Tumor immunotherapy using Sindbis viral vectors and agonist monoclonal antibodies

AU2020309538B2Pending Publication Date: 2026-09-03NEW YORK UNIV
View PDF 1 Cites 0 Cited by

Patent Information

Application Number
AU2020309538
Authority / Receiving Office
AU · AU
Patent Type
Applications
Current Assignee / Owner
Priority Date
2019-07-08
Filing Date
2020-07-08
Publication Date
2026-09-03

AI Technical Summary

Technical Problem

Current cancer treatments using immune checkpoint modulation face limitations such as low response rates due to lack of T cell infiltration into tumors and the immunosuppressive tumor microenvironment, as well as tumor escape mechanisms like mutation or loss of drug targets.

Method used

The use of Sindbis viral vectors, which can be replication defective and encode immunostimulatory proteins like IL-12, in combination with agonist monoclonal antibodies such as anti-OX40, to induce a nonspecific immune response that leads to a secondary immune response with memory T cells against tumor-associated antigens.

Benefits of technology

This approach enhances T cell infiltration and activation within the tumor microenvironment, overcoming immunosuppression and tumor escape mechanisms, leading to improved cancer treatment efficacy.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000001_0000
    Figure 00000001_0000
  • Figure 00000205_0000
    Figure 00000205_0000
  • Figure 00000205_0001
    Figure 00000205_0001
Patent Text Reader

Abstract

The present disclosure provides compositions and methods for the treatment of cancer. More specifically, the present disclosure provides compositions and methods utilizing a combination of an oncolytic viruses, such as Sindbis virus, and antibodies directed against a co-stimulatory molecule or to an immune system agonist molecule, such as anti-OX40 antibodies and anti-4-1BB antibodies.
Need to check novelty before this filing date? Find Prior Art

Description

TUMOR IMMUNOTHERAPY USING SINDBIS VIRAL VECTORS AND AGONIST MONOCLONAL ANTIBODIES CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of U.S. Provisional Application No. 62 / 871,675, filed on July 8, 2019, the contents of which is hereby incorporated by reference in their entirety. INCORPORATION-BY-REFERENCE OF SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on July 03, 2020, is named “27522-0225PCT Sequence Listing ST25.txt” and is 34 kilobytes in size. FIELD OF THE INVENTION

[0003] The present disclosure describes compositions and methods directed to treating cancer where the compositions include utilizing oncolytic viruses, such as Sindbis virus, and antibodies directed against a co-stimulatory molecule or to an immune system agonist molecule, such as OX-40 and 4-1BB (CD137). BACKGROUND OF THE INVENTION

[0004] Immune checkpoint modulation has shown remarkable promise in treating cancer. Although, high response rates with immune checkpoint blockade have been documented in patients with highly immunogenic tumors, often the proportion of patients that respond to treatment is still low. Major challenges to overcome are the lack of T cell infiltration into the tumor microenvironment as well as the immunosuppressive nature of the tumor, which inhibits the intratumoral immune response. Further, tumors tend to quickly escape the immune response by mutating or losing the expression of drug targets or tumor antigens targeted by the immune response. Thus there is a need in the art for compositions and methods that overcome these limitations. The present disclosure addresses these needs. SUMMARY OF THE INVENTION

[0005] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a oncolytic viral vector and (b) an antibody directed against a co-stimulatory molecule or a nucleic acid encoding same; or an antibody to an immunesystem agonist molecule or a nucleic acid encoding same.

[0006] The oncolytic viral vector can be a Sindbis viral vector. The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise at least one nucleic acid encoding a therapeutic protein. The Sindbis viral vector can comprise at least one nucleic acid encoding an immunostimulatory or an immunomodulatory protein. The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL-3, IL- 4, IL-5, IL-6 IL-7,1L-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34,IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The Sindbis viral vector can comprise at least one nucleic acid encoding LacZ, Flue or GFP.

[0007] The antibody can be an anti-OX40 antibody, an anti-4-1BB antibody, an anti- CD28 antibody, an anti-GITR antibody, an anti-CD137 antibody, an anti-CD37 antibody, an anti-HVEM antibody, or a combination thereof.

[0008] The Sindbis viral vector and the antibody can induce an immune response in a tumor associated antigen (TAA) nonspecific manner. The induced and nonspecific immune response can be a first immune response. The first immune response can be followed by a secondary immuneresponse. The secondary immune response can be the result of one or more TAAs released from the dead tumor cells. The secondary immune response can comprise memory T cells directed against one or more TA As released from the dead tumor cells.

[0009] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti- 0X40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.

[00010] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit) GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.

[00011] The Sindbis viral vector can comprise a nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and comprise a nucleic acid encoding interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.

[00012] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.

[00013] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ IDNO: 7.

[00014] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.

[00015] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.

[00016] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.

[00017] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.

[00018] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00019] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00020] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00021] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 34.

[00022] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 34.

[00023] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 38.

[00024] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38.

[00025] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 42.

[00026] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 42.

[00027] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 46.

[00028] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 46.

[00029] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 50.\

[00030] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 50.

[00031] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.

[00032] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof, of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody.

[00033] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab, dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments.

[00034] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.

[00035] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti- 0X40 monoclonal antibody.

[00036] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 §, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit) GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ IDNO: 2.

[00037] The Sindbis viral vector can comprise a nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and comprise a nucleic acid encoding interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.

[00038] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.

[00039] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ IDNO: 7.

[00040] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.

[00041] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.

[00042] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.

[00043] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.

[00044] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00045] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00046] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00047] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 34.

[00048] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 34.

[00049] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 38.

[00050] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38.

[00051] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 42.

[00052] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 42.

[00053] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 46.

[00054] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 46.

[00055] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 50.\

[00056] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 50.

[00057] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof; is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof; of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody.

[00058] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 0X40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab")2, Fab, dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments.

[00059] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject. The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject.

[00060] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 §, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit) GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.

[00061] The Sindbis viral vector can comprise a nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and comprise a nucleic acid encoding interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.

[00062] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.

[00063] The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered sequentially or concurrently. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered intraperitoneally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally.

[00064] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.

[00065] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1.

[00066] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit (IL-12 B, IL-12, p40 subunit) GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin-12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2.

[00067] The Sindbis viral vector can comprise a nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and comprise a nucleic acid encoding interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4.

[00068] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.

[00069] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.

[00070] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.

[00071] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.

[00072] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.

[00073] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.

[00074] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.

[00075] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12.

[00076] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12.

[00077] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00078] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00079] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13.

[00080] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 34.

[00081] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 34.

[00082] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 38.

[00083] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38.

[00084] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 42.

[00085] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 42.

[00086] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 46.

[00087] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 46.

[00088] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 50.

[00089] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 50.

[00090] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally.

[00091] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof; of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody.

[00092] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments.

[00093] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer.

[00094] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY- ESO-1 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY- ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15.

[00095] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8.

[00096] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7.

[00097] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10.

[00098] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12.

