
42. The circular RNA polynucleotide of any one of claims 32 - 41, consisting of natural nucleotides.
43. The circular RNA polynucleotide of any one of claims 32 - 42, further comprising a second expression sequence encoding a therapeutic protein.
44. The circular RNA polynucleotide of claim 43, wherein the therapeutic protein comprises a checkpoint inhibitor, 45. The circular RNA polynucleotide of claim 43, wherein the therapeutic protein comprises a cytokine.
46. The circular RNA polynucleotide of any one of claims 32 - 45, wherein the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin- like molecule-1, CD33, epidermal growth factor receptor variant IIT (EGFRvVIII), disialoganglioside GD2, disaloganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate- specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR?2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER 3, Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GML, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl- GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein- coupled receptor class C group 5, member D (GPRC35D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179%a 47. The circular RNA polynucleotide of any one of claims 32 - 46, wherein the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19.
48. The circular RNA polynucleotide of any one of claims 32 - 47, wherein the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, CD2, SLAM, and combinations thereof.
49. The circular RNA polynucleotide of any one of claims 32 - 48, wherein the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain.
50. The circular RNA polynucleotide of any one of claims 32 - 49, wherein the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain.
51. The circular RNA polynucleotide of any one of claims 32 - 50, wherein the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain.
52. The circular RNA polynucleotide of any one of claims 32 - 51, wherein the CAR or TCR complex protein comprises a CAR comprising: a. an antigen binding domain, b. a spacer domain, ¢. atransmembrane domain, d. a costimulatory domain, and e. an intracellular T cell signaling domain.
53. The circular RNA polynucleotide of any one of claims 32 - 52, wherein the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens.
54. The circular RNA polynucleotide of any one of claims 32 - 53, wherein the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta.
55. The circular RNA polynucleotide of any one of claims 32 - 54, consisting of natural nucleotides.
56. The circular RNA polynucleotide of claim 32, wherein the expression sequence is codon optimized.
57. The circular RNA polynucleotide of any one of claims 32 - 56, optimized to lack at least one microRNA binding site present in an equivalent pre-optimized polynucleotide.
58. The circular RNA polynucleotide of any one of claims 32 - 57, optimized to lack at least one endonuclease susceptible site present in an equivalent pre-optimized polynucleotide.
59. The circular RNA polynucleotide of any one of claims 32 - 58, optimized to lack at least one RNA-editing susceptible site present in an equivalent pre-optimized polynucleotide.
60. The circular RNA polynucleotide of any one of claims 32 - 59, having an in vivo functional half-life in humans greater than that of an equivalent linear RNA polynucleotide having the same expression sequence.
61. The circular RNA polynucleotide of any one of claims 32 - 60, having a length of about 100 nucleotides to about 10 kilobases.
62. The circular RNA polynucleotide of any one of claims 32 - 61, having a functional half-life of at least about 20 hours.
63. The circular RNA polynucleotide of any one of claims 32 - 62, having a duration of therapeutic effect in a human cell of at least about 20 hours.
64. The circular RNA polynucleotide of any one of claims 32 — 63, having a duration of therapeutic effect in a human cell greater than or equal to that of an equivalent linear RNA polynucleotide comprising the same expression sequence.
65. The circular RNA polynucleotide of any one of claims 32 -64, having a functional half-life in a human cell greater than or equal to that of an equivalent linear RNA polynucleotide comprising the same expression sequence.
66. A DNA vector comprising, in the following order, a 5° duplex forming region, an Anabaena 3’ group I intron fragment with a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, an Anabaena 5° group I intron fragment with a second permutation site, and a 3’ duplex forming region.
67. The DNA vector of claim 66, wherein the 3° group I intron fragment and 5° group I intron fragment are Anabaena group I intron fragments.
68. The DNA vector of claim 67, wherein the 3’ intron fragment and 5° intron fragment are defined by the L9a-5 permutation site in the intact intron.
69. The DNA vector of claim 67, wherein the 3’ intron fragment and 5° intron fragment are defined by the L8-2 permutation site in the intact intron.
70. The DNA vector of any one of claims 66 - 69, wherein the IRES comprises a CVB3 IRES or a fragment or variant thereof.
71. The DNA vector of claim 70, wherein the IRES encodes a sequence according to SEQ ID NO:
65.
72. The DNA vector of any one of claim 66 - 69, wherein the IRES comprises a salivirus SZ1 IRES or a fragment or variant thereof.
73. The DNA vector of claim 72, wherein the IRES encodes a sequence according to SEQ ID NO:
63.
74. The DNA vector of any one of claims 66 - 73, wherein the circular RNA polynucleotide comprises, in the following order, 5’ duplex forming region, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, a 5° group I intron fragment, and a 3’ duplex forming region.