[00099] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000100] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000101] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000102] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000103] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000104] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof; is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof; of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody. [000105] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against O0X-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 0X40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000106] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount (a) a Sindbis viral vector and (b) an anti-4-1BB (CD137) monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. The present disclosure further provides in vitro or ex vivo methods for treating cancer or assessing the treatment of cancer in a subject comprising contacting a biological sample from the subject with (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. The Sindbis viral vector does not comprise an endogenous nucleic acid encoding any protein. [000107] The Sindbis viral vector is replication defective. The Sindbis viral vector can comprise a nucleic acid sequence encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein. The Sindbis viral vector can comprise the nucleic acid encoding the therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody. The Sindbis viral vector can comprise a nucleic acid sequence encoding LacZ (lac operon structural gene lacZ encoding p-galactosidase), Flue (firefly luciferase) or GFP (green fluorescent protein). The Sindbis viral vector can comprise the nucleic acid encoding LacZ, Flue or GFP and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody. [000108] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23. [000109] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. [000110] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL- 3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The anti-4-1BB antibody can be urelumab, utomilumab or a combination thereof. The anti-4-1BB antibody can be InVivoMAD anti-mouse 4-1BB (BioXCell, Clone: LOB12.3, Cat.No. BE0169). [000111] The Sindbis viral vector and the anti-4-1BB monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-4-1BB monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-4-1BB monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-4-1BB monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally. [000112] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof, of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody. [000113] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4-1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000114] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is a lymphoma. In one preferred aspect, the cancer is a B cell lymphoma. [000115] The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding encoding LacZ, Flue or GFP and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding LacZ, Flue or GFP and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4- 1BB monoclonal antibody. The present disclosure further provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) an anti-4- 1BB monoclonal antibody or a nucleic acid encoding same. The present disclosure provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding encoding LacZ, Flue or GFP and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. [000116] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23. [000117] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. [000118] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL- 3,1L-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18,1L-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31,IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. [000119] An antibody of the present disclosure, or a fragment thereof, can be derived from any species, including, but not limited to, a human, a mouse, a rat, a hamster, a dog, a rabbit, a frog, a sheep, a goat, a cow, a horse, a pig, a bird, a donkey, a chicken, a camel, a llama, a dromedary, an alpaca, a shark, a bovine and a turtle. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a human. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a camel, a llama or an alpaca. In some aspects, an antibody of the present disclosure, or a fragment thereof, is derived from a shark. In some aspects, an antibody of the present disclosure, or a fragment thereof, of the present disclosure is a chimeric antibody that is derived from two or more of the aforementioned species. In a non-limiting example, an antibody of the present disclosure, or fragment thereof, can be a chimeric antibody that is derived from a human and a mouse. In some aspects, an antibody of the present disclosure, or a fragment thereof, can be derived from any species other than human and can be further humanized using standard methods known in the art as to reduce the immunogenicity of the antibody. [000120] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4-1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000121] Any of the above aspects can be combined with any other aspect. [000122] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. In the Specification, the singular forms also include the plural unless the context clearly dictates otherwise; as examples, the terms “a,” “an,” and “the” are understood to be singular or plural and the term “or” is understood to be inclusive. By way of example, “an element” means one or more element. Throughout the specification the word “comprising,” or variations such as “comprises” or “comprising,” will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from the context, all numerical values provided herein are modified by the term “about.” [000123] Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. The references cited herein are not admitted to be prior art to the claimed invention. In the case of conflict, the present Specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and are not intended to be limiting. Other features and advantages of the disclosure will be apparent from the following detailed description and claims. BRIEF DESCRIPTION OF DRAWINGS [000124] FIG. 1A-1D. SV.IL12 induces a modest therapeutic efficacy and increases 0X40 expression on CD4 T cells. FIG. 1A depicts treatment schema. BALB / c mice were given intraperitoneal (i.p.) injections of SV, IL-12 (50 ng), or SV.IL12 at various times after injection of 7 x 10* CT.26.Fluc on day 0. FIG. 1B depicts survival plots of control and treated mice bearing CT26.Fluc tumors. The x-axis shows days of treatment and y-axis shows percentage survival. Statistical significance between SV .IL12 and all other groups was determined with the Mantel-Cox test. Results are representatives of at least two independent experiments. FIG. 1C-D depict effect on OX40 expression of treatment of CT26 tumor-bearing mice with SV, IL-12 (50 ng), or SV.IL12 on 4 consecutive days (days 1, 2, 3, and 4). On day 7, spleens were excised and a single-cell suspension was stained and analyzed by flow cytometry. As controls, naive and untreated (control) tumor-bearing mice were used. FIG. 1C depicts percentage of 0X40 expression by CD4 T cells (left), regulatory T cells (TREG; middle), and CD8 T cells (right). The x-axis shows the various treatment groups and the y-axis shows percentage of 0X40+ cells. FIG. 1D depicts representative flow cytometry plots indicating 0X40 staining in different T cell subsets. Bars represent means and each symbol represents an individual mouse. Statistical significance was determined with the Kruskal-Wallis test followed by the Dunns’ test or the Mann-Whitney test. Results are representatives of at least two independent experiments. [000125] FIG. 2A-2C. SV infects monocytes / macrophages in mediastinal lymph nodes and quickly activates T cells. FIG. 2A depicts that tumor free mice were treated i.p. with SV expressing the firefly luciferase (Fluc) protein. 4 hours later, bioluminescent images were taken to monitor Fluc expression from SV. To determine the source of the signal, the mediastinal lymph nodes (LN) and adipose tissue were extracted and imaged separately. FIG. 2B depicts percentage of GFP expression by Ly6G-CD11b+F4 / 80+ cells. FIG. 2C depicts percentage of CD69 expression by CD4 (left graph) and CD8 (right graph) T cells. Tumor free mice were treated i.p. with SV expressing GFP for 4 consecutive days. On day 5, mediastinal and inguinal LN were extracted and a single cell suspension was stained and analyzed by flow cytometry. As control, naive mice were used. Statistical significance was determined with the Mann-Whitney test. Results are representatives of at least two independent experiments. [000126] FIG. 3A-3D. IL-12 and IFN-y production derived from SV.IL12 infection. FIG. 3A depicts IL-12 levels in supematant of infected cells measured by ELISA. 5 x 10° MyC- CaP cells were infected with SV.IL12 at various MOI (10; 1; 0°1) for 2 hours. As control, MyC- CaP cells were infected with SV or left uninfected (mock). SV was washed away and replaced with fresh media. After 24 hours incubation, supernatant was collected and IL-12 was measured by ELISA. FIG. 3B depicts IL-12 levels in plasma was measured by ELISA. FIG. 3C depicts percentage of Tbet expression by CD4 T cells in cell suspensions from mediastinal LN stained and analyzed by flow cytometry. FIG. 3D depicts IFNy enzyme-linked immunospot analysis of splenocytes from control and treated mice as indicated (n=3-10 mice per group). Tumor bearing mice were treated with SV.IL12 on 4 consecutive days (days 1; 2; 3; 4). As control, naive, untreated (control), IL-12 (50 ng) and SV treated mice were used. On day 7, plasma, spleen and mediastinal LN were collected from each mice. Statistical significance was determined with the Kruskal-Wallis test followed by the he Dunns’ test or Mann-Whitney test. Results are representatives of at least two independent experiments. [000127] FIG. 4A-4B. SV infectivity of MyC-CaP.Fluc tumors. MyC-CaP.Fluc and CT.26.Fluc cells were challenged with serially diluted single round replication SV.GFP 107-10 *) and incubated overnight. 16 hours post infection the percentage of GFP-positive cells was analyzed by flow cytometer for each dilution. FIG. 4A depicts representative flow cytometry plots of GFP positive MyC-CaP.Fluc and CT.26.Fluc cells per dilution and uninfected controls are shown. FIG. 4B depicts plotted infectivity curve of GFP-positive cells. [000128] FIG. 5A-5E. SV.IL12 in combination with anti-OX40 antibody cures established tumors in vivo. FIG. 5A depicts the experimental protocol for the prostate and colon cancer model. FVB / NJ or BALB / c mice were given an i.p. injection of SV.IL12 and / or anti-OX40 at various times after injection of 10° MyC-CaP Fluc or 7 x 10* CT26.Fluc cells on day 0, respectively. FIG. 5B depicts CT26.Fluc tumor growth curves shown as fold changes relative to the luminescence on day 0 of the same mouse. Each line represents an individual mouse. Left graphs: control (n = 14) (top) and SV.IL12 (n = 20) (bottom). Right graphs: anti- 0X40 (n= 10) (top) and SV.IL12+anti-OX40 (n = 11) (bottom). FIG. 5C depicts the representative bioluminescence images of control and treated CT26.Fluc-bearing mice. FIG. SD depicts survival plots of control and treated mice bearing peritoneally disseminated CT26.Fluc tumors. FIG. SE depicts survival plots of control and treated mice bearing peritoneally disseminated MyC-CaP.Fluc tumors. Statistical significances between SV.IL12+anti-OX40 and anti-OX40 or SV.IL12 were determined with the Mantel-Cox test. Results are representatives of at least two independent experiments. [000129] FIG. 6A-6B. Tumor growth of MyC-CaP.Fluc tumor bearing mice during treatment. FVB / NJ mice were given injection of SV.IL12 and / or anti-OX40 intraperitoneally (i.p.) at various times after injection of 10° MyC-CaP.Fluc cells on day 0. FIG. 6A depicts tumor growth curves are shown as fold changes relative to the luminescence on day 0 of the same mouse. Each line represents an individual mouse. Left graphs: Control (n=10) (top) and SV.IL12 (n=10) (bottom). Right graphs: aOX40 (n=10) (top) and SV.IL12+a0X40 (n=10) (bottom). FIG. 6B depicts representative bioluminescence images of control and treated CT.26.Fluc bearing mice. Results are representatives of at least two independent experiments. [000130] FIG. 7A-7D. The therapeutic efficacy of SV.IL12 in combination with anti- 0X40 is maintained at reduced treatment regimen in CT26.Fluc bearing mice. FIG. 7A depicts the treatment schema. BALB / c mice were given i.p. injection of SV.IL12 (day 1 and 8) and / or anti-OX40 (day 2 and 9) of 7 x 10* CT26 Fluc on day 0. FIG. 7B depicts representative bioluminescence images of control and treated CT26.Fluc bearing mice. FIG. 7C depicts tumor growth curves are shown as fold changes relative to the luminescence on day 0 of the same mouse. Each line represents an individual mouse. Left graphs: Control (n=14) (top) and SV.IL12 (n=15) (bottom). Right graphs: aOX40 (n=17) (top) and SV.IL12+a0X40 (n=15) (bottom). FIG. 7D depicts survival plots of control and treated mice bearing CT26.Fluc tumors. Statistical significance between SV.IL12+a0X40 and SV.IL12 was determined with the Mantel-Cox test. Results are representatives of at least two independent experiments. [000131] FIG. 8A-8B. Therapeutic efficacy of SV.IL12 in combination with anti-OX40 is dependent on CD4 and CD8 T cells. FIG. 8A depicts that mice injected with anti-CD4 (0.4 mg) or anti-CD8 (0.1 mg) depleting antibody. As a control, rat IgG2b (0.4 mg) isotype control was used. The frequency of CD4 and CD8 T cells were assessed by flow cytometry in splenocytes after 24, 48, 72 and 96 hours. FIG. 8B depicts that BALB / c mice were inoculated with 7 x 10* CT.26.Fluc on day -4. Depletion antibody anti-CD4 or anti-CD8 were injected i.p. onday-3, 1, 5,9, 13 and 17. Mice were left untreated (control) or were treated with SV.IL12 and anti-OX40 on day 4 and 11. Tumor growth curves are shown as fold changes relative to the luminescence on day 0 of the same mouse. Each line represents an individual mouse. [000132] FIG. 9A-91. Combination therapy markedly changes the transcriptome signature of T cells favoring effector T cells with a Th1 type phenotype. FIGs. 9A-9I depict RNA sequencing of T cells isolated from spleens derived from untreated tumor bearing mice (control) compared with mice treated with SV.IL12 and / or anti-OX40 on day 7. FIG. 9A depicts principal component analysis (PCA) of normalized read counts from the CT26.Fluc tumor model. FIG. 9B depicts PCA of normalized read counts from the MyC-CaP.Fluc tumor model. FIG. 9C depicts MA plots of differentially expressed genes (DEG; >2-fold) in T cells of control versus anti-OX40 treated mice (top graph), SV.IL12 treated mice (middle graph) or SV.IL12+anti-OX40 treated mice (bottom graph) in the CT.26 model. Significantly (p<0.05) upregulated and downregulated DEG are depicted in red or blue, respectively. FIG. 9D depicts Pathway and network analysis based on DEG in T cells isolated from CT26.Fluc-bearing mice treated with combination therapy. Downregulated (blue) and upregulated (red) pathways are shown, respectively. FIG. 9E depicts Heatmap analysis of selected genes based on normalized read counts linked to T cell differentiation and activation as well as T cell lineage transcription factors. FIGs. 9F-I depict data from tumor bearing mice that were treated with SV.IL12 and / or anti-OX40. As control, naive and untreated (control) tumor bearing mice were used. On day 7, spleens were excised and a single cell suspension was stained and analyzed by flow cytometry. FIG. 9F depicts percentage of CD44 or Ki-67 expression by T cells from the CT26.Fluc tumor model. FIG. 9G depicts percentage of CD44 or Ki-67 expression by T cells from the MyC- CaP.Fluc tumor model. FIG. 9H depicts the percentage of ICOS and T-bet expression by CD4 T cells. FIG. 91 depicts representative flow cytometry plots ICOS and T-bet expression by CD4 T cells. Bars represent means and each symbol represent an individual mouse. Statistical significance was determined with the Kruskal-Wallis test followed by the Dunns’ test. Results are representatives of at least two independent experiments. [000133] FIG. 10A-10B. Combination therapy induces systemic CD4 and CD8 T cell activation. Tumor bearing mice were left untreated or treated with SV.IL12 and / or anti-OX40. On day 7, spleens were excised and a single cell suspension was stained and analyzed by flow cytometry. As control, naive and untreated (control) tumor bearing mice were used. FIGs. 10A and 10B depict representative flow cytometry plots of CD44 and Ki-67 expression on CD4 and CD8 T cells in the CT.26.Fluc and MyC-CaP.Fluc tumor model, respectively. [000134] FIG. 11A-11G. SV.IL12 in combination with anti-OX40 promotes metabolic reprogramming of T cells. Tumor bearing mice were left untreated or treated with SV.IL12 and / or anti-OX40. T cells were isolated from spleens on day 7 or otherwise indicated. FIG. 11A depicts selected gene set enrichment analysis (GSEA) of oxidative phosphorylation and glycolysis pathways based on DEG in control versus SV+anti-OX40. FIG. 11B depicts mitochondrial respiration assessed by measuring the median values of oxygen consumption rates (OCR) in T cells of indicated groups using an extracellular flux analyzer. Oligomycin, FCCP, Antimycin A and Rotenone were injected as indicated to identify energetic mitochondrial phenotypes. FIG. 11C depicts Mitotracker Green FM staining of T cells from indicated groups using flow cytometry. FIG. 11D depicts Mitotracker Deep Red FM staining of T cells from indicated groups using flow cytometry. FIG. 11E depicts western blot of c-Myc protein expression in T cells of control or mice treated with anti-OX40, SV.IL12 or SV.IL12+anti- 0X40. GAPDH (bottom) is loading control. FIG. 11F depicts baseline extracellular acidification rates (ECAR) in T cells of indicated groups derived from the CT26.Fluc and MyC-CaP.Fluc tumor models. FIG. 11G depicts energy profile (OCR versus ECAR) of T cells from naive or CT26.Fluc bearing mice treated with SV.IL12+anti-OX40 on day 7, 14 and 40. Error bars indicate SEM. Results are representatives of at least two independent experiments in FIGs. 11B- G. [000135] FIG. 12A-12D. Combination therapy rewires T cells metabolically. FIGs. 12A and 12B depict the metabolic activity of T cells isolated from spleens of mice bearing CT.26.Fluc or MyC-CaP.Fluc tumor respectively, on day 7. Baseline OCR (left) and respiratory capacity (right) was measured in T cells of indicated groups using an extracellular flux analyzer. FIG. 12C depicts representative flow cytometry plots of Mitotracker Green FM and Mitotracker Deep Red staining in CD4 and CD8 T cells isolated from spleens of CT26.Fluc tumor bearing mice. FIG. 12D depicts energy profile (OCR versus ECAR) of T cells from naive (bottom graph) or CT26.Fluc bearing mice treated with SV.IL12+anti-OX40 (top graph) on day 7, 14 and 30. Data represent the mean of three different experiments. Bars represent means + SEM (A, B, D). Results are representatives of at least two independent experiments. [000136] FIG. 13A-13G. Reprogrammed T cells in SV+anti-OX40 treated mice display enhanced CD4 mediated cytokine production and anti-tumor activity. Tumor bearing mice were left untreated or treated with SV.IL12 and / or anti-OX40. Spleens were excised on day 7 for further analysis. FIG. 13A depicts Heatmap analysis of selected genes based on normalized read counts linked to cytokine expression and enhanced anti-tumor activity. FIG. 13B depicts RNA sequencing performed on isolated T cells from CT26.Fluc tumor-bearing mice. FIG. 13C depicts Interferon-gamma (IFN-y enzyme-linked immunospot analysis of splenocytes from control and treated mice as indicated (n=5-10 mice per group). Additionally, [FN-y enzyme-linked immunospot analysis was measured in splenocytes depleted of CD4 or CD8 T cells in the CT26.Fluc (Top) and MyC-CaP .Fluc (Bottom) tumor models. FIG. 13D depicts representative flow cytometry plots of T-bet and granzyme B (GrB) expression by CD4 T cells from indicated groups using flow cytometry. FIG. 13E depicts Percentage of T-bet and granzyme B (GrB) expression by CD4 T cells from indicated groups using flow cytometry of FIG. 13D. FIG. 13F depict cytotoxic activity of T cells from control and treated mice (n=5-10 mice per group) co- cultured at an effector-to-target cell ratio of 10:1 with either CT26. FLUC. FIG. 13G depicts MyC-CaP.Fluc tumor cell lines for 2 days. Additionally, T cells were depleted of CD4 or CD8 T cells and co-cultured as previously described. Cytotoxic activity was assessed based on viability of tumor cells, which was determined by measuring the luciferase activity and is shown relative to naive T cells. Bars represent means + SEM in FIGs. 13B, 13F and 13G, and each symbol represent an individual mouse in FIG. 13E. Statistical significance was determined with the Kruskal-Wallis test followed by the he Dunns’ test. Results are representatives of at least two independent experiments. [000137] FIG. 14A-14F. CD8 T cells show enhanced cytotoxic potential in mice treated with SV.IL12 and anti-OX40. Tumor bearing mice were left untreated or were treated with SV.IL12 with or without anti-OX40. Mice were sacrificed on day 7 to analyze the T cell immune response in spleen. FIGs. 14A-14B depict percentage of granzyme B and T-bet expression, by CD8 T cells from CT26.Fluc tumor bearing mice. FIGs. 14C-14D depict percentage of granzyme B and T-bet expression, respectively by CD8 T cells from MyC-CaP.Fluc tumor bearing mice. FIG. 14B and 14D depict representative flow cytometry plots. FIGs. 14E and 14F depict percentage of NKG2D (left graph) or T-bet (right graph) expression by CD8 T cells in the mice bearing CT26.Fluc and MyC-CaP.Fluc tumor, respectively. Bars represent means and each symbol represent an individual mouse. Statistical significance was determined with the Kruskal- Wallis test followed by the he Dunns’ test. Results are representatives of at least two independent experiments, [000138] FIG. 15A-15F. Mice treated with SV.IL12 in combination with anti-OX40 display enhanced T cell migration and intratumoral T cell activity. CT26.Fluc bearing mice were left untreated or were treated with SV.IL12 and / or anti-OX40. On day 7, spleens were excised and a single cell suspension was stained and analyzed by flow cytometry. FIG. 15A depicts percentage of CXCR3 expression by CD4 (left graph) and CDS8 (right graph) T cells. FIG. 15 B depicts representative flow cytometry plots. Tumors were harvested after 2 weeks of treatment from control and treated mice. FIG. 15C depicts intratumoral gene expression of CXCL9 (Top) and CXCL10 (bottom) analyzed by real time PCR. Data are normalized to GAPDH. FIG. 15D depicts intratumoral T cell immune responses from indicated groups that were assessed by flow cytometry. Percentage of CD4 expression by T cells (left graph), Ki-67 expression (middle graph) and granzyme B expression (right graph) by CD4 T cells. FIG. 15E depicts multiplex immunofluorescence staining of tumors isolated from CT26.Fluc tumor bearing mice. FIG. 15F depicts multiplex immunofluorescence staining of tumors isolated from MyC-CaP.Fluc tumor bearing mice. Representative images of T cell infiltration are shown for control as well as anti-OX40, SV.IL12 and SV.IL12+ anti-OX40. Proteins of interest were stained and are indicated by color in each image: K-i67 (red), CD3 (green), CD8 (magenta) and DAPI nuclear staining appears in blue. Bars represent means + SEM in FIG. 15C, and each symbol represent an individual mouse in FIG. 15A and 15D). Statistical significance was determined with the Kruskal-Wallis test followed by the Dunns’ test. Results are representatives of at least two independent experiments [000139] FIG. 16A-16D. T cells show enhanced migration into tumors and exert anti- tumor activity in mice treated with SV.IL12+anti-OX40. Tumor bearing mice were left untreated or were treated with SV.IL12 with or without anti-OX40. Mice were sacrificed on day 7 and 14 to analyze the T cell immune response in spleen. FIG. 16A-16C depict percentage of CXCR3 expression by CD4 (left graph) and CD8 (right graph) T cells measured by flow cytometry in the CT26.Fluc tumor model on day 14, in the MyC-CaP.Fluc tumor model on day 7 (B) and in the MyC-CaP.Fluc tumor model on day 14, respectively. FIG. 16D depicts percentage of CD8 expression by T cells (left graph), Ki-67 expression (middle graph) and granzyme B expression (right graph) by CD8 T cells. Tumors were harvested after 2 weeks of treatment from control and treated mice. T cell immune responses from indicated groups were assessed by flow cytometry. Bars represent means and each symbol represent an individual mouse. Statistical significance was determined with the Kruskal-Wallis test followed by the he Dunns’ test. Results are representatives of at least two independent experiments. [000140] FIG. 17. Combination therapy stimulates granzyme B expression in MyC- CaP.Fluc tumors. FIG. 17 depicts tumors stained by multiplex immunofluorescence. MyC- CaP Fluc tumors were harvested after 2 weeks of treatment from control and treated mice. Representative images are shown for untreated (control), anti-OX40, SV.IL12 and SV.IL12+anti-OX40 treated mice. Proteins of interest were stained and are indicated by color in each image: F4 / 80 (red) and granzyme B (green). DAPI nuclear staining appears in blue. [000141] FIG. 18A-18B. SV.IL12 triggers innate immune response and induces iNOS expression in MyC-CaP.Fluc tumors. MyC-CaP.Fluc tumors in FIG. 18A and CT26.Fluc tumors in FIG. 18B, were harvested after 2 weeks of treatment from control and treated mice. Tumors were stained by multiplex immunofluorescence. Representative images are shown for untreated (control), anti-OX40, SV.IL12 and SV.IL12+anti-OX40 treated mice. Proteins of interest were stained and are indicated by color in each image: iNOS (Cyan), Arginase 1 (green), and CD11b (magenta). DAPI nuclear staining appears in blue. [000142] FIG. 19. Treatment schema of C57 / BI6 (female) mice re-injected with Alm5- 2Fluc-17 tumor. Alm5-2Fluc-17 tumor reinjection was done from 9 C57 / B16 mice in 80 mice (16 cages) on day 0. Treatment started on day 9 after cells implantation. Antibodies (250ug / dose) treatment (blue dots) was done 3 times / week for 3 weeks starting at day 10 after cells re-injected. Sindbis Vector was administered 4 days / week for 4 weeks (red dots) starting day 9 after cells (mornings). IVIS imaging was done on indicated days after tumor implantation. [000143] FIG. 20. Combination of IL-12 and anti-OX40 expressed by Sindbis viral vectors synergistically enhances survival of subjects with established tumors. FIG. 20. depicts Percentage survival rate of C57 / BI6 (female) mice re-injected with Alm5-2Fluc-17 tumor and treated with SV.IL12 vector; SV.IL-12 vector and anti-OX40 IgG; RepOX40IgG_Rep-IL12 (fragmented SV expressing OX-40 IgG and fragmented SV expressing IL-12, 50% mix of both vectors) or RepOX40IgG_SV-IL12 (fragmented SV expressing OX-40 IgG and full length SV expressing IL-12, 50% mix of both vectors), with n=5 mice in each treatment group. Untreated mice were used as a control. The mice were re-injected with tumor cells and treated according to the scheme in FIG. 19. [000144] FIG. 21A-21C. A20 lymphoma cells were SV infection resistant. FIG. 21A depicts A20 cells and BHK cells were infected with SV carrying GFP overnight. GFP expression was observed under fluorescent microscope. FIG. 21B depicts SV-GFP infectivity to BHK cells was verified by flow cytometry. FIG. 21C depicts SV-GFP infectivity to A20 cells in vivo were measured by flow cytometry. 107 A20 cells (express CD45.2) were inoculated to CByJ. STL(B6)- Ptprca / J (CD45.1 BALB / C) mice. Recipient mice were treated with SV-GFP 4 days later. GFP expression was measured the next day. [000145] FIG. 22A-22C. Sindbis virus (SV) and a4-1BB combination completely cured BALB / C mice A20 lymphoma. FIG. 21A depicts representative bioluminescence images of groups as indicated. Intensity scale, day 0, 7, 21, min: 400, max: 7000; day 14, min: 100, max: 1000; day 28, min: 3000, max: 50000. FIG. 2B depicts tumor growth measured by relative firefly luciferase (fLuc) activity (normalized to day O fLuc activity). Untreated, n= 16; SV, n= 18; o4- 1BB Ab, n= 13; SV plus a4-1BB Ab, n = 13. FIG. 2C depicts survival curve of all groups (the ratio is shown as survived number / total number). [000146] FIG. 23A-23E. SV alone and SV plus a4-1BB mAb stimulated cell cycle progression, cytokine production, and activation. FIG. 23A depicts the numbers of significant differential (SD) expressed genes (upregulated and downregulated) of SV vs. untreated are as indicated. SD expressed genes were selected based on Deseq2 analysis (q < 0.05), [Log2FC| > 1. FIG. 23B depicts the enrichment scores for gene cluster of cell cycle for SV vs. untreated, SV+ 04-1BB vs. untreated and SV+ 04-1BB vs. SV respectively (“cell cycle” is the gene cluster with the highest enrichment score for these 3 comparisons). FIG. 23C depicts the heat map representing SD expressed cytokine and chemokine genes (left, SV vs. untreated; right, SV+ a4- 1BB vs.04-1BB, Log2FC > 1). Expression values are shown by Z-score. Genes are hierarchically clustered by one minus Pearson correlation. Red arrow, Ccl8, IL4, IL13 and IL21 expression. FIG. 23D depicts the percentage of CD69+ T cells from all groups on day 2 after starting treatment was measured by flow cytometry. FIG. 23E depicts GSEA enrichment plot of KEGG (SV + 04-1BB vs. untreated) TCR receptor signaling pathway. *, p <0.05; **, p< 0.01, *** p< 0.001. [000147] FIG. 24A-24C. SV infection enhanced cell cycle progression and migration. FIG.24A depicts DAVID KEGG analysis. FIG. 24B depicts GSEA enrichment plot of KEGG (SV vs. Untreated) cell cycle pathway (SV vs. Untreated). FIG. 24C depicts cell movement pathway was significantly enhanced by IPA (SV vs. Untreated). [000148] FIG. 25A-25B. Significant differential (SD) upregulated genes are clustered by DAVID analysis. FIG. 25A depicts enrichment score of gene clusters for SV+ a 4-1BB vs Untreated. FIG. 25B depicts enrichment score of gene clusters for SV+ a 4-1BB vs SV. [000149] FIG. 26A-26D. Untreated group had low ratio of T cells and high ratio of regulatory T cells on day 28. FIGs. 26A-26C depict the frequency of CD4, CDS, and Treg respectively measured by flow cytometry. FIG. 26D depicts the Treg / CD8 ratio as indicated. [000150] FIG. 27A-27D. Sindbis virus plus a4-1BB combination induced higher cytotoxicity. FIG. 27A depicts splenocytes mixed with fLuc-A20 lymphoma cells according to the ratio as indicated (splenocytes: lymphoma cells). Cytotoxicity corresponds to the reduction of normalized Luc activity (fLuc activity of A20 lymphoma cells only is normalized to 1). SV + tumor, 04-1BB + tumor, SV+ a4-1BB + tumor: tumor inoculated mice. SV, 04-1BB, SV+ 04- 1BB: mice without tumor inoculation. FIG. 27B depicts splenocytes harvested from all groups after 7 days treatment. The percentage of NKG2D+ cells was measured by flow cytometry (CD8 T cell gated). FIG. 27C depicts the percentage of granzyme B+ and perforin+ cells was measured by flow cytometry (CD8 T cell gated). FIG. 27D depicts cytotoxicity associated genes upregulated in SV + 04-1BB treated group. The heat map depicts the relative expression level of cytotoxicity associated genes. Expression values are shown by Z-score. Genes are hierarchically clustered by one minus Pearson correlation (day 7). Red square, granzyme b and perforin expression. Red arrow, Ifng and Stat4 expression. **, p < 0.01; **** p < 0.0001. [000151] FIG. 28A-28F. Sindbis virus plus a4-1BB combination induced Th1 differentiation and IFNy production. FIG. 28A depicts IFNy Elispot analysis of splenocytes harvested at day 2, 7, 14 and 28 from all groups as indicated. Upper panel, IFNy Elispot image on day 7 after treatment. 1, 2, 3: three individual mice. Lower panel, IFNy spots number from indicated groups over the course of treatment (2 x 10° splenocytes per well). No stimulator was added. FIG. 28B depicts IFNy production from CD4 / CD8 T cell population in splenocytes and purified CD4 / CD8 T cells. All groups were cultured in media for 5 h in the presence of brefeldin A. FIG. 28C depicts IFNy production from purified CD4 T cells at different stimulation conditions. FIG. 28D depicts upregulated Th1 pathway gene set under SV, a4-1BB and SV + a4- 1BB stimulation. Expression values are shown by Z-score. Genes are hierarchically clustered by one minus Pearson correlation (day 7). FIG. 28E depicts T-bet expression for all groups as indicated. FIG. 28F depicts EOMES expression for all groups as indicated. CD8 T cell gated. FIGs. 28E and 28F, day 7 after treatment. *, p < 0.05; **, p < 0.01, **** p <0.0001. [000152] FIG. 29 depicts IFNy production from splenocytes of all groups with or without tumor inoculation on day 7 after treatment was measured by Elispot. With tumor: tumor was inoculated on day 0. Without tumor: tumor was not inoculated. No stimulator was added in Elispot assay. [000153] FIG. 30A-30B. IFNy production measurement. FIG. 30A, IFNy production (at day 7) by all groups, as indicated, was measured by Elispot. FIG. 30B, IFNy production of purified T cells (CD8 T cell portion) on day 7 after treatment was measured by flow cytometry. [000154] FIG. 31A-311L SV and a4-1BB mAb stimulated chemotaxis, adhesion and enhanced T cell infirtration and activation in tumor. FIG. 31A depicts heat map of the expression pattern of SV + a4-1BB upregulated chemokine and chemokine receptor genes (Expression values are shown by Z-score.) Genes are hierarchically clustered by one minus Pearson correlation (day 7). FIG. 31B depicts the percentage of CCR5+ cells was measured by flow cytometry (day 7). FIGs. 31C and 31D depict the percentage of CD11a+ and ICAM-1+ cells, respectively measured by flow cytometry. FIG. 31E depicts the relative expression of CD11a (ltgal) and ICAM-1 was shown by heat map measured by RNA-Seq. Expression values are shown by Z score. FIG. 31F depicts the percentage of 0X40+ and ICOS+ T cells were measured by flow cytometry. *, p < 0.05; **, p <0.01; ***, p <0.001; **** p <0.0001. FIG. 31G depicts the frequency of CD3 and CD8 T cells to total harvested cells from tumor measured by flow cytometry. FIG. 31H depicts the CD8 / Treg ratio of tumor infiltrated T cells. FIG. 311 depicts the percentage of granzyme B+ CD8 T cells as indicated. *, p <0.05; **, p <0.01; ***, p < 0.001; **** p< 0.0001. [000155] FIG. 32A-32E. The phenotype of tumor infiltrated T cells. FIGs. 32A-32E depict the percentage of Ki67+, Foxp3+, T-bet+, EOMES+, NKG2D+ T cells respectively, measured by flow cytometry. [000156] FIG. 33A-33C. Sindbis virus plus a4-1BB synergistically enhanced T cell glycolysis and oxidative phosphorylation. FIG. 33A depicts GSEA enrichment plot of KEGG (SV + 04-1BB vs. untreated) glycolysis pathway. FIG. 33B depicts the canonical pathways of SV plus a4-1BB Ab stimulation clustered by IPA. Red square, oxidative phosphorylation. FIG. 33C depicts both oxygen consumption rate (oxidative phosphorylation) and Extracellular Acidification Rate (glycolysis) measured by seahorse XFe24. All groups are as indicated (n= 4). [000157] FIG. 34A-34B. SV plus low dose a4-1BB mAb cured A20 tumor bearing mice. FIG. 34A depicts Bioluminescence images of mice showing tumor load in A20 tumor bearing mice treated with SV plus low dose 04-1BB mAb, as compared to control (untreated) and SV alone. FIG. 34B depicts tumor growth (Relative Luciferase activity) in each treatment group as indicated. Each line is a single mice. [000158] FIG. 35A-35D. Cured mice are completely protected from A20 lymphoma re- challenge. FIG. 35A depicts Bioluminescence images of groups, previously treated as indicated, were re-challenged with A20 lymphoma cells. FIG. 35B depicts IFNy production from purified T cells of all groups(To SV + a4-1BB, 4 months after treatment finished), in the absence or presence of A20 tumor cells (5 x 104 per well), was measured by Elispot assay. FIG. 35C depicts cytotoxicity assay was performed the same as FIG. 27A. Left 2 panels, total splenocytes were used. Right, purified T cells were used. Left upper, A20 Fluc cells and left lower, CT26 Fluc cells were used for co-culture. FIG. 35D depicts significant differential (SD) upregulated gene sets are clustered by DAVID KEGG analysis. *, p <0.05; **, p < 0.01; **** p< 0.0001 [000159] FIG. 36. Combination of NY-ESO-1 and IL-12 expressed by separate Sindbis viral vectors synergistically enhances survival of subjects with established tumors. FIG. 36 depicts the percentage survival rate of C57 / BI6 (albino-female) mice re-injected with AlmS5- 2Fluc-17 tumor cells and treated with SV-IL-12, SV-NY-ESO-1 or a 50% mixture of both the vectors in one injection, SV-IL-12 and SV-NY-ESO-1, as indicated. Untreated mice were used as control. A total of n=5 mice in each group were tested for percentage survival days after tumor transplantation [000160] FIG. 37. Combination of NY-ESO-1 and IL-12 expressed by the same Sindbis viral vectors synergistically enhances survival of subjects with established tumors. FIG. 37 depicts the percentage survival rate of C57 / BI6 (albino-female) mice re-injected with Alm5- 2Fluc-17 tumor cells and treated with SV-IL-12, SV-NY-ESO-1 or a Sindbis viral vector expressing both IL-12 and NY-ESO-1 (SV-NYESO-SGP2-IL12), as indicated. Untreated mice were used as control. A total of n=5 mice in each group were tested for percentage survival days after tumor transplantation. [000161] FIG. 38. pSP6-R_IL12 Sindbis replicon vector expressing IL12 a and b subunits. FIG. 38 depicts plasmid map with SP6, promoter for in vitro transcription; Replicase, SV RNA polymerase; Psg, subgenomic promoter for IL12 expression; linker, joins IL12 a and b subunits; AmpR, ampicillin resistance gene. Numbers show nucleotide positions of genes in the replicon plasmid. [000162] FIG. 39. Sindbis Repicon vector expressing full length antibody to 0X40 IgG2a. FIG. 39 depicts plasmid map with T7 promoter for in vitro transcription; Replicase, SV RNA polymerase; Psg subgenomic promoter for expression of anti-OX40 heavy chain IgG2a; 2Psg, second subgenomic promoter for expression of light chain anti-OX40. AmpR, ampicillin resistance gene; ColE1, plasmid origin of replication. Numbers show nucleotide positions of genes in the replicon plasmid. [000163] FIG. 40. Sindbis replicon vector expressing single chain antibody to 0X40. FIG. 40 depicts plasmid map with T7, promoter for in vitro transcription; Replicase, SV RNA polymerase; Psg, subgenomic SV promoter; IL12 signal peptide, signal peptide fused to the sequence encoding anti-OX40 single chain antibody; AmpR, ampicillin resistance gene; ColE1, plasmid origin of replication. Numbers show nucleotide positions of genes in the replicon plasmid. [000164] FIG. 41. Sindbis Replicon Vector expressing NY-ESO-1. FIG. 41 depicts plasmid map with T7, promoter for in vitro transcription; Replicase, SV RNA polymerase ; Psg, subgenomic promoter for transcription; Hu NY-ESO-1, coding sequence for human NY-ESO-1 tumor associated antigen, Poly A, poly A tail transcribed onto NY-ESO mRNA; AmpR, ampicillin resistant gene; ColE, plasmid origin of replication. Numbers show nucleotide positions of genes in the replicon plasmid. [000165] FIG. 42. pT7StulR1-FcOX40L_T2A_NY-ESOL. Sindbis replicon vector expressing the 0X40 Ligand fused with the Fc receptor sequence and NY-ESO-1. FIG. 42 depicts plasmid map with T7, promoter for in vitro transcription; Replicase, SV RNA polymerase; Psg, subgenomic SV promoter; FcOX40L coding sequence; T2A, termination peptide sequence; NY-ESO-1, coding sequence; AmpR, ampicillin resistance; ColE1, plasmid origin of replication. Numbers show nucleotide positions of genes in the replicon plasmid. DETAILED DESCRIPTION OF THE INVENTION [000166] Oncolytic virus (OV) therapy has become a novel immunotherapeutic approach to treat cancer. A rationale for oncolytic virus is that they can infect and lyse the tumor cell. They have been made to selectively replicate in tumor cells either through the direction of tumor specific promoters or through direct intratumoral administration. Most OVs encounter a number of barriers to systemic administration. Once lysed by OVs, tumor cells release tumor associated antigens (TA As) that can stimulate cytotoxic T cells. OV infection also induces an inflammatory response that helps to trigger an immune anti-tumor response. Several OV clinical trials are underway and have shown promising results. However, whether OV therapy can effectively treat tumors that they are unable to infect remains an unresolved limitation. [000167] Sindbis virus (SV) belongs to alphavirus genus and is one type of OV. Alhough it does not lyse infected tumor cells, it can cause their apoptotic death. It offers several important benefits. SV is known as one of the least virulent alphaviruses with clinical signs and symptoms usually unapparent. It has been estimated that there are 17 times more subclinical than symptomatic SV infections. In general, when symptoms do occur in humans they consist of a self-limiting, mild, febrile disease with vesicular exanthema and arthralgia from which most patients recover within 14 days. The disease is in part self-limiting because SV is an RNA virus that does not integrate in the host genome and hence its presence is transitory. The lack of an integrative step in its replication cycle also avoids insertional mutagenesis risks. In addition, SV vectors of the present disclosure were generated from the laboratory strain AR339, which is not known to cause disease in humans. These vectors were further attenuated by rendering them replication-defective. [000168] SV vectors can target tumors systemically and can reach metastatic tumor cells throughout the body. They can target tumors without infecting normal tissues. However, susceptibility to infection by SV vectors depends on a number of factors including laminin receptor expression and distribution, as well as, defects in IFN signaling in tumors. The present disclosure demonstrates that SV vectors can effectively help cure tumors that they are unable to infect and further demonstrates that the combination antibodies and SV vectors provide a surprising synergistic therapeutic effect against cancer. [000169] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a oncolytic viral vector and (b) an antibody directed against a co-stimulatory molecule or a nucleic acid encoding same; or an antibody to an immunesystem agonist molecule or a nucleic acid encoding same. [000170] The oncolytic viral vector can be a Sindbis viral vector. The Sindbis viral vector can be replication defective. Sindbis viral vectors were produced as described in US Patent No. 8,093,021 (incorporated herein by reference in its entirety). The Sindbis viral vector can comprise at least one nucleic acid encoding a therapeutic protein. The Sindbis viral vector can comprise at least one nucleic acid encoding an immunostimulatory or an immunomodulatory protein. The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL-3, IL- 4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL- 22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The Sindbis viral vector can comprise at least one nucleic acid encoding LacZ, Flue or GFP. [000171] The antibody can be an anti-OX40 antibody, an anti-4-1BB antibody, an anti-CD28 antibody, an anti-GITR antibody, an anti-CD137 antibody, an anti-cd37 antibody, an anti-HVEM antibody, or a combination thereof. [000172] The Sindbis viral vector and the antibody can induce an immune response in a tumor associated antigen (TAA) nonspecific manner. The induced and nonspecific immune response can be a first immune response. The first immune response can be followed by a secondary immuneresponse. The secondary immune response can be the result of one or more TAAs released from the dead tumor cells. The secondary immune response can comprise memory T cells directed against one or more TAAs released from the dead tumor cells. [000173] The present disclosure also provides methods for treating cancer ina subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. [000174] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. [000175] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 8, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin- 12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2. [000176] The nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) comprises the nucleic acid sequence of SEQ ID NO: 1 shown in the following Table. The nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) 61 cccaaggtca gcgttccaac agectcaccee teggeatcca gecagetecte tcagtgecgg 121 tccagcatgt gtcaatcacg ctacctccte tttttggecca cecttgecct cctaaaccac 181 ctcagtttgg ccagggtcat tccagtctct ggacctgcca ggtgtcttag ccagtcccga 241 aacctgctga agaccacaga tgacatggtg aagacggcca gagaaaaact gaaacattat 301 tcctgcactg ctgaagacat cgatcatgaa gacatcacac gggaccaaac cagcacattg 361 aagacctgtt taccactgga actacacaag aacgagagtt gecctggetac tagagagact 421 tcttccacaa caagagggag ctgectgece ccacagaaga cgtctttgat gatgaccctg 481 tgccttggta gcatctatga ggacttgaag atgtaccaga cagagttcca ggccatcaac 541 gcagcacttc agaatcacaa ccatcagcag atcattctag acaagggcat gectggtggee 1 gcaagagaca cagtcctggg aaagtctgcc ggctatccag acaattataa aaatgtgtct 61 cccaaggtca gcgttccaac agectcacce tcggcatcca geagetecte tcagtgecgg 121 tccagcatgt gtcaatcacg ctacctcete tttttggcca ceccttgcect cctaaaccac 181 ctcagtttgg ccagggtcat tccagtctct ggacctgeca ggtgtcttag ccagtcecga 241 aacctgctga agaccacaga tgacatggtg aagacggcca gagaaaaact gaaacattat 301 tecctgeactg ctgaagacat cgatcatgaa gacatcacac gggaccaaac cagcacattg 361 aagacctgtt taccactgga actacacaag aacgagagtt gecctggctac tagagagact 421 tcttccacaa caagagggag ctgcctgcce ccacagaaga cgtctttgat gatgaccctg 481 tgccttggta gcatctatga ggacttgaag atgtaccaga cagagttcca ggccatcaac 541 gcagcacttc agaatcacaa ccatcagcag atcattctag acaagggcat gctggtggec 601 atcgatgagc tgatgcagtc tctgaatcat