75. The DNA vector of claim 74, wherein the 5° duplex forming region and 3” duplex forming region each have about 70% GC nucleotides.
76. The DNA vector of claim 74 or claim 75, wherein the 5° duplex forming region and 3’ duplex forming region each have a length of about 30 nucleotides.
77. The DNA vector of any one of claims 74 - 76, comprising a first external spacer between the 5° duplex forming region and the 3’ group I intron fragment, and a second external spacer between the 5° group I intron fragment and the 3’ duplex forming region.
78. The DNA vector of claim 77, wherein the first and second external spacers each have a length of about 10 to about 60 nucleotides.
79. The DNA vector of any one of claims 74 - 78, wherein the 5° duplex forming region is directly adjacent to the 3’ group I intron fragment, and wherein the 5° group I intron fragment is directly adjacent to the 3’ duplex forming region.
80. The DNA vector of any one of claims 66 - 79, comprising a first internal spacer between the 3° group I intron fragment and the IRES, and a second internal spacer between the expression sequence and the 5° group I intron fragment.
81. The DNA vector of claim 80, wherein the first and second internal spacers each have a length of about 10 to about 60 nucleotides.
82. The DNA vector of any one of claims 66 - 81, wherein the CAR or TCR complex protein comprises an antigen binding domain specific for an antigen selected from the group: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRVIII), disialoganglioside GD2, disaloganglioside GD3, TNF receptor family member, B cell maturation antigen (BCMA), Tn antigen ((Tn Ag) or (GaINAca-Ser / Thr)), prostate-specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated glycoprotein 72 (TAG72), CD38, CD44v6, Carcinoembryonic antigen (CEA), Epithelial cell adhesion molecule (EPCAM), B7H3 (CD276), KIT (CD117), Interleukin-13 receptor subunit alpha-2, mesothelin, Interleukin 11 receptor alpha (IL-11Ra), prostate stem cell antigen (PSCA), Protease Serine 21, vascular endothelial growth factor receptor 2 (VEGFR2), Lewis(Y) antigen, CD24, Platelet-derived growth factor receptor beta (PDGFR-beta), Stage-specific embryonic antigen-4 (SSEA-4), CD20, Folate receptor alpha, HER2, HER3, Mucin 1, cell surface associated (MUC1), epidermal growth factor receptor (EGFR), neural cell adhesion molecule (NCAM), Prostase, prostatic acid phosphatase (PAP), elongation factor 2 mutated (ELF2M), Ephrin B2, fibroblast activation protein alpha (FAP), insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), glycoprotein 100 (gp100), oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (ber-abl), tyrosinase, ephrin type-A receptor 2 (EphA2), Fucosyl GMI, sialyl Lewis adhesion molecule (sLe), ganglioside GM3, transglutaminase 5 (TGS5), high molecular weight-melanoma-associated antigen (HMWMAA), o-acetyl-GD2 ganglioside (OAcGD2), Folate receptor beta, tumor endothelial marker 1 (TEM 1 / CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDNG6), claudin 18.2 (CLDN18.2), thyroid stimulating hormone receptor (TSHR), G protein- coupled receptor class C group 5, member D (GPRC5D), chromosome X open reading frame 61 (CXORF61), CD97, and CD179%a 83. The DNA vector of any one of claims 66 - 82, wherein the CAR or TCR complex protein comprises a CAR comprising an antigen binding domain specific for CD19.
84. The DNA vector of any one of claims 66 - 83, wherein the CAR or TCR complex protein comprises a CAR comprising a costimulatory domain selected from the group CD28, 4-1BB, 0X40, CD27, CD30, ICOS, GITR, CD40, CD2, SLAM, and combinations thereof.
85. The DNA vector of any one of claims 66 - 84, wherein the CAR or TCR complex protein comprises a CAR comprising a CD3zeta signaling domain.
86. The DNA vector of any one of claims 66 - 85, wherein the CAR or TCR complex protein comprises a CAR comprising a CH2CH3, CD28, and / or CD8 spacer domain.
87. The DNA vector of any one of claims 66 - 86, wherein the CAR or TCR complex protein comprises a CAR comprising a CD28 or CD8 transmembrane domain.
88. The DNA vector of any one of claims 66 - 87, wherein the CAR or TCR complex protein comprises a CAR comprising: a. an antigen binding domain, b. a spacer domain, c. a transmembrane domain, d. a costimulatory domain, and e. an intracellular T cell signaling domain.
89. The DNA vector of any one of claims 66 - 88, wherein the CAR or TCR complex protein comprises a multispecific CAR comprising antigen binding domains for at least 2 different antigens.
90. The DNA vector of any one of claims 66 - 89, wherein the CAR or TCR complex protein comprises a TCR complex protein selected from the group TCRalpha, TCRbeta, TCRgamma, and TCRdelta.
91. A eukaryotic cell comprising a circular RNA polynucleotide comprising, in the following order, a 3’ group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment.
92. The eukaryotic cell of claim 91, wherein the eukaryotic cell comprises a human cell.
93. The eukaryotic cell of claims 91 or 92, wherein the eukaryotic cell comprises an immune cell.
94. The eukaryotic cell of any one of claims 91 - 93, wherein the eukaryotic cell comprises a T cell.
95. A population of eukaryotic cells comprising a circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment, wherein the population of eukaryotic cells express the CAR or TCR complex protein encoded by the circular RNA polynucleotide on its cell surface.
96. The population of eukaryotic cells of claim 95, wherein the population of cells comprises NK cells, NKT cells, macrophages, dendritic cells, alphabeta T cells, gammadelta T cells, or combinations thereof.
97. The population of eukaryotic cells of claims 95 or 96, wherein the population of cells comprises T cells.
98. The population of eukaryotic cells of claim 97, wherein the population comprises CD3+ T cells.
99. The population of eukaryotic cells of claim 97, wherein the population comprises CD4+ T cells.
100. The population of eukaryotic cells of claim 97, wherein the population comprises CD8+ T cells.
101. The population of eukaryotic cells of any one of claims 95 - 100, in an amount effective to treat cancer in a human subject in need thereof.
102. The population of eukaryotic cells of any one of claims 95 - 101, wherein the population of cells kills tumor cells more effectively or for longer than an equivalent population of eukaryotic cells comprising linear RNA encoding the same CAR.
103. A method of making a population of eukaryotic cells comprising contacting cells in the population with a transfer vehicle comprising a circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment, wherein the transfer vehicle comprises (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG-modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell.
104. A method of treating a subject in need thereof comprising administering a therapeutically effective amount of a pharmaceutical composition comprising: a. a circular RNA polynucleotide comprising, in the following order, a 3° group I intron fragment, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) or TCR complex protein, and a 5° group I intron fragment, and b. a transfer vehicle comprising (i) an ionizable lipid, (ii) a structural lipid, and (iii) a PEG-modified lipid, wherein the transfer vehicle is capable of delivering the circular RNA polynucleotide to a human immune cell, such that the CAR is translated in the human immune cell and expressed on the surface of the human immune cell.
105. The method of claim 104, wherein the subject has a cancer selected from the group acute lymphocytic cancer, acute myeloid leukemia (AML), alveolar rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., medulloblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia, liquid tumors, liver cancer, lung cancer (e.g., non- small cell lung carcinoma and lung adenocarcinoma), lymphoma, mesothelioma, mastocytoma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, ovarian cancer, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, solid tumors, synovial sarcoma, gastric cancer, testicular cancer, thyroid cancer, and ureter cancer.
106. An RNA polynucleotide comprising an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, and at least one self-circularizing element.
107. The RNA polynucleotide of claim 106, comprising a 5° duplex forming region, an Anabaena 3’ group I intron fragment with a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, an Anabaena 5° group I intron fragment with a second permutation site, and a 3” duplex forming region.
108. The RNA polynucleotide of claims 106 or 107, comprising a 5° duplex forming region, a first permutation site, an Internal Ribosome Entry Site (IRES), an expression sequence encoding a chimeric antigen receptor (CAR) polypeptide, a second permutation site, and a 3° duplex forming region.
109. The RNA polynucleotide of any one of claims 106 - 108, wherein the self- circularizing element is a group I intron fragment.
110. The RNA polynucleotide of claims 108 or 109, comprising a 3’ group I intron fragment and a 5° intron fragment.
111. The RNA polynucleotide of claim 110, wherein the 3° group I intron fragment and 5’ group I intron fragment are Anabaena group I intron fragments.
112. The RNA polynucleotide of claim 111, wherein the 3” intron fragment and 5° intron fragment are defined by the L9a-5 permutation site in the intact intron.
113. The RNA polynucleotide of claim 111, wherein the 3” intron fragment and 5° intron fragment are defined by the L8-2 permutation site in the intact intron.
114. The RNA polynucleotide of any one of claims 110 - 113, capable of circularizing in the absence of an enzyme.
115. The RNA polynucleotide of any one of claims 106 - 114, consisting of natural nucleotides.
116. A DNA vector suitable for synthesizing the RNA polynucleotide of any one of claims 106-115.
117. The circular RNA polynucleotide of any one of claims 32-65, wherein the circular RNA polynucleotide is delivered to a target cell in a non-lipid polymeric core-shell nanoparticle.