aatggcgaga ctctgcgcca gaaacctcct 721 agcacccgcg tcgtgaccat caacagggtg atgggctatc tgagctccge ctgaaagctc 781 aaggccctet gecacagege cctectcaca cagataggaa acaaagaaag attcataaga 841 gtcaggtggt cttggcctgg tgggcttaag ctecttcagg aatctgttet cccatcacat 901 ctcatctccc caaaggtggc acagctacct cagcatggtg ccctccatcg cttctctcat 961 attcactata caagttgttt gtaagttttc atcaaaatat tgttaagggg cgaagacgte 1021 ctcccctcaa tgtgttagca gaagagcaag aactgataag ctattgtttt tgtgccaaag 1081 tgtttatgaa aacactcagt caccccttat ttaaaaatat ttattgctat attttatact 1141 catgaaagta catgagccta tttatattta tttattttct atttattata atatttctta 1201 tcagatgaat ttgaaacatt ttgaaacata ccttattttg tggttctaat aaagtaatgt 661 gtgggagaag cagaccctta cagagtgaaa atgaagctct gecatcctgcet tcacgecttce 721 agcacccgcg tcgtgaccat caacagggtg atgggctatc tgagcetccge ctgaaagctc 781 aaggccctct gccacagege cctcctcaca cagataggaa acaaagaaag attcataaga 841 gtcaggtggt cttggcctgg tgggcttaag ctecttcagg aatctgttct cccatcacat 901 ctcatctcce caaaggtggc acagctacct cagcatggtg coctccatcg cttctctcat 961 attcactata caagttgttt gtaagttttc atcaaaatat tgttaagggg cgaagacgtc 1021 ctcccctcaa tgtgttagca gaagagcaag aactgataag ctattgtttt tgtgccaaag 1081 tgtttatgaa aacactcagt caccccttat ttaaaaatat ttattgctat attttatact 1141 catgaaagta catgagccta tttatattta tttattttet atttattata atatttctta 1201 tcagatgaat ttgaaacatt ttgaaacata ccttattttg tggttctaat aaagtaatgt 1261 tatca (SEQ ID NO:1) [000177] The nucleic acid encoding interleukin-12 beta subunit (IL-12 8, IL-12, p40 subunit) comprises the nucleic acid sequence of SEQ ID NO: 2 shown in the following Table. The nucleic acid encoding interleukin-12 beta subunit (IL-12 3, IL-12, p40 subunit) 61 ctggtttgcc atcgttttgc tggtgtctcc actcatggec atgtgggage tggagaaaga 121 cgtttatgtt gtagaggtgg actggactcce cgatgeccct ggagaaacag tgaacctcac 181 ctgtgacacg cctgaagaag atgacatcac ctggacctca gaccagagac atggagtcat 241 aggctctgga aagaccctga ccatcactgt caaagagttt ctagatgctg gccagtacac 301 ctgccacaaa ggaggcgaga ctetgagceca ctcacatetg ctgetccaca agaaggaaaa 361 tggaatttgg tccactgaaa ttttaaaaaa tttcaaaaac aagactttcc tgaagtgtga 421 agcaccaaat tactccggac ggttcacgtg ctcatggetg gtgcaaagaa acatggactt 481 gaagttcaac atcaagagca gtagcagttc ccctgactct cgggcagtga catgtggaat 541 ggcgtctctg tctgcagaga aggtcacact ggaccaaagg gactatgaga agtattcagt 601 gtectgecag gaggatgtca cctgeccaac tgecgaggag accctgecca ttgaactgge 661 gttggaagca cggcagcaga ataaatatga gaactacagc accagcttct tcatcaggga 721 catcatcaaa ccagacccge ccaagaactt gcagatgaag cctttgaaga actcacaggt 781 ggaggtcagc tgggagtacc ctgactcctg gagcactccc cattcctact tctccctcaa 841 gttctttgtt cgaatccagc gcaagaaaga aaagatgaag gagacagagg aggggtgtaa 801 ccagaaaggt gcogtteocteg tagagaagac atctaccgaa gtccaatgea aaggegggaa 961 tgtctgcgtg caagctcagg atcgctatta caattcctca tgcagcaagt gggcatgtgt 1021 tcecctgecagyg gtccgatcoct aggatgcaac gttggaaagg aaagaaaagt ggaagacatt 1081 aaggaagaaa aatttaaact caggatggaa gagtccccca aaagctgtct tctgcottggt 1141 tggctttttc cagttttcct aagttcatca tgacaccttt gcoctgatttct acatgtaaat 1201 gttaaatgece cgcagagceca gggagctaat gtatgcatag atattctage attccacttg 1261 gccttatgct gttgaaatat ttaagtaatt tatgtattta ttaatttatt tctgcatttc 1321 acatttgtat accaagatgt attgaatatt tcatgtgetce gtggectgat ccactgggac 1381 caggccctat tatgcaaatt gtgagcttgt tatcttcttc aacagctctt caatcagggce 1441 tgcgtaggta cattagcttt tgtgacaacc aataagaaca taatattctg acacaagcag 1 gcacatcaga ccaggcagcet cgcagcaaag caagatgtgt cctcagaage taaccatcte 61 ctggtttgcc atcgttttge tggtgtctcc actcatggec atgtgggage tggagaaaga 21 cgtttatgtt gtagaggtgg actggactce cgatgcceect ggagaaacag tgaacctcac 81 ctgtgacacg cctgaagaag atgacatcac ctggacctca gaccagagac atggagtcat 41 aggctctgga aagaccctga ccatcactgt caaagagttt ctagatgetg gecagtacac 01 ctgccacaaa ggaggcgaga ctcotgageca ctcacatctg ctgctccaca agaaggaaaa 61 tggaatttgg tccactgaaa ttttaaaaaa tttcaaaaac aagactttcc tgaagtgtga 21 agcaccaaat tactccggac ggttcacgtg ctecatggetg gtgcaaagaa acatggactt 81 gaagttcaac atcaagagca gtagcagttc ccctgactct cgggcagtga catgtggaat 41 ggcgtctctyg tctgcagaga aggtcacact ggaccaaagg gactatgaga agtattcagt 01 gtcectgccag gaggatgtca cctgecccaac tgecgaggag accetgccca ttgaactgge 61 gttggaagca cggcagcaga ataaatatga gaactacagc accagcettct tcatcaggga 21 catcatcaaa ccagacccge ccaagaactt gecagatgaag cctttgaaga actcacaggt 81 ggaggtcagc tgggagtacc ctgactcctg gagcactcec cattcctact tctcectcaa 41 gttctttgtt cgaatccagc gcaagaaaga aaagatgaag gagacagagyg aggggtgtaa 01 ccagaaaggt gcgttecteg tagagaagac atctaccgaa gtccaatgeca aaggegggaa 61 tgtctgcgty caagctcagg atcgctatta caattcctca tgcagcaagt gggcatgtgt 21 tccectgcagg gtecgatect aggatgcaac gttggaaagg aaagaaaagt ggaagacatt 81 aaggaagaaa aatttaaact caggatggaa gagtccccca aaagcotgtct tcotgettggt 41 tggctttttc cagttttcct aagttcatca tgacaccttt gotgatttct acatgtaaat 01 gttaaatgce cgcagagcca gggagctaat gtatgcatag atattctage attccacttg 61 gccttatgct gttgaaatat ttaagtaatt tatgtattta ttaatttatt tctgeatttc 21 acatttgtat accaagatgt attgaatatt tcatgtgctc gtggecctgat ccactgggac 81 caggccctat tatgcaaatt gtgagettgt tatcttcttc aacagetctt caatcaggge 41 tgcgtaggta cattagettt tgtgacaacc aataagaaca taatattctg acacaagcag 1501 tgttacatat ttgtgaccag taaagacata ggtggtattt ggagacatga agaagctgta 1561 aagttgactc tgaagagttt agcactagtt tcaacaccaa gaaagacttt ttagaagtga 1621 tattgataag aaaccagggc cttctttaga agggtaccta aatttaaaag aattttgaaa 1681 ggctgggtat cggtggtata tgcttttaat tccagcactc aggagaccaa ggcaggcaga 1741 tctctgtgag tttgaggaca gcctggtgta cagagggagt tccagcacag ccagtgccac 1801 acagaaattc tgtctcaaaa acaattaaaa aaaaaaaaaa (SEQ ID NO: 2) : [000178] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4 [000179] The Sindbis viral vector can comprise the nucleic acid encoding the interleukin- 12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and a nucleic acid encoding the interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit comprises the amino acid sequence of SEQ ID NO: 3 shown in the following Table. The amino acid sequence of the interleukin-12 alpha subunit (SEQ ID NO: 3) 1 MCQSRYLLFL ATLALLNELS LARVIPVSGP ARCLSQSRNL LKTTDDMVKT AREKLKHYSC 61 TAEDIDHEDI TRDQTSTLKT CLPLELHKNE SCLATRETSS TTRGSCLPPQ KTSLMMTLCL 121 GSIYEDLKMY QTEFQAINAA LQNHNHQQII LDKGMLVAID ELMQSLNHNG ETLRQKPPVG 181 EADPYRVKMK LCILLHAFST RVVTINRVMG YLSSA (SEQ ID NO: 3) [000180] The amino acid sequence of the interleukin-12 beta subunit comprises the amino acid sequence of SEQ ID NO: 4 shown in the following Table. The amino acid sequence of the interleukin-12 beta subunit 1 MCPQKLTISW FAIVLLVSPL MAMWELEKDV YVVEVDWTPD APGETVNLTC DTPEEDDITW 61 TSDQRHGVIG SGKTLTITVK EFLDAGQYTC HKGGETLSHS HELLLHEKKENG IWSTEILKNF Ma AP LRMEV LE PELL LL LL VA So dUAD LLL dao L Ll Lois LoLLiiAnnane Se LDL Lats 121 KNKTFLKCEA PNYSGRFTCS WLVQRNMDLK FNIKSSSSSP DSRAVICGMA SLSAEKVTLD 181 QRDYEKYSVS CQEDVTCPTA EETLPIELAL EARQONKYEN YSTSFFIRDI IKPDPPKNLQ 241 MKPLKNSQVE VSWEYPDSWS TPHSYFSLKF FVRIQRKKEK MKETEEGCNQ KGAFLVEKTS 301 TEVQCKGGNV CVQAQDRYYN SSCSKWACVP CRVRS (SEQ ID NO:4) [000181] The Sindbis viral vector can comprise a nucleic acid encoding an interleukin-12 alpha subunit that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 3 and a nucleic acid encoding an interleukin-12 alpha subunit that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 4. [000182] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000183] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO:5 shown in the following Table. anti-OX40 variable heavy chain amino acid (mouse anti-OX40 variable heavy chain) 1 MAEVQLVESG GGLVQPGGSL RLSCAASGFT FSNYTMNWVR QAPGKGLEWV 51 SAISGSGGST YYADSVKGRF TISRDNSKNT LYLOMNSLRA EDTAVYYCAK Ma Paleo Ll Linde Viol LL0RUND INL LL Liane 101 DRYSQVHYAL DYWGQGTLVT V (SEQ ID NO: 5) [000184] The nucleic acid sequence encoding the anti-OX40 variable heavy chain comprises the nucleic acid sequence of SEQ ID NO:6 shown in the following Table. anti-OX40 variable heavy chain nucleic acid (mouse anti-OX40 variable heavy chain 5’ atggccgaggtgcagetggtggagageggeggeggectggtgecageceggeggcagectgaggetgagetgege cgccageggettecacctteageaactacaccatgaactgggtgaggcaggeccecggeaagggectggagtgggty agcgccatcagcggcagcggcggcagcacctactacgecgacagegtgaagggcaggttcaccatcagcagggaca acagcaagaacaccctgtacctgeagatgaacagectgagggecgaggacacegeegtgtactactgegecaagga caggtacagccaggtgcactacgccctggactactggggecagggcaccctggtgacegtg 37 (SEQ ID NO: 6) [000185] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO:7 shown in the following Table. anti-OX40 variable light chain amino acid (mouse anti-OX40 variable Tight chain) 1 DIQMTQSPDS LPVTPGEPAS ISCRSSQSLL HSNGYNYLDW YLQKAGQSPQ = Hiei DUD JE VIDIO LoS 51 LLIYLGSNR (SEQ ID NO: 7) [000186] The nucleic acid sequence encoding the anti-OX40 variable light chain comprises the nucleic acid sequence of SEQ ID NO:8 shown in the following Table. anti-OX40 variable light chain nucleic acid (mouse anti-OX40 variable light chain 57 gacatccagatgacccagtcccccgactocctgoccgtgaccoccggegagoccgactocatotectgecggte ctcecagteectgetgeactecaacggetacaactacctggactggtacetgecagaaggecggecagtecceecag ctgctgatctacctgggetcecaaccgggectecggegtgecegaceggtteteecggeteeggetecggeacegact tcaccctgaagatctcccgggtggaggecgaggacgtgggegtgtactactgecageagtactacaaccaccccac cacctteggecagggeaccaagetggagatcaagegg-3’ (SEQ ID NO: 8) [000187] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain of amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding an anti-OX40 variable light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding an anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7. [000188] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO:9 shown in the following Table. anti-OX40 antibody heavy chain amino acid sequence (mouse anti-OX40 IgG2a antibody heavy chain) MGQSRYLLELATLALLNHLS LAMAEVQLVESGGGLVQPGGSLRLSCAASGE TE SNY TMNWVRQAPGKGLEWVSALS GSGGSTYYADSVKGREFTISRDNSKNTLY LOMNSLRAEDTAVYYCAKDRY SQVHYALDYWGQGTLVTVAAKTTAPSV YPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLS SGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNV AHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVICVVVDVSEDDPDVQISW FUNNVEVHTAQTQTHREDYNSTLRVVSALPIQHEQDWMS GKEFKCKVNNKDLPAPTERT I SKPKGSVRAPQVYVLEP PEEEMTKKQVTLTCMVTDFMPEDI YVEWTNNGKTELNYKNTEPVLDSDGS YFMYSKLRVEKKNWVERNSYSCSVVH EGLHNHHTTKSFSRTPGK (SEQ ID NO:9) [000189] The nucleic acid sequence encoding the anti-OX40 antibody heavy chain comprises the nucleic acid sequence of SEQ ID NO:10 shown in the following Table. anti-OX40 antibody heavy chain nucleic acid sequence (mouse anti-OX40 IgG2a antibody heavy chain) 5’ gecaccatgggccagageaggtacctgetgttectggecacectggecctgetgaaccacctgagectggecat ggccgaggtgcagotggtggagageggeggeggectggtgecageccggeggcagactgaggotgagetgogecgec ageggetteacctteageaactacacecatgaactgggtgaggeaggececeggecaagggectggagtgggtgageg ccatecageggeageggeggcageacctactacgeegacagegtgaagggecaggtteaccateageagggacaacag caagaacaccctgtacctgcagatgaacagectgagggocgaggacaccgecgtgtactactgegecaaggacagg tacagccaggtgeactacgeectggactactggggecagggeacectggtgacegtggccgecaagaccacegece ccagegtgtacecectggecceegtgtgeggegacaccacceggeageagegtgacectgggetgectggtgaaggy ctacttccccgagecccgtgaccctgacctggaacageggcagectgagcageggegtgcacacctteccegecgty ctgcagagcgacctgtacaccctgagcagcagegtgaccgtgaccagcagcacctggeccagecagagcatcacct gcaacgtggcccaccecgecagcageaccaaggtggacaagaagatcgagoccaggggocteaccatcaageactg ceccecetgeaagtgecccgeccccaacctgetgggeggececagegtgttecatettecececcaagateaaggac gtgctgatgatcagectgagecceategtgacctgegtggtggtggacgtgagegaggacgacececegacgtgeaga tcagctggttcgtgaacaacgtggaggtgcacaccgeccagacccagacccacagggaggactacaacagcacect gagggtggtgagcgccctgeccatccagcaccaggactggatgageggcaaggagttcaagtgcaaggtgaacaac aaggacctgccegeccccatcgagaggaccatcageaageccaagggcagegtgagggcctoccaggtgtacgtge tgcccccccccgaggaggagatgaccaagaagcaggtgaccctgacctgecatggtgaccgacttcatgeccgagga catctacgtggagtggaccaacaacggcaagaccgagectgaactacaagaacaccgageccgtgetggacagegac ggcagctacttcatgtacagcaagctgagggtggagaagaagaactgggtggagaggaacagctacagetgecageg tggtgcacgagggcctgcacaaccaccacaccaccaagagcttcagcaggacccccggcaagtaa—3’ (SEQ ID NO:10) [000190] In SEQ ID NOs: 9 and 10, the underlined residues indicate IL-2 signal peptide; the Bold residues indicate variable antigen binding region; the non-underlined residues indicate mouse heavy chain IgG2a constant region, GB Accession BC080671; and the bold and underlined residues indicate the Hinge and disulfide bond region. The double underlined residue in SEQ ID NO: 9 indicates change from C to T to remove Apal site. The dotted underlined residues in SEQ ID NO: 9 indicate Kozak sequence. [000191] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID NO:11 shown in the following Table. anti-OX40 antibody light chain amino acid sequence (mouse anti-OX40 IgG2a antibody light chain MGQSRYLLFLATLALLNHLSLADIQMTQSPDSLPVTPGEPASISCRSSQSLLHSNGYNY LDWYLQOKAGQSPQLLIY LGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQYYNHPTTFGQGTKLEIKRADAAPTVSIFPPSSEQL TSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS TSPIVKSENRNEC (SEQ ID NO:11) [000192] The nucleic acid sequence encoding the mouse anti-OX40 antibody light chain comprises the nucleic acid sequence of SEQ ID NO:12 shown in the following Table. anti-OX40 antibody light chain nucleic acid sequence (mouse anti-OX40 IgG2a antibody light chain 57 gccaccatgggecagtcocggtacctgctgttactggocaccctggacotgctgaaccacctgtecctggacg acatccagatgacccagtcoccccgactocctgoccgtgaceeccggegagocegactacatotoctgecggtact ccecagtecctgetgeactecaacggetacaactacetggactggtacetgeagaaggeeggecagtecececage tgctgatctacctgggotccaaccgggecteeggegtgeccgaceggttetecggotecggotecggeacegact tecacectgaagatetecegggtggaggeegaggacgtgggegtgtactactgecageagtactacaaccacceca ccacctteggecagggeaccaagetggagatcaagegggecgacgecgeccecacegtgtecatetteceeeect cctecgageagetgaccteoggeggegecteogtggtgtgettectgaacaacttetaceccaaggacatcaacy tgaagtggaagatcgacggctccgageggeagaacggegtgotgaactoctggaccgaccaggactccaaggact ccacctactecatgtectecacectgacectgaccaaggacgagtacgageggeacaactectacacctgegagyg ccacccacaagacctccacctcccccatcgtgaagtccttcaaccggaacgagtgetaa—3’ (SEQ ID NO:12) [000193] In SEQ ID NOs: 11 and 12, the underlined residues indicate IL-2 signal peptide; the Bold residues indicate variable antigen binding region; the non-underlined residues indicate light constant region, GB Accession BC091750.1. The dotted underlined residues in SEQ ID NO: 12 indicate Kozak sequence. [000194] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000195] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000196] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO:13 shown in the following Table. amino acid sequence of the Target antigen (Target Antigen: 0X40 / CD134, Receptor for TNFSF4 / 0X40L / GP34) 1 MCVGARRLGR GPCAALLLLG LGLSTVTGLH CVGDTYPSND RCCHECRPGN 51 GMVSRCSRSQ NTVCRPCGPG FYNDVVSSKP CKPCTWCNLR SGSERKQLCT Ji doilVioiuotialy WNiVi.nliviolio DINLUNVOOND LRIGLWLNLN Oizo liv 101 ATQDTVCRCR AGTQPLDSYK PGVDCAPCPP GHFSPGDNQA CKPWTINCTLA 151 GKHTLQPASN SSDAICEDRD PPATQPQETQ GPPARPITVQ PTEAWPRTSQ 201 GPSTRPVEVP GGRAVAAILG LGLVLGLLGP LAILLALYLL RRDQRLPPDA 251 HKPPGGGSFR TPIQEEQADA HSTLAKI (SEQ ID NO: 13) [000197] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31 shown in the following Table. Human anti-OX40 antibody, 1-12Z5 (ATCC No. PTA-7216) Heavy chain variable region amino acid sequence. Leader sequence in bold. “ MTMITPSLVP SSDPLVTAAS VLEFALLIRL TIGOAVVSTQ STGGGLVOPG RSLRLSCAAS 61 GFTLDDYGMH WVRQAPGKGL EWVSGISWNS DSIGYVDSVK GRFTISRDNA KNSLYLQMNS 121 LRVEDTALYY CVKDISGWYS FDYWGQGTLV TVSS (SEQ ID NO: 31) [000198] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 32 shown in the following Table. Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Heavy chain variable region nucleic acid sequence 5’ -atgaccatgattacgccaagcttggtacegageteggatccactagtaacggecgecagt gtgctggaattcgcccttctaatacgactcactatagggcaagcagtggtatcaacgcag agtacggggggaggcttggtacagectggecaggtecctgagactetectgtgeagectet ggattcacccttgatgattatggcatgecactgggtecggecaagetecagggaagggectyg gagtgggtctcaggtattagttggaatagtgatagtataggctatgtggactctgtgaag ggccgattcaccatctccagagacaacgccaagaactcectgtatctgcaaatgaacagt ctgagagttg aggacacggccttgtattactgtgtaaaagatattagtggctggtacage tttgactactggggccagggaaccctggtcacegtctecteca—3’ (SEQ ID NO: 32) [000199] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 33 shown in the following Table. Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Light chain variable region amino acid sequence 1 MEAPAQLLFL LLLWLPDTTG EIVLTQSPAT LSLSPGERAT LSCRASQSVS SYLAWYQQKP 61 GQAPRLLIYD ASNRATGIPA RFSGSGSGTD FTLTISSLEP EDFAVYYCQQ RSNWPITFGQ 121 GTRLEIK (SEQ ID NO: 33) [000200] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 34 shown in the following Table. Human anti-OX40 antibody 1-12Z5 (ATCC No. PTA-7216) Light chain variable region nucleic acid sequence 57 atggaagccccagotcagottotettoctectgotactotggotoccagataccaccggagaaattgtgttgac acagtctecagecacectgtetttgtetecaggggaaagagecacectetectgecagggecagtecagagtgttage agctacttagcctggtaccaacagaaacctggccaggetcccaggetecteatetatgatgeatccaacagggeca ctggcateccagecaggtteagtggeagtgggtotgggacagacttecactetecaccatecageagectagagectga agattttgcagtttattactgtcageagegtageaactggeogatecacctteoggecaagggacacgactggagatt aaa-3’ (SEQ ID NO: 34) [000201] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35 shown in the following Table. Human anti-0X40 antibody 112F32 (ATCC No. PTA-7217) Heavy chain variable region amino acid sequence 1 MEWGPCWVFL VVILEGVQCG VQLVESGGGL VQPGGSLRLS CAASGFTFSS YSMNWVRQAP 61 GKGLEWVSYI SSSSSTIYYA DSVKGRFTIS RDNAKNSLYL QMNSLRDEDT AVYYCARGVY 121 HNGWSFFDYW GQGTLLTVSS (SEQ ID NO: 35) [000202] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 36 shown in the following Table. Human anti-0X40 antibody 112F32 (ATCC No. PTA-7217) Heavy chain variable region nucleic acid sequence 5’ atggagtgggggccgtgctgggttttecttgttgttattttagaaggtgtecagtgtggggtgcagetgyg tggagtctgg gggaggcttg gtacagcctg gggggtccctgagactctcctgtgeagect ctggattcaccttcagtagctatagcatgaactgggtecgecaggetecagggaagggge tggagtgggtttcatacattagtagtagtagtagtaccatatactatgcagactctgtga agggccgattcaccatcteccagagacaatgeccaagaactcactgtatetgecaaatgaacagectgagagacgagga cacggctgtgtattactgtgcgagaggagtgtatcacaatggctggtocttott tgactactggggccagggaaccctacteaccgtctectea-3’ (SEQ ID NO: 36) [000203] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 37 shown in the following Table. Human anti-OX40 antibody 112F32 (ATCC No. PTA-7217) Light chain variable region amino acid sequence. 1 MDMRVLAQLL GLLLLCFPGA RCDIQMTQSP SSLSASVGNR VTITCRASQD ISSWLAWYQQ 061 KPEKAPKSLI YAASSLQSGV PSRFSGSGSG TDFTLTISSL QPEDFATYYC QQYNSYPLTF 121 GOGTRLEIKR (SEQ ID NO: 37) [000204] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 38 shown in the following Table. Human anti-OX40 antibody 12F32 LV (ATCC No. PTA-7217) Light chain variable region nucleic acid sequence 57 -atggacatgagggtcctcgotcagotoctggggotoctgotgototgttteccaggtgec agatgtgacatccagatgacccagtececatectcactgtetgeatetgtaggaaacaga gtcaccattacttgtegggegagtcaggatattageagetggttagectggtateageag aaaccagagaaagcccctaagtccctgatctatgctgeatccagtttgcaaagtggggte ccatcaaggtteageggeagtggatetgggacagatttecacteteacecatecageagectyg cagcctgaagattttgcaacttattactgccaacagtataatagttaccccctcacctte ggccaagggacacgactggagattaaacga-3’ (SEQ ID NO: 38) [000205] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39 shown in the following Table. Human anti-0X40 antibody 112Y1 31 (ATCC NO. PTA-7218) Heavy chain variable region amino acid sequence 1 MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPTQTLTLT CTFSGFSLST SGVGVGWIRQ 61 PPGKALEWLA LIYWDDHSPY SPSLKSRLTI TKDTSKNQVV LTMTNMDPVD TATYYCARTR 121 GAFDIWGQGT MVTVSS (SEQ ID NO: 39) [000206] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 40 shown in the following Table. Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Heavy chain variable region nucleic acid sequence 5’ —atggacactctttgctccacgctectgetgetgaccatcecttecatgggtettgteccag atcaccttgaaggagtctggtcctacgctggtgaaacccacacagaccctcacgctgace tgcaccttectetggattetcactecageactagtggagtgggtgtgggetggatecgteag cccecaggaa aggccctggagtggettgeactcatttattgggatgatcatageceetac agcccatctetgaagageaggetcaccatcaccaaggacacctecaaaaaccaggtggte cttacaatgaccaacatggaccctgtggacacagccacatattactgtgcacgcaccegy ggggcttttgatatetggggccaagggacaatggtcacegtetetteca—3’ (SEQ ID NO: 4C [000207] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 41 shown in the following Table. Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Light chain variable region amino acid sequence 1 MEAPAQLLFL LLLWLPDTTG EIVLTQSPAT LSLSPGERAT LSCRASQGVS SYLAWYQQKP 61 GQAPRLLIYD ASNRATGIPA RFSGSGPGTD FTLTISSLEP EDFAVYYCQQ RSNWHPTFGQ 121 GTKVEIK (SEQ ID NO: 41) [000208] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 42 shown in the following Table. Human anti-OX40 antibody 112Y1 31 (ATCC NO. PTA-7218) Light chain variable region nucleic acid sequence 5’ -atggaagcecccagegeagettetettectectgetactetggeteccagataccacegga gaaattgtgttgacacagtctecagecacectgtetttgtetecaggggaaagagecace ctctcctgcagggccagtcagggtgttagcagctacttagectggtaccagcagaaacctggecaggeteccagge tectecatctatgatgeatecaacagggecactggeateccagecaggttecagtggeagtgggectgggacagactt cactctcaccatcagcagcctagagoctgaagattttgcagtttattactgtcagcagegtagcaactggcatecg acgtteggccaagggaccaaggtggaaatcaaacgaactgtggetgcaceate-3’ (SEQ ID NO: 42) acgtteggccaagggaccaaggtggaaatcaaacgaactgtggetgcaccate-3’ (SEQ ID NO: 42) [000209] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43 shown in the following Table. Human anti-0X40 antibody 112V8 (ATCC NO. PTA-7219) Heavy chain variable region amino acid sequence T= MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPKQTLTLT CTFSGFSLST SGMGVGWIRQ - FILMdLe LAA MALEONVUOY LtiiiboEbl id VAD AKL LL LL MLE OEbeLe Ll Gala VEL 61 PPGKALEWLA VIYWDDHQLY SPSLKSRLTI TKDTSKNQVV LTMTNMDPVD TATYYCAHRR 121 GAFQHWGQGT LVTVSSASTK (SEQ ID NO: 43) [000210] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 44 shown in the following Table. Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Heavy chain variable region nucleic acid sequence 5 -atggacacactttgctccacgctectgetgetgaccateccttecatgggtettgteccag atcaccttgaaggagtctggtcctacgctagtgaagcccaaacagaccctcacgetgace tgcaccttetetggattetecactecageactagtggaatgggtgtgggetggatecgteag cccccaggaaaggccctggagtggcttgeagtcatttattgggatgatcatcaactctac agtccatctctgalgagcaggctcaccatcaccaaggacacctccaaaaaccaggtggtc cttacaatgaccaacatggaccctgtggacacagecacatattactgtgeacacagacga ggggccttccagcactggggccagggcacectggteacegtetectcagettccaccaaggge—3' (SEQ ID NO: 44) [000211] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 45 shown in the following Table. Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Light chain variable region amino acid sequence = METPAQLLFL LLLWLPDTTG EIVLIQSPGT LSLSPGERAT LSCRASQSVS SSYLAWYQQK | 61 PCOAPRLLIY GASSRATGIP DRFSGSGSGT DETLTISRLE PEDFAVYYCQ QYDSSLTFGG = FELSARLLLSL LLdfLEY ALT Sa Vd) 61 PGQAPRLLIY GASSRATGIP DRFSG: 121 GTKVEIKRT (SEQ ID NO: 45) [000212] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 46 shown in the following Table. Human anti-OX40 antibody 112V8 (ATCC NO. PTA-7219) Light chain variable region nucleic acid sequence 5’ -atggagtgggggecgtgctgggttttecttgttgttattttagaaggtgtecagtgtggg atggaaaccccagcgeagcttetettectectgetactetggeteccagataccaccgga gaaattgtgttgacgcagtctccaggcacectgtetttgtetccaggggaaagagecace ctctectgecagggecagtcagagtgttagecagecagetacttagectggtaccagecagaaa cctggccaggctcccaggetecteatetatggtgcatccagecagggecactggecatecca gacaggttcagtggcagtgggtctgggacagacttcactetecaccatecagecagactggag cctgaagattttgcagtgtattactgtcagcagtatgatagctegetcacttteggegga gggaccaaggtggagatcaaacgaact-3’ (SEQ ID NO: 46) [000213] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47 shown in the following Table. Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Heavy chain variable region amino acid sequence 1 MDTLCSTLLL LTIPSWVLSQ ITLKESGPTL VKPTQTLTLS CTFSGFSLST SGVGVGWIRQ 61 PPGKALEWLA LIHWDDAERY SPSLKSRLTI TKDTSKNQVV LTMTNMDLVD TATYYCAHTR 121 GAFDIWGQGT MVTVSS (SEQ ID NO: 47) [000214] The nucleic acid sequence encoding the human anti-OX40 antibody heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 48 shown in the following Table. Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Heavy chain variable region nucleic acid sequence 5’ -atggacacactttgctccacgctectgctgetgaccatoccttcatgggtottgteccag atcaccttgaaggagtcetggtectacgetggtgaaacccacacagacectcacgetgtee tgcaccttctctgggttctcactcagcactagtggagtgggtgtgggctggatecgteag cccecaggaaaggecctggaatggettgcacteattcattgggatgatgetgagegetac agtccatctetgaagageaggetcaccatcaccaaggacacctecaaaaaccaggtggte cttacaatgaccaacatggaccttgtggacacagccacatattactgtgcacacacccgy ggggcttttgatatetggggccaagggacaatggtcacegtetettca-3’ (SEQ ID NO: 48) [000215] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 antibody variable light chain comprising the amino acid sequence of SEQ ID NO: 49 shown in the following Table. Human anti-0X40 antibody 112Y55 (ATCC No. PTA-7220) Light chain variable region amino acid sequence 1 METPAQLLFL LLLWLPDTTG EIVLTQSPGT LSLSPGERAI LSCRASQSVS SSFLAWYQQK 61 PGQAPRLLIY GAFSRATGIP DRFSGSGSGT DFTLTISRLE PEDFAVYYCQ QYDSSRTFGQ 121 GTKVEIK (SEQ ID NO: 49) [000216] The nucleic acid sequence encoding the human anti-OX40 antibody light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 50 shown in the following Table. Human anti-OX40 antibody 112Y55 (ATCC No. PTA-7220) Light chain variable region nucleic acid sequence 5’ -atggaaaccccagcgcagottotcettectectgctactotggetoccagataccaccgga gaaattgtgttgacgcagtctccaggcacectgtetttgtctecaggggaaagagecate ctctectgecagggecagtcagagtgttagecagecagettettagectggtaccaacagaaa cctggecaggcteccaggetecteatctatggtgcatttageagggecactggeatceca gacaggttcagtggcagtgggtctgggacagacttcactectecaccatcagecagactggag cctgaagattttgcagtgtattactgtcagcagtatgatagetcacggacgtteggecag gggaccaaggtggaaatcaaa-3’ (SEQ ID NO: 50) [000217] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 IgG2a antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 IgG2a antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000218] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and a mouse anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000219] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000220] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7. [000221] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10. [000222] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12. [000223] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000224] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000225] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 34. [000226] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 32. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 33. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 34. [000227] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 38. [000228] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 36. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38. [000229] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 42. [000230] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 40. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 42. [000231] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 46. [000232] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 43. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 44. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 45. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 46. [000233] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain is SEQ ID NO: 50.\ [000234] The Sindbis viral vector can comprise a nucleic acid encoding a human anti- 0X40 variable heavy chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 47. The nucleic acid sequence encoding the human anti-OX40 variable heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to is SEQ ID NO: 48. The Sindbis viral vector can comprise a nucleic acid encoding a human anti-OX40 variable light chain comprising the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 49. The nucleic acid sequence encoding the human anti-OX40 variable light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 50. [000235] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000236] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000237] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000238] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally. [000239] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 0X40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments. [000240] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer. [000241] Sindbis Viral Vector and Anti-OX40 Monoclonal Antibody [000242] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti- 0X40 monoclonal antibody. [000243] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 §, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin- 12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2. [000244] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4 [000245] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000246] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 7. [000247] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10. [000248] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12. [000249] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000250] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000251] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000252] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000253] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000254] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. [000255] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. [000256] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 §, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin- 12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2. [000257] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4. [000258] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000259] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ IDNO: 7. [000260] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10. [000261] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12. [000262] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000263] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000264] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000265] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000266] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000267] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against OX40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000268] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally. [000269] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer. [000270] Sindbis virus can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. Sindbis virus can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. Sindbis virus can be administered from 10° — 10° TU / mL. Preferably, Sindbis virus can be administered from 10° — 10° TU / mL. [000271] An anti-OX40 monoclonal antibody can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. An anti-OX40 monoclonal antibody can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. An anti-OX40 monoclonal antibody can be administered from 25ug — 500ug, 25ug — 450ug, 50ug — 400ug, from 50pug — 350ug, from 50ug — 300pg, from 50ug — 250g, from 50pg — 200pg, from 50pug — 150pg or from 50ug — 100ug. An anti-OX40 monoclonal antibody can be administered at 250g. An anti- 0X40 monoclonal antibody can be administered at 250g once a week for one week. An anti-OX40 monoclonal antibody can be administered at 250g once a week for two weeks. An anti-OX40 monoclonal antibody can be administered at 250ug once a week for three weeks. An anti-OX40 monoclonal antibody can be administered at 250g three times a week for one week. An anti-OX40 monoclonal antibody can be administered at 250pg three times a week for two weeks. An anti-OX40 monoclonal antibody can be administered at 250ug three times a week for three weeks. [000272] The results provided in the instant disclosure demonstrate that administration of the a Sindbis virus expressing IL-12 (SV.IL12) markedly increases the expression of 0X40 on CD4 T cells and demonstrate that administration of a combination of SV.IL12 and anti-OX40 monoclonal antibody resulted in complete tumor regression in colon cancer, prostate cancer and ovarian cancer in vivo models and led to a greater than 60% survival rate (in some instances to a greater than 90% survival rate). This combined therapeutic effect was dramatically more effective when compared to either SV.IL12 or anti-OX40 monoclonal antibody treatment alone. These results also confirm that the oncolytic activity of the Sindbis virus is not required to induce a robust and effective anti-tumor response. [000273] The results provided in the instant disclosure demonstrate that the combination of SV.IL12 or anti-OX40 monoclonal antibody treatment markedly changes the transcriptome signature of T cells and favors the differentiation of terminal effector T cells (e.g., effector T cells with a Th1 type phenotype). In particular, pathways upregulated by the combination treatment were dominated by DNA replication, chromosomal organization and cell cycle regulation, but also included various metabolic and immunological processes, such as mitochondrial respiration, nucleotide metabolism and adaptive immune responses. Specifically, only T cells from combined therapy expressed the gene signature of terminally differentiated effector T cells, which are characterized by high expression of the killer lectin-like receptor (KLRG1) and low expression of the interleukin 7 receptor (IL-7R). Furthermore, genes encoding products associated with the differentiation and function of effector cells, such as Batf, Id2, Thet, Gzmb and Ifng, were also highly expressed in T cells following combination therapy. Furthermore, CD4 T cells also expressed a marked anti-tumor effector phenotype (ICOS Tbet™) which was on average 2 to 3-fold higher during combined therapy compared with SV.IL12 or anti-OX40 treatment. [000274] The tumor microenvironment can be a very challenging milieu for an effector T cell as it is characterized by hypoxia, acidosis and low levels of nutrient sources such as glucose and glutamine. Even if T cell activation and initiation of effector function is allowed, T cells may be unable to generate the bioenergetics intermediates necessary to carry out effector function in the tumor microenvironment. Thus, providing a metabolic support for T cells is crucial for the success of cancer treatments. The results provided in the instant disclosure demonstrate that the combination of SV.IL12 or anti-OX40 monoclonal antibody promotes metabolic reprogramming of T cells. Specifically, the basal rate of oxygen consumption (OCR) was enhanced and spare respiratory capacity was dramatically increased in T cells following combination treatment. The combination also induced elevated protein expression of c-MYC as well as rate of extracellular acidification (ECAR). Collectively, these results show that SV.IL12 induces enhanced oxidative phosphorylation in CD8 T cells and the combination treatment is required to push CD4 T cells towards glycolysis by increasing the protein expression of ¢-MYC. Thus, the combination of SV.IL12 or anti-OX40 monoclonal antibody metabolically rewires T cells to an energetic state using both metabolic pathways, oxidative phosphorylation and glycolysis. [000275] The results provided in the instant disclosure demonstrate that metabolic reprogrammed T cells display enhanced CD4 mediated cytokine production and anti-tumor activity following treatment with the combination of SV.IL12 and anti-OX40 monoclonal antibody. Specifically, genes encoding pro-inflammatory cytokines ifing and i / 2 were upregulated in T cells and the secretion of interferon-y (IFNy) by splenocytes was increased following combination treatment. Additional, the levels of the cytotoxic proteases, granzyme A and B, were upregulated following combination treatment. Further, granzyme B positive cells were detected in CD8 as well as CD4 T cells, indicating the presence of cytotoxic CD4 T cells following combination treatment. In addition, tumor growth was markedly reduced when co-cultured with splenocytes from mice receiving combined therapy. Surprisingly, tumor growth inhibition was mediated by CD4 T cells. Together, these results clearly show that T cells from combined therapy elicit enhanced anti-tumor and functional activity, such as granzyme B and IFNy production driven by CD4 T cells. [000276] The results provided in the instant disclosure demonstrate that treatment with the combination of SV.IL12 and anti-OX40 monoclonal antibody results in enhanced T cell migration and intratumoral T cell immunity. Specifically, CXCR3 levels were significantly upregulated on CD4 T cells following combination therapy. In contrast, CXCR3 expression on CD8 T cells only appeared later on in treatment, indicating that CD4 T cells are first recruited to the inflamed site followed by CD8 T cells. Combination therapy also enhanced the production of CXCL9 and CXCL10 in the tumor microenvironment, indicating that CXCR3 positive T cells migrate to the tumor site. These results clearly show that the combination of SV.IL12 and anti-OX40 monoclonal antibody alter the tumor microenvironment by facilitating T cell infiltration via modulation of the CXCR3 / CXCL9- 11 axis. Not only did combination therapy increase T cell infiltration but CD4 as well as CDB8 T cells also demonstrated enhanced functional activity in the tumor, as judged by the Ki-67 and granzyme B expression. These results indicate that the presence of activated T cells in the tumor microenvironment exert anti-tumor activity which inhibits tumor growth. Enhanced iNOS production was also demonstrated in tumors treated with combination therapy. Interestingly, the amount of iNOS inversely correlated with arginasel production, indicating a repolarization of tumor associated macrophages from the M2-like (pro-tumor) into Ml-like (anti-tumor) phenotype during combination therapy. [000277] Thus, the data provided herein clearly shows that even in absence of direct Sindbis virus infectivity, SV.IL12 in combination with an anti-OX40 monoclonal antibody alter the tumor microenvironment by enhancing T cell infiltration and intratumoral T cell immunity, especially against low immunogenic tumors. The synergistic therapeutic efficacy of the systemic administration of the combination is driven by T cell modulation and reprogramming of its metabolic state, in order to enhance the anti- tumor response in the periphery and in the tumor microenvironment. Furthermore, the use of Sindbis virus allows these metabolically reprogrammed T cells to better infiltrate the tumor microenvironment, which is crucial for an adequate immunotherapy. [000278] Sindbis Viral Vector and Anti-4-1BB Monoclonal Antibody [000279] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. The present disclosure further provides in vitro or ex vivo methods for treating cancer or assessing the treatment of cancer in a subject comprising contacting a biological sample from the subject with (a) a Sindbis viral vector and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. Preferably, the Sindbis viral vector does not comprise an endogenous nucleic acid encoding any protein. Sindbis viral vectors were produced as described in US Patent No. 8,093,021 (incorporated herein by reference in its entirety). [000280] The Sindbis viral vector is replication defective. The Sindbis viral vector can comprise a nucleic acid sequence encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein. The Sindbis viral vector can comprise the nucleic acid encoding the therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody. The Sindbis viral vector can comprise a nucleic acid sequence encoding LacZ (lac operon structural gene lacZ encoding B-galactosidase), Flue (firefly luciferase) or GFP (green fluorescent protein). The Sindbis viral vector can comprise the nucleic acid encoding LacZ, Flue or GFP and further comprise the nucleic acid encoding the anti-4-1BB monoclonal antibody. [000281] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences as follows: HCDR1: GFIFSYFDMA (SEQ ID NO: 16), HCDR2: SISPDGSIPYYRDSVK (SEQ ID NO: 17) and HCDR3: RSYGGYSELDY (SEQ ID NO: 18). [000282] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB heavy chain comprising the amino acid sequence of SEQ ID NO:19 shown in the following Table. anti-4-1BB heavy chain amino acid DVQLVESGGGLVQPGRS LKLSCAASGFIFSYFDMAWVROAPTKGLEWVASI SPDGSIPYYRDSVKGRETVSRENAK SSLYLQMDSLRSEDTATYYCARRSYGGYSELDYWGQGVMVTVSS (SEQ ID NO: 19). [000283] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody light chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences as follows: LCDR1: QASQDIGNWLA (SEQ ID NO: 20), LCDR2: GSTSLAD (SEQ ID NO: 21) and LCDR3: LQAYGAPW (SEQ ID NO: 22). [000284] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB light chain comprising the amino acid sequence of SEQ ID NO:23 shown in the following Table. anti-4-1BB light chain amino acid DIQMTQSPASLSASLEEIVIITCQASQDIGNWLAWYHOKPGKSPQLLIYGSTSLADGVPSRESGSSSGSQYSLKIS RLQVEDIGIYYCLQAYGAPWTFGGGTKLELK (SEQ ID NO: 23) [000285] The Sindbis viral vector can comprise a nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen comprising the amino acid sequence of SEQ ID NO:24 shown in the following Table. anti-4-1BB target antigen MGNNCYNVVV IVLLLVGCEK VGAVQNSCDN CQPGTFCRKY NPVCKSCPPS 51 TFSSIGGQPN CNICRVCAGY FRFKKFCSST HNAECECIEG FHCLGPQCTR Ma 2 LEPRL ODEN iLL AVAGALDL DARDALLI LEO L ALL LOLL LE DLL LL D 101 CEKDCRPGQE LTKQGCKTCS LGTFNDQNGT GVCRPWTNCS LDGRSVLKTG 151 TTEKDVVCGP PVVSFSPSTT ISVIPEGGPG GHSLQVLTLF LALTSALLLA 201 LIFITLLFSV LKWIRKKFPH IFKQPFKKTT GAAQEEDACS CRCPQEEEGG 251 GGGYEL (SEQ ID NO: 24) [000286] The Sindbis viral vector can comprise a nucleic acid encoding a 4-1BB heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 19 and a nucleic acid encoding a 4-1BB light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 23. [000287] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24). The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24). The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen (4-1BB antigen) of the amino acid sequence of (SEQ ID NO: 24). [000288] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23. [000289] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. [000290] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL- 3, IL- 4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. The anti-4-1BB antibody can be urelumab, utomilumab or a combination thereof. The anti-4-1BB antibody can be InVivoMAD anti-mouse 4-1BB (BioXCell, Clone: LOB12.3, Cat.No. BE0169). [000291] The Sindbis viral vector and the anti-4-1BB monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-4-1BB monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-4-1BB monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-4-1BB monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-4-1BB monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally. [000292] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4- 1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments. [000293] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is a lymphoma. In one preferred aspect, the cancer is a B cell lymphoma. [000294] The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure provides a Sindbis viral vector comprising a nucleic acid encoding encoding LacZ, Flue or GFP and a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding LacZ, Flue or GFP and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-4-1BB monoclonal antibody. The present disclosure further provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding a therapeutic protein, an immunostimulatory protein or an immunomodulatory protein and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. The present disclosure provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding encoding LacZ, Flue or GFP and (b) an anti-4-1BB monoclonal antibody or a nucleic acid encoding same. [000295] The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3 amino acid sequences of SEQ ID NOs: 16, 17 and 18, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 19. The Sindbis viral vector can comprise a nucleic acid encoding an anti-4-1BB antibody heavy chain comprising the light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3 amino acid sequences of SEQ ID NOs: 20, 21 and 22, respectively. The Sindbis viral vector can comprise the nucleic acid encoding an anti-4-1BB antibody light chain comprising the amino acid sequence of SEQ ID NO: 23. [000296] The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain CDR1, CDR2 and CDR3 amino acid sequences that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody heavy chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. The Sindbis viral vector can comprise the nucleic acid encoding anti-4-1BB antibody light chain amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 24. [000297] The immunostimulatory or immunomodulatory protein can be IL-1, IL-2, IL- 3, IL-4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31,1L-32, IL-33, IL-34, IL-35, IL-36, or any combination thereof. In a preferred aspect, the immunostimulatory or immunomodulatory protein is IL-12. Additional cytokines include IL-I8-IL-36. In addition to CCL17, other chemokines can also be used, including, but not limited to, CCL1-CCL27 and other CC chemokines, CXCLI-CXCL13 and other CXC chemokines, C chemokines, and CX3C chemkines. Cytokine or chemokine receptors and soluble receptors can also be used. Additional immune modulators that can be used include TGF-f and TNFa. In addition, different combinations of the above-mentioned (or alternative) cytokines can be used. [000298] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against 4-1BB or an anti-4- 1BB monoclonal antibody, as described herein, can be a full length antibody against 4-1BB antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 4-1BB receptor on a cell surface. An “antigen-binding fragment” of an anti-4-1BB antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv-CH3, scFv-Fc, and diabody fragments. [000299] Sindbis virus can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. Sindbis virus can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. Sindbis virus can be administered from 10° — 10° TU / mL., Preferably, Sindbis virus can be administered from 10° — 10° TU / mL. [000300] An anti-4-1BB monoclonal antibody can be administered at least one time, at least two times, at least three times, at least four times or at least five times per week. An anti-4-1BB monoclonal antibody can be administered for at least one week, at least two weeks, at least three weeks, or at least four weeks. An anti-4-1BB monoclonal antibody can be administered from 25ug — 500ug, 25ug — 450ug, 50ug — 400g, from 50ug — 350ug, from 50ug — 300g, from 50pug — 250pg, from 50pug — 200pg, from 50pug — 150ug or from 50pug — 100pg. An anti-4-1BB monoclonal antibody can be administered at 50g. An anti-4-1BB monoclonal antibody can be administered at 50g once a week for three weeks. An anti-4-1BB monoclonal antibody can be administered at 250ug. An anti-4-1BB monoclonal antibody can be administered at 250g three times week for two weeks. An anti-4-1BB monoclonal antibody can be administered at 350pg. An anti-4-1BB monoclonal antibody can be administered at 350g three times week for two weeks. [000301] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in complete tumor regression in an lymphoma in vivo model and that this therapeutic effect was dramatically more effective when compared to either Sindbis virus or anti-4-1BB monoclonal antibody treatment alone. Tumor elimination involves a synergistic effect of the combination that significantly boosts T cell cytotoxicity, IFNy production, T cell proliferation, migration, and glycolysis. As described in more detail below, the data identified the molecular pathways, including upregulated cytokines, chemokines and metabolic pathways in T cells that are triggered by the combined therapy and help to achieve a highly effective anti-tumor response. [000302] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased T cell cell cycle progression, cytokine production and activation. T cell proliferation is critical for an effective anti-tumor response. [000303] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased cytotoxicity (e.g., increased cytotoxic T cell function). Specifically, genes such as Gzmb (granzyme B), Prfl (perforin) and Klrkl (NKG2D) are significantly upregulated in T cells (particularly CD8 T cells) following administration of Sindbis virus and anti-4-1BB monoclonal antibody. [000304] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased IFNy production from T cells and Th1 differentiation. The combination of Sindbis virus and anti-4-1BB monoclonal antibody upregulated the expression of STAT4, Cer5, Cxcer3, Haver2(Tim3), IL12rbl and Klrel in T cells, which are required for the development of Th1 cells from naive CD4+ T cells and IFNy production. This increase was independent of the presence or absence of TAA. The combination of Sindbis virus and anti-4-1BB monoclonal antibody increased IFNy production from both CD4 and CD8 T cells (with a larger portion CD4 T cells producing IFNy) and demonstrated that antigen presenting cells (APCs) are essenThltial for helping T cells product IFNy. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also increased T-bet in T cells. T-bet is a key transcription factor which is essential for type I immune response (IFNy production, T cell cytotoxicity) and memory T cell differentiation. Thus, this indicates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody boosts the type I immune response, which is critical for controlling tumor growth. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also increased Eomesodermin (EOMES) in T cells. EOMES, another important transcription factor, is upregulated in activated T cells and is essential for memory CD8 T cell development. [000305] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in increased chemotaxis, adhesion and enhanced T cell infiltration and activation in tumors. Specifically, the combination significantly upregulates CD11a and ICAM-1(CD54) in both CD4 and CD8 T cells, which are two adhesion molecules expressed on activated T cells and are essential for the formation of immune synapses between T cells and APCs and are also required for T cell / T cell homotypic aggregation and activation. The combination of Sindbis virus and anti-4-1BB monoclonal antibody also significantly upregulated 0X40 and ICOS in T cells. 0X40 engagement promotes effector T cell function and survival and ICOS is another key CD4 T cell costimulatory molecule. Tumor infiltrating lymphocytes play a critical anti-tumor role and are an important marker for prognosis. The percentage of CD3 and CD8 T cells increased about two-fold following combination treatment. Thus, these results demonstrate that combination treatment enhanced T cell infiltration, division, activation, cytotoxicity and downregulated the inhibitory Treg population. [000306] The results provided in the instant disclosure demonstrate that administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody resulted in enhanced T cell glycolysis and oxidative phosphorylation. T cell activation requires a quick consumption of energy through both enhanced glycolysis and oxidative phosphorylation. Metabolic switch is a major feature of T cell activation and memory T cell development. Upregulation of glycolysis genes quickly produce ATP and supports T cell migration and cytotoxicity in hypoxic or acidific microenvironments (such as in and around a tumor). The instant results demonstrate that combination treatment significantly increased both oxygen consumption rate (OCR, represents oxidative phosphorylation) and extracellular acidification rate (ECAR, represents glycolysis). This indicates that both glycolysis and oxidative phosphorylation are activated in combination treated T cells. [000307] The results provided in the instant disclosure demonstrate that mice cured by the administration of the combination of Sindbis virus and anti-4-1BB monoclonal antibody are completely protected from cancer rechallenge demonstrating that these mice acquired long lasting antitumor immunity. [000308] The conventional view of oncolytic virus therapy against tumors is that it requires selective infection of cancer cells resulting in the induction of cancer cell lysis and apoptosis. Tumor specific antigens (TAAs), released from dead tumor cells, attract and further stimulate an antitumor immune response. The data presented herein demonstrates that encoding a TAA is not necessary for the combination of Sindbis virus and anti-4-1BB monoclonal antibody to be fully successful in eradicating growing tumors. [000309] The quick inhibition of tumor growth is critical for cancer therapy because tumor cells undergo exponentially rapid division. However, the induction of adaptive immunity and establishment of tumor specific immunity takes a long time. An ideal therapy requires an early, quick reduction of tumor burden, and a later induction of anti- tumor specificity that prevents relapse. The data presented herein demonstrates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody treatment induced massive T cell activation due to viral induced immune response. This massive activation helps to control the tumor in a TAA nonspecific manner. [000310] It was shown herein that both NKG2D (KLRKI) and granzyme B are highly expressed under combination treatment. This massive nonspecific activation is critical for controlling tumor growth at an early time point (day 7). This step is also important for inducing anti-tumor specificity that is mediated by TA As released from dead tumor cells due to nonspecific killing. After tumor regression, T cells from treated animals were able maintain the ability to produce IFNy and acquired immunological memory to rapidly reject tumor rechallenges. IFNy production from purified T cells of cured mice was significantly enhanced after encountering tumor cells. This demonstrates that anti-tumor specificity is fully established in cured mice. [000311] The data also shows that Sindbis viral infection of tumor cells, inclusion of dendtric cells and lymphodepletion are not necessary for successful cancer treatment. The omission of these additional features decreases costs, any risks related to toxicity and infection. [000312] Thus, the data provided herein demonstrates that the combination of Sindbis virus and anti-4-1BB monoclonal antibody completely eradicated a B-cell lymphoma in a preclinical mouse model, a result that could not be achieved with either treatment alone. Tumor elimination involves a synergistic effect of the combination that significantly boosts T cell cytotoxicity, IFN-y production, migration, tumor infiltration and oxidative phosphorylation. In addition, all mice that survived after treatment developed long lasting antitumor immunity. [000313] Sindbis Viral Vector and Sindbis Viral Vector NY-ESO-1 [000314] The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject. The present disclosure also provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject. [000315] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 8, IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin- 12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2. [000316] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4 [000317] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO:14 shown in the following Table. 1 agcagggggce gctgtgtgta ccgagaatac gagaatacct cgtgggecct gaccttetet 61 ctgagagccg ggcagaggcet ccoggagcecat gcaggccgaa ggccggggca cagggggtte Ma RkgadagLtyd d-adadytb begdadhal Yhagibbgaa YYbegEbda Ladibdes be 121 gacgggcgat gctgatggec caggaggecc tggcattcct gatggeccag ggggcaatge 181 tggcggccca ggagaggcgyg gtgccacggyg cggcagaggt coccggggcyg caggggcage 241 aagggcctcg gggccgggag gaggcgcocce goggggtccg catggeggeg cggcttcagg 301 gctgaatgga tgctgcagat geggggccag ggggecggag agecgectge ttgagttcta 361 cctegecatg cctttegega cacccatgga agcagagctg geccgcagga gectggecea 421 ggatgcccca ccgcttcccg tgccaggggt gottctgaag gagttcactg tgtccggcaa 481 catactgact atccgactga ctgctgcaga ccaccgccaa ctgcagetcet ccatcagete 541 ctgtctccag cagctttcce tgttgatgtg gatcacgcag tgctttctge cogtgttttt 601 ggctcagect cecctcaggge agaggegeta ageccagect ggegeccett cctaggteat 661 gcctectece ctagggaatg gtcccageac gagtggecag ttcattgtgg gggectgatt 721 gtttgtcgct ggaggaggac ggcttacatg tttgtttctg tagaaaataa aactgagcta 781 cgaaaaaaaa aaaaaaaaaa aaaaaa (SEQ ID NO: 14) [000318] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO:15 shown in the following Table. Amino acid sequence of NY-ESO-1 (NP 001318.1) 1 mgaegrgtgg stgdadgpgg pgipdgpggn aggpgeagat ggrgprgaga arasgpggga 61 prgphggaas glngccrcga rgpesrllef ylampfatpm eaelarrsla gdapplpvpg ML MLN Yeas WhlidebLlbYe AYeolllel: FLY ialpl SatlalloLa AAAI LM VY 121 vllkeftvsg niltirltaa dhrqlglsis sclgglsllm witqcflpvf lagppsgqrr (SEQ ID NO: 15) [000319] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15. [000320] A replication defective Sindbis viral vector as described herein can be any replication defective Sindbis viral vector including a replication defective viral vector described, for example, in US Patent Nos. 7,303,898, 7,306,792, and 8,093,021. Replication defective vectors are preferred for use in the present invention in order to prevent infection of healthy tissues. [000321] The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered sequentially or concurrently. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered systemically. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered parenterally. The Sindbis viral vector comprising a nucleic acid encoding interleukin-12 can be administered intraperitoneally. The Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally. Both the Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and the Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 can be administered intraperitoneally. [000322] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer. [000323] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1. [000324] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit (IL-12 a, IL-12, p35 subunit) and interleukin-12 beta subunit (IL-12 , IL-12, p40 subunit). The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of GenBank accession no. M86672 and interleukin-12 beta subunit of GenBank accession no. M86671. The nucleic acid encoding interleukin-12 alpha subunit comprises the nucleic acid sequence of SEQ ID NO: 1. The nucleic acid encoding interleukin- 12 beta subunit comprises the nucleic acid sequence of SEQ ID NO: 2. [000325] The Sindbis viral vector can comprise the nucleic acid encoding interleukin-12 alpha subunit of amino acid sequence of GenBank accession no. AAA39292.1 and interleukin-12 beta subunit of amino acid sequence of GenBank accession no. AAA39296.1. The amino acid sequence of the interleukin-12 alpha subunit is of amino acid sequence of SEQ ID NO: 3. The amino acid sequence of the interleukin-12 beta subunit is of amino acid sequence of SEQ ID NO: 4 [000326] The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15. [000327] The present disclosure provides methods for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject. [000328] The Sindbis viral vector can be replication defective. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 and can further comprise the nucleic acid encoding the anti-OX40 monoclonal antibody. The method can comprise administering a Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15. [000329] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000330] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ IDNO: 7. [000331] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10. [000332] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12. [000333] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000334] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000335] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000336] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000337] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000338] The Sindbis viral vector and the anti-OX40 monoclonal antibody can be administered sequentially or concurrently. The Sindbis viral vector can be administered systemically. The anti-OX40 monoclonal antibody can be administered systemically. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered systemically. The Sindbis viral vector can be administered parenterally. The anti-OX40 monoclonal antibody can be administered parenterally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered parenterally. The Sindbis viral vector can be administered intraperitoneally. The anti-OX40 monoclonal antibody can be administered intraperitoneally. Both the Sindbis viral vector and the anti-OX40 monoclonal antibody, or a nucleic acid encoding same, can be administered intraperitoneally. [000339] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the 0X40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000340] The cancer can be a solid cancer or a liquid / hematologic cancer. The cancer can comprise metastatic cancer. The cancer can comprise a solid tumor. The cancer can be a carcinoma, a lymphoma, a blastoma, a sarcoma, a leukemia, a brain cancer, a breast cancer, a blood cancer, a bone cancer, a lung cancer, a skin cancer, a liver cancer, an ovarian cancer, a bladder cancer, a renal cancer, a gastric cancer, a thyroid cancer, a pancreatic cancer, an esophageal cancer, a prostate cancer, a cervical cancer or a colorectal cancer. In one preferred aspect, the cancer is colon cancer. In one preferred aspect, the cancer is prostate cancer. In one preferred aspect, the cancer is ovarian cancer. [000341] The present disclosure further provides a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and a nucleic acid encoding an anti-OX40 monoclonal antibody. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same. The present disclosure also provides a composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY- ESO-1 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody. The Sindbis viral vector can comprise the nucleic acid encoding NY- ESO-1 of NCBI Reference accession no. NM_001327.1. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of NCBI Reference accession no. NM_001327.1. The nucleic acid encoding NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO: 14. The Sindbis viral vector can comprise the nucleic acid encoding NY-ESO-1 of amino acid sequence of NCBI Reference accession no. NP_001318.1. The amino acid sequence of the NY-ESO-1 comprises the amino acid sequence of SEQ ID NO: 15. [000342] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable heavy chain comprising the amino acid sequence of SEQ ID NO: 5. The nucleic acid sequence encoding the anti-OX40 variable heavy chain is SEQ ID NO: 6. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 variable light chain comprising the amino acid sequence of SEQ ID NO: 7. The nucleic acid sequence encoding the anti-OX40 variable light chain is SEQ ID NO: 8. [000343] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain of amino acid sequence of SEQ ID NO; 5 and a nucleic acid encoding a mouse anti- 0X40 light chain of amino acid sequence of SEQ ID NO: 7. The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ ID NO: 5 and a nucleic acid encoding a mouse anti-OX40 light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid sequence of SEQ IDNO: 7. [000344] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 9. The nucleic acid sequence encoding the an anti-OX40 antibody heavy chain is SEQ ID NO: 10. [000345] The Sindbis viral vector can comprise a nucleic acid encoding a mouse anti-OX40 antibody light chain comprising the amino acid sequence of SEQ ID No: 11. The nucleic acid sequence encoding the anti-OX40 antibody light chain is SEQ ID NO: 12. [000346] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence of SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain of SEQ ID NO: 10 and an anti-OX40 antibody light chain with an amino acid sequence of SEQ ID NO: 12. [000347] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 9 and an anti-OX40 antibody light chain with an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 11. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 10 and an anti-OX40 antibody light chain that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 12. [000348] The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000349] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise the nucleic acid encoding an anti-OX40 antibody light chain with an amino acid sequence that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000350] The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody variable heavy chain amino acid sequence, and an anti-OX40 antibody variable light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. The Sindbis viral vector can comprise a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, and an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13. [000351] A “monoclonal antibody” as disclosed herein, can be a full-length antibody or an antigen binding fragment thereof, wherein the “antigen binding fragment” is a fragment of the full length antibody that retains binding to the target antigen of the said monoclonal antibody. For example, a monoclonal antibody against OX-40 or an anti-OX40 monoclonal antibody, as described herein, can be a full length antibody against 0X40 antibody or an antigen binding fragment thereof, wherein the fragment retains binding to the OX40 receptor on a cell surface. An “antigen-binding fragment” of an anti-OX-40 antibody, as described herein can include any fragment selected from the group consisting of Fv, Fav, F(ab')2, Fab, dsFv, scFv, sc(Fv)2, scFv- CH3, scFv-Fc, and diabody fragments. [000352] The results provided in the instant disclosure demonstrate that administration of a combination of IL-12 and NY-ESO-1, expressed by separate Sindbis virus vector synergistically enhances the survival rate of a subject bearing an established tumor. The results described herein show that mice transplanted with Alm5-2Fluc-17 ovarian cancer cells by re- injection to establish tumor as depicted in FIG. 19, when treated post-tumor establishment with a SV vector expressing NY-ESO-1 (SVNYESO) showed no enhancement of survival, with a percentage survival rate similar to untreated tumor bearing mice, thereby showing that some tumors are resistant to treatment with SV expressing a TAA, like NY-ESO-1. The results described herein show that treatment of the tumor bearing mice, with a SV expressing NYESO (SV-NYESO_SV-IL12) showed improvement in survival rate. The results show that surprisingly treatment with a 50% mix in one injection of a SV expressing IL-12 (SV-IL-12) and a SV expressing NYESO (SV-NYESO_SV-IL12), demonstrated synergistically enhanced survival as compared to mice treated with the SV-IL-12 or SV-NYESO. The results described herein clearly show the possibility of using a combination of SV vectors expressing IL-12 and NY-ESO-1, for treatment of cancers that may be resistant to treatment with a SV expressing a tumor associated antigen. [000353] The results provided in the instant disclosure demonstrate that administration of a combination of IL-12 and NY-ESO-1, expressed by the same Sindbis virus vector synergistically enhances the survival rate of a subject bearing an established tumor. The results show that mice bearing established tumors of Alm5-2Fluc-17 ovarian cancer cells, when treated with a Sindbis viral vector that expresses both IL-12 and NYESO (SV-NYESO_SGP2_IL12), demonstrated synergistically enhanced survival as compared to mice treated with the SV-IL-12 or SV-NYESO. The results described herein clearly show the possibility of using a single SV vectors expressing both IL-12 and NY-ESO-1, for treatment of cancers that may be resistant to treatment with a SV expressing a tumor associated antigen. [000354] Treating cancer means treating at least one symptom of cancer. Treating at least one symptom of cancer can include any of the following, or any combination thereof: inhibiting tumor growth, reducing tumor size, reducing tumor number, reducing tumor burden, preventing cancer recurrence, preventing metastasis of a primary tumor. [000355] The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Included in this definition are benign and malignant cancers. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, leukemia and germ cell tumors. More particular examples of such cancers include adrenocortical carcinoma, bladder urothelial carcinoma, breast invasive carcinoma, cervical squamous cell carcinoma, endocervical adenocarcinoma, cholangiocarcinoma, colon adenocarcinoma, lymphoid neoplasm diffuse large B-cell lymphoma, esophageal carcinoma, glioblastoma multiforme, head and neck squamous cell carcinoma, kidney chromophobe, kidney renal clear cell carcinoma, kidney renal papillary cell carcinoma, acute myeloid leukemia, brain lower grade glioma, liver hepatocellular carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, mesothelioma, ovarian serous cystadenocarcinoma, pancreatic adenocarcinoma, pheochromocytoma, paraganglioma, prostate adenocarcinoma, rectum adenocarcinoma, sarcoma, skin cutaneous melanoma, stomach adenocarcinoma, testicular germ cell tumors, thyroid carcinoma, thymoma, uterine carcinosarcoma, uveal melanoma. Other examples include breast cancer, lung cancer, lymphoma, melanoma, liver cancer, colorectal cancer, ovarian cancer, bladder cancer, renal cancer or gastric cancer. Further examples of cancer include neuroendocrine cancer, non-small cell lung cancer (NSCLC), small cell lung cancer, thyroid cancer, endometrial cancer, biliary cancer, esophageal cancer, anal cancer, salivary, cancer, vulvar cancer, cervical cancer, Acute lymphoblastic leukemia (ALL), Acute myeloid leukemia (AML), Adrenal gland tumors, Anal cancer, Bile duct cancer, Bladder cancer, Bone cancer, Bowel cancer, Brain tumors, Breast cancer, Cancer of unknown primary (CUP), Cancer spread to bone, Cancer spread to brain, Cancer spread to liver, Cancer spread to lung, Carcinoid, Cervical cancer, Children's cancers, Chronic lymphocytic leukemia (CLL), Chrome myeloid leukemia (CML), Colorectal cancer, Ear cancer, Endometrial cancer, Eye cancer, Follicular dendritic cell sarcoma, Gallbladder cancer, Gastric cancer, Gastro esophageal junction cancers, Germ cell tumors, Gestational trophoblastic disease (GIT)), Hairy cell leukemia, Head and neck cancer, Hodgkin lymphoma, Kaposi's sarcoma, Kidney cancer, Laryngeal cancer, Leukemia, Gastric linitis plastica, Liver cancer, Lung cancer, Lymphoma, Malignant schwannoma, Mediastinal germ cell tumors, Melanoma skin cancer, Men's cancer, Merkel cell skin cancer, Mesothelioma, Molar pregnancy, Mouth and oropharyngeal cancer, Myeloma, Nasal and paranasal sinus cancer, Nasopharyngeal cancer, Neuroblastoma, Neuroendocrine tumors, Non-Hodgkin lymphoma (NHL), Esophageal cancer, Ovarian cancer, Pancreatic cancer, Penile cancer, Persistent trophoblastic disease and choriocarcinoma, Pheochromocytoma, Prostate cancer, Pseudomyxoma peritonei, Rectal cancer. Retinoblastoma, Salivary gland cancer, Secondary’ cancer, Signet cell cancer, Skin cancer, Small bowel cancer, Soft tissue sarcoma, Stomach cancer, T cell childhood non Hodgkin lymphoma (NHL), Testicular cancer, Thymus gland cancer, Thyroid cancer, Tongue cancer, Tonsil cancer, Tumors of the adrenal gland, Uterine cancer. Vaginal cancer, Vulval cancer, Wilms' tumor, Womb cancer and Gynaecological cancer. Examples of cancer also include, but are not limited to, Hematologic malignancies, Lymphoma, Cutaneous T cell lymphoma, Peripheral T cell lymphoma, Hodgkin's lymphoma, Non-Hodgkin's lymphoma, Multiple myeloma, Chrome lymphocytic leukemia, chronic myeloid leukemia, acute myeloid leukemia, Myelodysplastic syndromes, Myelofibrosis, Biliary tract cancer, Hepatocellular cancer, Colorectal cancer, Breast cancer, Lung cancer, Non-small cell lung cancer, Ovarian cancer, Thyroid Carcinoma, Renal Cell Carcinoma, Pancreatic cancer, Bladder cancer, skin cancer, malignant melanoma, merkel cell carcinoma, Uveal Melanoma or Glioblastoma multiforme. [000356] The nucleotide sequences encoding the TAAs to be expressed by a Sindbis viral vector as described herein are well known in the art and can be easily obtained from the literature. For example, the sequence of NY-ESO-1, a testicular antigen aberrantly expressed in human cancers was published in 1997 (http: / / www.pnas.org / content / 94 / 5 / 1914 full , Yao-Tseng Chen, Matthew J. Scanlant, Ugur Sahin, Ozlem Tiireci, Ali 0. Guret, Solam Tsangt, Barbara Williamsont, Elisabeth Stockertt, Michael Pfreundschuh, and Lloyd J. Old, PNAS 1997.), whereas the Carcinoembryonic antigen sequence was published in 1987 (http: / / mcb.asm.org / content / 7 / 9 / 3221.short Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen. N Beauchemin, .S. Benchimol, D Cournoyer, A Fuks and C P Stanners, Molecular and Cellular Biology. [000357] Although in mice a single i.p. injection of the SV / TAA as described herein, is sufficient to elicit a detectable CD8+ mediated immune response directed against the tumor, other regimens may be necessary for achieving a maximal response. For example, between 1 and about 8 i.p. injections over a time period of between 1 week and many weeks, with the possibility of injecting one or more booster injections 1 or more years later, may be preferably administered for a maximum effect. EXAMPLES [000358] Example 1: Sindbis with anti-OX40 enable immune responses to cold tumors [000359] This study, investigates the therapeutic efficacy of a replication-deficient oncolytic viral vector called Sindbis Virus. Because Sindbis Virus (SV) is a blood-borne pathogen, vectors from this virus can be administered in the bloodstream via the intravenous (i.v.) and intraperitoneal (i.p.) routes, which greatly facilitates their delivery [Tseng, JC, et al., Nature Biotech., 2004]. Furthermore, SV was genetically modified to be replication-defective by splitting its genome and deleting the packaging signal to block viral assembly after viral replication [Bredenbeek PJ, et al., J. Virol. 1993]. This study shows that SV expressing the pro- inflammatory cytokine IL-12 (SV .IL12) activates T cells as well as enhances the expression of 0X40 on CD4 T effector cells and, therefore, potentiates efficacy of the agonistic anti-OX40 antibody therapy. The data indicates that combination of SV.IL12 and anti-OX40 activates tumor immunity against low immunogenic tumors through the metabolic rewiring of T cells into highly activated effector cells. Furthermore, SV.IL12 in combination with anti-OX40 induces a marked immune cell infiltration into the tumor microenvironment. Considering that tumors tend to quickly escape the immune response by mutating or losing the expression of drug targets or tumor antigens targeted by the immune response, the treatment approach disclosed herein reduces the risk of developing tumor resistances and offers an attractive and safe strategy to change the immunogenic phenotype of various cancers without prior knowledge of tumor antigens. [000360] The studies presented herein describe several, non-limiting examples of anti-OX- 40 antibody, Sindbis viral vector (SV), Sindbis viral vector expressing IL-12 (SV.IL-12), Sindbis viral vector expressing an anti-OX-40 antibody and Sindbis viral vector expressing both IL-12 and an anti-OX-40 antibody. These examples are provided below to further illustrate different features of the present invention. The examples also illustrate useful methodology for practicing the invention. These examples do not and are not intended to limit the claimed invention. [000361] Materials and Methods [000362] Cell lines [000363] Baby hamster kidney (BHK), BALB / c colon carcinoma [CT26.WT (ATCC® CRL-2638™)] and FVB prostate carcinoma [MyC-CaP (ATCC® CRL-3255™)] cell lines were obtained from the American Type Culture Collection (ATCC). Firefly luciferase (Fluc)- expressing CT26 and MyC-CaP cells (CT26.Fluc and MyC-CaP.Fluc) were generated by stable transfection of pGL4.20 Fluc plasmid. [000364] BHK cells were maintained in minimum essential a-modified media (a-MEM) (Corning CellGro) with 5% fetal bovine serum (FCS, Gibco) and 100 mg / ml penicillin- streptomycin (Corning CellGro). CT26.Fluc and MyC-CaP Fluc cells were maintained in Dulbecco’s modified Eagles medium containing 4.5 g / l Glucose (DMEM, Corning CellGro) supplemented with 10% FCS, 100 mg / ml penicillin-streptomycin, 7.5 pg / ml Puromycin or 400 pg / ml Gentamycin, respectively. All cell lines were cultured at 37 °C and 5% CO2. [000365] SV Production [000366] SV-LacZ production and titering were done the same as previously described [ Scherwitzl I, Mal Ther Oncolytics. 2018]. SV.IL12 and SY Lacz vectors were produced as previously described [Subramanian A et al., Proc Natl Acad Sci US A. 2005; Leonard WJ et al., F1000Res. 2016; Rowell JF et al, J. Immunol. 1999; Metcalf TU et al., J. Virol. 2013]. All SV viral vectors used in these studies are replication-defective. Vectors were produced as previously described. SV.IL12 plasmid used in this study has been published in 2002 [Tseng JC et al., J Natl Cancer Inst. 2002]. To construct a Sindbis viral vector containing genes for interleukin 12 (IL- 12), the Sindbis viral vector SinRep / 2PSG was first constructed, which contains a secondary subgenomic promoter that is responsive to the Sindbis replicase. Two DNA oligonucleotide primers (sequence 5° CGCGTAAAGCATCTCTACGGTGGTCCTAATAGTGCATG-3’; SEQ ID NO: 29) and its complementary strand 5’CACTATTAGGACCACCGTCGAGATGCTTTA- 3’; SEQ ID NO: 30) containing the subgenomic promoter sequence were annealed and ligated into the Mlul and Sphl sites of the SinRep plasmid. The murine IL-12 a subunit gene (mp35; ATCC 87596) and the IL-12 B subunit gene (mp40; ATCC 87595) were subcloned into the Mlul and the Stul sites of SinRep / 2PSG, respectively, to produce the Sin-Rep / IL12 plasmid. [000367] SV empty is the same plasmid without an additional gene of interest (e.g.IL12). SV.Luc was generated as described [Tseng, JC et al., Nature Biotech., 2004]. SV.GFP was generated as published in 2012 [Suzme R et al., Cancer Gene Ther., 2012]. Briefly, plasmids carrying the replicon (e.g. SinRep-IL12 or SinRep-IL-12) or DHBB helper RNAs were linearized with Xhol. In vitro transcription was performed using the mMessage mMachine RNA transcription kit (Ambion). Helper and replicon RNAs were then electroporated into BHK cells and incubated at 37°C in oMEM supplemented with 10% FCS. After 12 hours, the media was replaced with OPTI-MEM (GIBCO-BRL) supplemented with CaCl2 (100 mg / l) and cells were incubated at 37°C. After 24 hours, the supernatant was collected, centrifuged to remove cellular debris, and frozen at —80°C. Vectors were titrated as previously described [Tseng JC et al., J. Natl. Can. Inst., 2002]. [000368] In vivo experiments and tumor models [000369] All experiments were performed in accordance with the Institutional Animal Care and Use Committee of New York University Health. Six to 12-week old female BALB / c mice were purchased from Taconic (Germantown, NY) and age matched male FVB / NJ mice were purchased from Jackson Laboratory. [000370] Tumor inoculation and animal studies [000371] Treatment started on day 4 after i.p. inoculation of 7 x 10* CT26 Fluc cells or 105 cells of MyC-CaP.Fluc in 500 ul OPTI-MEM. For treatments, mice were randomized and SV (107 TU / ml), in a total volume of 500 ul, was injected i.p. into the left side of the animal once for CT26.Fluc and 4 days a week (days 1, 2, 3, 4) for a total of 4 weeks for MyC-CaP Fluc inoculated mice. The immune checkpoint inhibitor anti-OX40 (clone OX-86, BioXCell) was injected i.p. into the left side of the animal at a dose of 250 pg per injection (1x / week for the CT26.Fluc and 3x / week for MyC-CaP Fluc tumor bearing mice). Therapeutic efficacy of the treatment was monitored in two ways: tumor luminescence and survival. Noninvasive bioluminescent imaging was performed using the IVIS Spectrum imaging system (Caliper Life Science) at the indicated time points and tumor growth was quantified using the Living Image 3.0 software (Caliper Life Science) as previously described 86. Relative tumor growth for each mouse was calculated dividing total body counts of a given day by total body counts of the first IVIS image. Survival was monitored and recorded daily. [000372] Flow cytometry [000373] For flow cytometry analysis, spleens and tumors were harvested from mice and processed as previously described [Scherwitzl I, et al., Mol. Ther. Oncol, 2018]. The extracted tumors were chopped into small pieces and incubated with a digestive mix containing RPMI with collagenase IV (50 ug / ml) and DNAse I (20 U / ml) for 1 hour at 37 °C. Tumor samples had additional hyaluronidase V (50 pg / ml) in the digestive mix. [000374] Spleens and digested tumors were mashed through a 70-um strainer before red blood cells were lysed using ammonium-chloride-potassium (ACK) lysis (Gibco). Cells were washed with PBS containing 1% FCS and surface receptors were stained using various antibodies. Fluorochrome-conjugated antibodies against mouse CD3, CD4, CD44, ICOS, 0X40, CD69, Foxp3, Granzyme B and Tbet, were purchased from Biolegend. Fluorochrome-conjugated antibodies against mouse CD8a were purchased from BD Biosciences. Mitotracker Deep Red FM, Mitotracker Green and Fluorchrome-conjugated antibodies against CXCR3 and Ki67 were purchased from Thermofisher. Stained cells were fixed with PBS containing 4% Formaldehyde. For intracellular staining, the forkhead box P3 (FOXP3) staining buffer set was used (eBioscience). Flow cytometry analysis was performed on a LSR II machine (BD Bioscience) and data were analyzed using FlowJo (Tree Star). [000375] ~~ T cell isolation [000376] Total T cells were freshly isolated with the EasySepTM mouse T Cell Isolation Kit. Freshly isolated lymphocytes were depleted of either CD4 or CDS specific T cells using EasySepTM mouse CD4 and CD8 Positive Selection Kits II. Isolation of T cells and depletions were performed according to the manufacturer’s protocols (Stemcell Technologies). [000377] Enzyme-Linked Immunospot (ELISPOT) [000378] Enzyme-linked immunospot was performed as previously described [Scherwitzl I, et al., Mol. Ther. Oncol, 2018]. Splenocytes and T cells were prepared as described for flow cytometry. Mouse IFNy ELISPOT was performed according to the manufacturer's protocol (BD Bioscience). Lymphocytes (4 x 105 cells) and isolated (8 x 104) T cells were plated per well overnight in RPMI supplemented with 10% FCS. No additional stimulus was used in the ELISPOT. As positive control, cells were stimulated with Sng / ml PMA+1pg / ml Ionomycin. [000379] Ex vivo cytotoxic assay [000380] T cells were isolated on day 7 and day 14 during treatment. 8 x 105 / ml T cells were co-cultured with CT26.Fluc cells (2 x 104 / ml) or MyC-CaP.Fluc cells (2 x 104 / ml) in a 24 well plate for 2 days in 1 ml RPMI supplemented with 10% FCS. Cells were washed with PBS and lysed with 100 ul of M-PER Mammalian Protein Extraction Reagent (Promega) per well. Cytotoxicity was assessed based on the viability of CT26 cells, which was determined by measuring the luciferase activity in each well. Luciferase activity was measured by adding 100 pl of Steady-Glo reagent (Promega) to each cell lysate and measuring the luminescence using a GLOMAX portable luminometer (Promega). [000381] CD8+ and CD4+ T-cell depletion in vivo [000382] CD8+ T cells were depleted using anti-CD8 antibody (clone 2.43) (Bio X cell, Lebanon, NH). 0.1 mg antibody in 0.2m! PBS was injected into each mouse, starting 1 day before the first SV treatment, and then every 4 days for 2 weeks. CD4+ T cells were depleted using anti-CD4 antibody (clone GK 1.5) (Bio X cell, Lebanon, NH). 0.4 mg were injected into each mouse, starting day 1 before the first treatment. Control mice were injected with PBS and isotype controls. [000383] Quantitative real-time PCR [000384] RNA was extracted from tumor samples using RNeasy Kit (Qiagen), followed by cDNA synthesis with the iScript II Kit (Bio-Rad). qRT-PCR was performed using iQTM SYBR Green Supermix (Biorad) and an StepOneTM Real-Time PCR Detection System (Applied Biosystems). PCR conditions were as follows: 95 °C for 10 min, followed by 40 cycles (94 °C for 30's, 58 °C for 30 s) of amplification. For quantitation, CT values were normalized to GAPDH and expression was analysed using the 2-AACT method. Primers for CXCL9, CXCL10 and GAPDH were used. CXCL9 (Forward: GAAGTCCGCTGTTCTTTTCC; SEQ ID NO: 25 Reverse: TTGACTTCCGTTCTTCAGTG; SEQ ID NO: 26), CXCL10 (Forward: GCTGCAACTGCATCCATATC; SEQ ID NO: 27; Reverse: AGGAGCCCTTTTAGACCTTT; SEQ ID NO: 28). [000385] Transcriptome analysis of T cells [000386] Total RNA was extracted from freshly isolated T cells on day 7 of treatment from spleens using RNeasy Kit (Qiagen). For each group, 3 BALB / C mice or 3 FVB / J mice were used for biological repeats. RNA-seq was done by NYUMC Genome Center. RNA quality and quantity was analyzed. RNAseq libraries were prepared and loaded on the automated HiSeq 4000 Sequencing System (Illumina) and run as single 50 nucleotide reads. [000387] Alignment and Differential Expression Analysis [000388] Sequences were aligned to the mm10 mouse genome using Bowtie software, Version 1.0.08” [Langmead R et al., Genome Biol. 2009] with two mismatches allowed. Uniquely mapped reads were further processed by removing PCR duplicates with Picard (“Picard Tools.” Broad Institute, GitHub repository. http: / / broadinstitute.github.io / picard / ) MarkDuplicates and transcripts were counted using HT Seq® and differential gene expression was performed between all groups using DESeq [Anders S et al., Genome Biol. 2010]. Differences in gene expression were considered significant if padj < 0.05. [000389] GSEA and Enrichment Map Analysis [000390] The network-based method enrichment map 90 was used for gene-set enrichment visualization and interpretation of data. As a follow up analysis of Gene-Set Enrichment Analysis2 (GSEA) [Mootha VK et al., Nat. Genet., 2003] it reduces redundancy and helps in the interpretation of large gene sets and helps to quickly identify major enriched functional themes in the gene expression data. To perform this analysis, we first assigned a unique row identifier for each transcript and obtained differentially expressed genes through DESeq [Anders Set al., Genome Biol. 2010]. These genes were then ranked and GSEA was performed in Gene Pattern 92 server using GSEA pre-ranked module. We then obtained the gene identifiers corresponding to the gene names using the Bioconductor package ‘org. Mm.eg.db’ and the resulting positively and negatively regulated gene identifiers were used to generate enrichment maps in Cytoscape [Shannon P et al., Genome Res. 2003]. Expression heatmap is drawn by Morpheus (https: / / software.broadinstitute.org / morpheus / ). Highest and lowest expression for each gene (row min. and row max.) were displayed as red or blue color, respectively. [000391] Measurement of Oxygen Consumption and Extracellular Acidification Rates of T cells [000392] T cell metabolic output was measured by Seahorse technology as previously described [Scharping NE et al., Cancer Immunol. Res., 2017]. Purified T cells were plated at 6x10° cells / well in a Seahorse XF24 cell culture microplate. Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) were measured using an Agilent Seahorse XFe24 metabolic analyzer following the procedure recommended by the manufacturer (Agilent). For the mitochondrial stress test, 1) oligomycin (1 uM), 2) FCCP (1.5 pM) and 3) rotenone (100 nM) and antimycin A (1 uM) were injected sequentially through ports A, B and C. [000393] Immunoblot analysis [000394] Cells were lysed in M-PER® Mammalian Protein Extraction Reagent according to the manufacturer’s protocol. Lysates were separated by SDS-PAGE on 4-12% Bio-Rad gels, transferred to polyvinylidene difluoride (PVDF) membranes, blocked in 5% Milk in TBS buffer with 0.1% Tween-20 (TBST). Primary antibodies to c-Myc (Santa Cruz Biotechnology) and GAPDH (Thermofisher) were added at room temperature or overnight at 4 °C. Secondary fluorescent antibodies (IRDye®, LI-COR) were added in 5% Milk in TBST for 1 h at room temperature. Odyssey® Classic Infrared Imaging System was used for visualization. [000395] Histochemistry and Multiplex immunofluorescence (MIF) [000396] Tumors of mice were collected, fixed in 4 % PFA for 2 days and embedded in paraffin, sectioned and H&E stained. For Multiplex immunofluorescence staining and imaging, five micron paraffin sections were stained with Akoya Biosciences® Opal™ multiplex automation kit on a Leica BondRX® autostainer, according to the manufacturers’ instructions. Prior to incubation with the first primary antibody, sections underwent heat retrieval with Bond Epitope Retrieval Buffer 2 (Leica ER2, AR9640) and blocking. Primary antibodies in Panel 1 were against CD3 (1:200, Biorad, MCA1477T), CD8 (1:2000, Cell Signaling, 989418), Ki67 (1:200, Abcam, AB16667). Primary antibodies in Panel 2 recognized iNos (1:1000, Genetex, GTX130246), Argl (1:750, Genetex, GTX109242), Granzyme B (1:1000, Abcam, AB4059), CD11b (1:10,000, Abcam, AB133357), F480 (1:250, Cell Signaling, 70076S). Each primary antibody was followed by a cocktail of horse radish peroxidase-conjugated secondary antibodies against mouse and rabbit IgG (RTU, Akoya / Perkin Elmer, Cat# ARH1001) and then tyramide mediated signal amplification (TSA) with covalent linkage of the individual Opal fluorophor (each 1:250, Opal 520 (FP1496001KT), 540 (FP1487001KT), 570 (FP1494001KT), 620 (FP1488001KT), 650 (FP1495001KT) or 690 (FP1497001KT), Akoya / Perkin Elmer Cat#’s) to the tissue antigen. Antibodies were subsequently stripped using either ER1 (Leica, AR9961) or ER2 (Leica, AR9640) heat retrieval buffer and the next round of immunostaining initiated. After completion of the sequential incubations and stripping, slides were counterstained with spectral DAPI (Akoya / PerkinElmer, FP1490). Monoplex controls were used to confirm appropriate staining for antibodies integrated into the multiplex panels. Multispectral imaging was performed on a Vectra3 imaging system (Akoya / PerkinElmer) at 20x. The fluorophore emission signatures were captured by a multispectral camera and then unmixed with InForm software (Akoya / PerkinElmer). Autofluorescence, obtained from an unstained slide, was removed from the composites and pseudo-colored images exported as tif files. [000397] Statistical analysis [000398] Statistical analysis was performed using GraphPad Prism 7.0 as described in Figure legends. All data are shown as mean+s.e.m. Figures were prepared using GraphPad Prism 7, Adobe Photoshop and ImageJ Software. Treated groups were compared, using a one-way analysis using Prism7 (GraphPad Software), to naive mice. Differences with a P value of <0.05 were considered significant: ¥P<0.05; **P<0.005; ***P<0.0001. [000399] SV expressing IL-12 enhances the expression of 0X40 on CD4 T cells [000400] The study described herein investigated the therapeutic effect of SV.IL12 in immune-competent tumor bearing mice (colon cancer; CT26). To exploit SV.IL12 for cancer therapy, tumor cells were i.p. implanted and after tumor establishment (4 days after tumor cell injection [day 0]), SV, SV.IL12 or IL-12 were i.p. injected on 4 consecutive days (day 1, 2, 3 and 4) for a total of 4 weeks (FIGs. 1A and B). While untreated (control), SV and IL-12 treated mice succumb to cancer after 3 weeks, treatment with SV.IL12 slightly prolonged survival time with an overall long-term survival rate of 7.1%. These data suggest that SV expressing IL-12 is needed to induce the observed therapeutic efficacy. Shortly after i.p. injection, SV infects macrophages in mediastinal lymph nodes where T cells get subsequently activated (FIG. 2). Even though SV.IL12 infected cells secrete significant amounts of IL-12 as observed in in vitro experiments (FIG. 3A), i.p. injection of SV.IL12 did not significantly change levels of plasma IL-12 in mice (FIG. 3B). Thus, suggesting that IL-12 produced by SV acts locally and stimulates transduced macrophages (FIG. 2) that present tumor antigens to corresponding T cells and activates them further. That shapes the subsequent anti-tumor immune response, such as promoting the differentiation into Th1 cells as well as increasing IFNy production (FIGs. 3C and 3D) 27:28.2%.30_ After one week of treatment, we analyzed the T cell response for their expression of inhibitory and activation markers. 0X40 was markedly upregulated on CD4 T cells during SV.IL12 treatment, which was mostly among the effector CD4 T cells and less on the regulatory T cells (FIGs. 1C and 1D). Interestingly, SV treatment also induced OX40 upregulation on CD4 T cells but to a lesser extent (FIGs. 1C and 1D). On the basis of the results above and previous studies, reporting a beneficial effect of anti-OX40 in cancer treatment [Aspeslagh S et al., Eur. J Cancer, 2016], it was hypothesized that the agonistic anti-OX40 antibody could augment the therapeutic efficacy of SV.IL12 and and help induce anti-tumor immune responses without to require knowledge of the tumor antigens. [000401] Intraperitoneal delivery of SV.IL12 and anti-OX40 antibody cures established cancers [000402] To investigate whether the oncolytic activity of SV.IL12 in combination with anti-OX40 is required for successful anti-cancer therapy, SV non-susceptible (colon cancer; CT26) and susceptible (prostate cancer, MyC-CaP) tumor cell lines were used in this study (FIG. 4) [Granot T et al., Mol. Ther., 2014; Huang PY et al., Mol. Ther., 2012] Immuno-competent female BALB / c and male FVB / NJ mice were implanted with either CT26 or MyC-CaP tumor cell lines, which expressed the firefly luciferase (Fluc) protein, respectively. This allowed monitoring tumor growth in vivo using noninvasive bioluminescent imaging. Once tumors became established (day 0), mice were treated with SV.IL12 in combination with anti-OX40. SV.IL12 was i.p. injected on 4 consecutive days (day 1, 2, 3 and 4) for a total of 4 weeks (FIG. 5A). Anti-OX40 was injected 3 times a week (day 0, 2 and 4) for a total of 2 weeks. In both tumor models, all untreated animals experienced progressive tumor growth and succumbed to cancer on week 3 (FIGs. 5 and 6). Mice bearing CT26.Fluc or MyC-CaP.Fluc tumors showed some delay in tumor growth when treated with i.p. injected SV.IL12 or anti-OX40 alone but with only a moderate effect on long-term survival (FIGs. 5 and 6). However, the combination of SV.IL12 with anti-OX40 resulted in complete regression of tumors in both tumor models (FIGs. 5 and 6). Tumors occasionally did recur in mice treated with combination therapy after treatment was completed, resulting in a long-term survival rate of 91.6% and 50% in the CT26 and MyC- CaP tumor model, respectively. In conclusion, combination of SV.IL12 with anti-OX40 elicits a strong therapeutic efficacy against two distinct solid tumors. Furthermore, these findings confirm that the oncolytic activity of SV is not required to induce a robust and effective anti-tumor response. Due to the fact that anti-OX40 monotherapy already resulted in a 20-50% survival rate, whether the addition of SV.IL12 would allow reduction of treatment frequencies while still maintaining the strong therapeutic efficacy of combination therapy, was investigated. This is especially important for lowering risks of adverse events as well as being more convenient for patients in clinics. Interestingly, therapeutic efficacy in the CT26.Fluc tumor model was maintained with only one injection per week of SV.IL12 and anti-OX40 (Fig. 7). This is in contrast with MyC-CaP.Fluc tumor bearing mice for which the full treatment regimen was required (data not shown). Thus, in the following experiments mice bearing CT26 tumors were treated with one injection a week whereas MyC-CaP tumor bearing mice received the full treatment regimen. [000403] Combination therapy markedly changes the transcriptome signature of T cells [000404] The requirement of T cells during SV.IL12 with anti-OX40 treatment was assessed. The presence of both CD4 and CD8 T cells was required for eliciting the observed therapeutic efficacy as mice treated with the corresponding depleting antibodies were unable to control tumor growth (FIG. 8). To better understand the impact of the combination therapy on T cells, RNA sequencing was performed on isolated T cells from spleens derived from naive, control as well as anti-OX40 and SV with or without anti-OX40 treated mice on day 7. Principal component analysis (PCA) of normalized reads showed a distinct segregation between combined therapy and all other groups in both tumor models (FIGs. 9A and 9B). These data suggest that combined therapy induces a distinct T cell response in the periphery independently of tumor model and mouse strain suggesting an indirect and immunity driven role of SV vectors with a negligible direct effect of the vector in tumors (FIG. 9C). Indeed, gene expression profiles of control versus anti-OX40, SV or SV in combination with anti- 0X40 were clearly distinct, with the most differentially expressed genes (DEG) in the latter one (503, 49 and 2100 DEG, respectively) (FIG. 9C). Of 2100 DEG in control versus combination therapy, more genes were downregulated than upregulated (1637 vs. 463) > two- fold. Similarly, in control versus anti-OX40 as well as control versus SV more DEG were downregulated than upregulated (393 versus 110 and 30 versus 19, respectively). [000405] Unbiased pathway enrichment and network analyses of DEG from control versus combination therapy was performed to determine biological processes in T cells that are influenced by this treatment (FIG. 9D). Although both upregulated and downregulated DEG were included in the analysis, the vast majority of pathways were upregulated in T cells treated with combination therapy with the exception of four clusters (TGFbeta signaling, ribosomal biogenesis, translation and chromatin modification). The upregulated pathways were dominated by DNA replication, chromosomal organization and cell cycle regulation, but also included various metabolic and immunological processes, such as mitochondrial respiration, nucleotide metabolism, and adaptive immune responses. [000406] Combination therapy enhances systemic T cell responses, favoring Th1 like ICOS CD4 T cells [000407] As T cells from combination therapy express a marked change in their transcriptome signature compared with all other groups, markers for T cell differentiation and activation (e.g., PD-1, ICOS, 0X40, TIM3, KLRGI, IL7R) as well as T cell lineage transcription factors (e.g., EOMES, TBET, GATA3, BCL6, RORC, FOXP3) were analyzed (FIG. 9E). Only T cells from combined therapy expressed the gene signature of terminally differentiated effector T cells, which are characterized by high expression of the killer lectin-like receptor (KLRG1) and low expression of the interleukin 7 receptor (IL-7R) [Joshi NS et al., Immunity, 2007]. Furthermore, genes encoding products associated with the differentiation and function of effector cells, such as Batf, Id2, Thet, Gzmb and [fng, were also highly expressed in T cells isolated from mice treated with combined therapy compared with all other groups. The enhancement of effector T cells in combined therapy was confirmed by flow cytometry in both tumor models, as judged by the increased expression of the activation and proliferation markers CD44 and Ki-67, respectively (FIGs. 9F, 9G and 10). Interestingly, CD4 T cells also expressed a marked anti-tumor effector phenotype (ICOS Tbet™) which was on average 2 to 3-fold higher during combined therapy compared with SV.IL12 or anti-OX40 treatment (FIGs. 9H and 91). Previous studies reported a correlation between expansion of ICOS Tbet” CD4 T cells and clinical benefit in cancer patients who received anti-CTLA4 therapy [Wei SC et al., Cell, 2017, Ng Tang G et al., Cancer. Immunol. Res. 2003; Carthon BC et al, Clin. Cancer Res., 2010]. In summary, SV.IL12 in combination with anti-OX40 induces a marked systemic T cell response and favors the differentiation of terminal effector T cells. Furthermore, combined therapy induces a sustained increase in the frequency of ICOS Tbet™ CD4 T cells which has also been reported to be elevated during successful anti-CTLA4 cancer therapy. [000408] CD4 and CDS T cells are metabolically reprogrammed in mice treated with SV.IL12 and anti-OX40 [000409] The tumor microenvironment can be a very challenging milieu for an effector T cell as it is characterized by hypoxia, acidosis and low levels of nutrient sources such as glucose and glutamine [Delgoffe, GM et al, Cancer Immunol. Res., 2016; Scharping, N.E, Vaccines, 2016; Chang, CH et al, Cell, 2015]. Even if T cell activation and initiation of effector function is allowed, T cells may be unable to generate the bioenergetic intermediates necessary to carry out effector function in the tumor microenvironment. Thus, providing a metabolic support for T cells is crucial for the success of cancer treatments as previously reported [Scharping, N.E. et al., Immunity, 2016; Ho, PC et al., Cell, 2015; Siska PJ., et al, Trends immunol., 2015; Zhao et al., Nat. Immunol, 2016]. To test if SV.IL12 in combination with anti-OX40 influences the metabolic state of T cells, Gene Set Enrichment Analysis (GSEA) of the RNA sequencing data was performed between T cells from combined therapy and control. GSEA analysis showed significantly higher expression of genes involved in oxidative phosphorylation and glycolysis pathways during combination therapy (FIG. 11). To confirm GSEA analysis, peripheral T cells from both tumor models were metabolically profiled using Seahorse analysis on day 7 (FIGs. 11B, 12A and 12B). Oxidative phosphorylation and glycolytic profiles in T cells from naive, control and mice treated with SV.IL12 and / or anti-OX40 were determined by measuring the rate of oxygen consumption (OCR) and the rate of extracellular acidification (ECAR), respectively. Basal OCR was enhanced in T cells from combined therapy and SV.IL12 treatment, but only the former harbored a dramatic increase in spare respiratory capacity in the CT26 model (FIGs. 11B and 12A). This was in contrast to T cells from combined therapy in the MyC-CaP.Fluc tumor model which expressed 3.75-fold higher basal OCR with no spare respiratory capacity (Fig. 12B). The reason for this discrepancy between the two models might be the differences in the number of treatments as MyC-CaP Fluc bearing mice receive 3 and 4 times more injections of anti-OX40 and SV.IL12, respectively. [000410] Analysis of mitochondrial mass (FIGs. 11C and 12C) and activity (FIGs. 11D and Fig. 12C), using flow cytometry with the mitochondrial stain Mitotracker Green and DeepRed respectively, revealed that SV.IL12 with or without anti-OX40 induced higher mitochondrial mass and activity in CD8 T cells but not in CD4 T cells. These data suggest that the observed increase in basal OCR was mainly driven by CD8 T cells. Interestingly, a slight decrease of active mitochondria occurred in CD4 T cells from mice treated with combined therapy, which might explain the increase in spare respiratory capacity in this group. To test if the reduction of active mitochondria in CD4 T cells is associated with a switch towards glycolysis, the master regulator for glycolysis ¢-MYC and basal ECAR were measured in T cells from all groups. Indeed, the addition of anti-OX40 to SV.IL12 induced elevated protein expression of c-MYC as well as basal ECAR (FIG. 11E and 11F). T cells from naive and control as well as SV.IL12 or anti-OX40 treated mice showed no signs of elevations. Collectively, these findings reveal that SV.IL12 induces enhanced oxidative phosphorylation in CD8 T cells, whereas the addition of anti-OX40 to SV.IL12 is needed to push CD4 T cells towards glycolysis by increasing the protein expression of ¢-MYC. [000411] To determine the kinetics of peripheral T cell metabolism over the course of treatment with SV.IL12 and anti-OX40, OCR and ECAR were measured on day 7, 14 and 40 in CT26.Fluc bearing mice (FIG. 11G). As shown above, T cells on day 7 shifted towards a glycolytic state which is associated with the initial effector phase. Two weeks into the treatment, T cells switched to a highly energetic state utilizing both metabolic pathways, oxidative phosphorylation and glycolysis, as reported for highly activated T cells [Buck MD et al., J. Exp. Med., 2015] Once tumors were fully rejected and mice were tumor-free for a month, T cells returned to a more quiescent state, such as naive cells. Interestingly, T cells from MyC-CaP.Fluc bearing mice switched to a highly energetic state early on during treatment (day 7) and remained in this metabolic phenotype 2 weeks after treatment has stopped (FIG. 12D). The reason for this discrepancy might be the differences in the number of treatments applied in both tumor models as MyC-CaP Fluc bearing mice receive 3 and 4 times more anti-OX40 and SV.IL12, respectively. T cells from control as well as anti-OX40 or SV.IL12 treated mice in both tumor models remained in a quiescent state over the course of treatment (FIG. 12E). In summary, SV.IL12 in combination with anti-OX40 metabolically rewires T cells to an energetic state using both metabolic pathways, oxidative phosphorylation and glycolysis. This phenotype does not occur in SV.IL12 or anti-OX40 treated mice, which succumb to cancer. Thus, the changed metabolic state of T cells correlate with an efficient anti-tumor response and better survival rate. [000412] Metabolic reprogrammed T cells in SV.IL12 with anti-OX40 treated mice display enhanced CD4 mediated cytokine production and anti-tumor activity [000413] To test if metabolic reprogrammed T cells in combined therapy possess enhanced effector functions, cytokine production and cytotoxicity were analyzed in T cells isolated from spleens on day 7. Genes encoding pro-inflammatory cytokines ifing and # / 2 were upregulated in T cells from mice treated with SV in combination with anti-OX40 (FIG. 13A). ELISPOT analysis of interferon-y (IFNy) by splenocytes confirmed RNA sequencing data, showing the strongest IFNy secretion in mice treated with combined therapy in both tumor models (FIGs. 13B and 13C). Splenocytes from SV.IL12 treated mice also produced IFNy but to a lesser extent. Interestingly, the main producer of IFNy were CD4 T cells as depletion of CD4 T cells but not CD8 T cells abolished IFNy secretion in splenocytes from mice treated with combined therapy. [000414] In addition, RNA levels of the cytotoxic proteases, granzyme A and B, were upregulated in mice treated with combination therapy compared with all other groups (FIGs. 13A). Protein expression of granzyme B correlated with RNA levels as measured by flow cytometry in both tumor models (FIGs. 13D, 13E, and 14A-14D). Further, granzyme B positive cells were detected in CD8 as well as CD4 T cells, suggesting the presence of cytotoxic CD4 T cells in mice treated with combined therapy [Brown DM et al., Cell Immunol, 2010; Mucida D. et al., Nat Immunol, 2013; Reis BS et al., Nat Immunol 2013] Upregulation of granzyme B was associated with downregulation of the transcription factor Foxol which is known to control granzyme transcription through repression of the transcription factor T-bet (FIG. 13A) [Rao RR et al., Immunity, 2012]. Last, the enhanced cytotoxic potential of T cells from combined therapy was also supported by elevated expression of the NKG2D receptor which has been shown to trigger TCR-independent cytotoxicity in activated T cells (FIG. 13A, 14E and 14F) [Verneris MR et al., Blood 2004], [000415] Having observed upregulation of granzymes and cytotoxic receptors in combination therapy, the function of T cells was investigated using an ex vivo tumor growth assay. Splenocytes obtained from all groups were co-cultured at an effector-to-target cell ratio of 10:1 with either CT26.FLUC (FIG. 13F) or MyC-CaP.Fluc (FIG. 13G) tumor cell lines. The anti-tumor activity of splenocytes was determined by measuring the luciferase activity of cell lines, which correlates with tumor growth. Tumor growth was markedly reduced when co- cultured with splenocytes from mice receiving combined therapy compared with splenocytes from naive, control and mice treated with anti-OX40 in both tumor models. The anti-tumor activity of splenocytes from mice treated with SV. IL12 alone was weaker than that from combined therapy. Surprisingly, tumor growth inhibition was mediated by CD4 T cells as depletion of CD4 T cells but not CD8 T cells abolished the inhibitory effect on tumor cells. Together, these results clearly show that T cells from combined therapy elicit enhanced anti- tumor and functional activity, such as granzyme B and IFNy production driven by CD4 T cells. [000416] Mice treated with SV.IL12 in combination with anti-OX40 display enhanced T cell migration and intratumoral T cell immunity [000417] Only a minority of the total of treated patients respond to current immunotherapy and the presence of TILs has been shown to be one of the main factors that influence the responsiveness towards various therapies in multiple cancers [Galon, J et al., Science 2006; Hwang WT et al., Gynecol Oncol 2012]. Due to the fact that SV elicited anti-tumor responses do not necessarily require direct infection of the tumor or intratumoral injection, whether SV.IL12 therapy in combination with anti-OX40 could nevertheless alter the local tumor microenvironment and favor intratumoral immunity, was invetsigated. To assess whether SV.IL12 in combination with anti-OX40 induces T cell infiltration into the tumor, the chemokine receptor CXCR3 on peripheral T cells was analyzed after one week of treatment. In the CT26.Fluc model CXCR3 levels were significantly upregulated on CD4 T cells during combination therapy compared with all other groups and CXCR3 levels remained elevated over the course of treatment (FIG. 15A, 15B and 16A). In contrast, CXCR3 expression on CD8 T cells only appeared later on in treatment, suggesting that CD4 T cells are first recruited to the inflamed site followed by CD8 T cells (FIG. 16A). MyC-CaP.Fluc tumor bearing mice showed elevated levels of CXCR3 on CD4 and CD8 T cells after one week of combination treatment (FIGs. 16B and 16C). Furthermore, SV.IL12 treatment also increased CXCR3 expression on T cells but to lesser extent. The reason for this discrepancy between the two models might be the differences in the number of treatments as MyC-CaP.Fluc bearing mice receive 3 and 4 times more injections of anti-OX40 and SV.IL12, respectively. Cells expressing CXCR3 follow the gradient of their ligands CXCL9, CXCL10 and CXCL11 [Groom, J.R. & Luster, A.D. Exp. Cell Res. 2011]. Indeed, combination therapy also enhanced the production of CXCL9 and CXCL10 in the tumor microenvironment, as judged by real-time PCR, suggesting that CXCR3 positive T cells migrate to the tumor site (FIG. 15C). Treatment of SV.IL12 or anti-OX40 alone did not alter the expression of these ligands. In line with these observations, an overall increase in T cells was observed in CT26.Fluc and MyC-CaP.Fluc peritoneally disseminated tumors from mice treated with combined therapy compared with control and anti-OX40 treated mice (FIGs. 15E and 15F). SV.IL12 treated mice also showed enhanced T cell infiltration but to a lesser extent. Furthermore, dissecting CD4 and CD8 T cells by flow cytometry revealed that combination therapy increases the proportion of CD4 T cells in CT26.Fluc tumors, which is consistent with the elevated CXCR3 expression on peripheral CD4 T cells (FIGs. 15D). These results clearly show that SV.IL12 in combination with anti-OX40 alter the tumor microenvironment by facilitating T cell infiltration via modulation of the CXCR3 / CXCL9-11 axis. Not only did combination therapy increase T cell infiltration in both tumor models but CD4 as well as CD8 T cells also demonstrated enhanced functional activity in the tumor, as judged by the Ki-67 and granzyme B expression (Figs. 15D, 16D and 17). In line with these results, a decrease in proliferation, as judged by the expression of Ki-67 in tumor cells, was observed in CT26.Fluc and MyC-CaP Fluc tumor cells when treated with combined therapy compared with all other treatments (FIGs. 15E and 15F). These results suggest that the presence of activated T cells in the tumor microenvironment exert anti-tumor activity which inhibits tumor growth. Besides from T cell activation, we also observed enhanced iNOS production in MyC-CaP Fluc tumors treated with combination therapy compared with control or anti-OX40 treatment (FIG. 18). SV.IL12 treatment alone also induced iNOS production but to a lesser extent. Interestingly, the amount of iNOS inversely correlated with ariginasel production, suggesting a repolarization of tumor associated macrophages from the M2-like (pro-tumor) into M1-like (anti-tumor) phenotype during combination therapy. These trends were only observed in MyC-CaP.Fluc and not in CT26.Fluc tumors, which might be a consequence of SV directly infecting MyC-CaP cells. [000418] The study described herein provides a practical strategy for cancer immunotherapy using an OV and anti-OX40. This strategy takes advantage of the preexisting T cell immune repertoire in vivo, removing the need to know about present tumor antigens. The study described herein shows that the combination of replication-deficient SV.IL12 and anti- 0X40 amplifies these antitumor T cells and induces their action throughout the body against two distinct solid tumors, reversing effectively local tumor-mediated immune suppression. This effect was specific for combination therapy and was not observed during SV.IL12 or anti-OX40 treatment alone. [000419] The high metabolic activity of cancer cells together with the poor vasculature blood supply in the tumor microenvironment can induce nutrient deprivation [Delgoffe, GM et al., Cancer Immunol Res. 2016; Scharping, NE & Delgoffe, GM, Vaccines, 2016; Chang, CH et al,, Cell, 2015]. These conditions can impair TCR signaling, glycolytic and mitochondrial metabolism, as well as decrease mitochondrial mass, all hallmarks of T effector cells, resulting in impaired anti-tumor effector functions of tumor-specific T cells. 39-42 Scharping, N.E. et al., Immunity 2016; Ho, P.C. et al., Cell 2015; Siska, PJ & Rathmell, JC, Trends Immunol., 2015; Zhao, E. et al., Nat Immunol, 2016]. The data in two distinct models of cancer immunotherapy disclosed in the study described herein, shows that SV.IL12 in combination with OX40 signaling provides the necessary metabolic support to T cells to generate an efficient antitumor response. This metabolic support is characterized most prominently by elevated mitochondrial function and mass in CD8 T cells as well as a switch to aerobic glycolysis in CD4 T cells. T cells from mice treated with SV.IL12 in combination with anti-OX40 demonstrated enhanced protein expression of c-Myc compared with all other groups. Thus, the study described herein clearly shows that T cells are metabolically reprogrammed in the periphery during combination therapy. [000420] The study described herein strongly shows that the therapeutic efficacy of SV.IL12 with anti-OX40 is driven by T cell modulation and reprogramming of its metabolic state, in order to enhance the anti-tumor response in the periphery and in the tumor microenvironment. Furthermore, the use of SV allows these metabolically reprogrammed T cells to better infiltrate the tumor microenvironment, which is crucial for an adequate immunotherapy. Anti-OX40 antibody is currently being studied in phase 1 and 2 clinical trials. SV will be tested as a single agent in its first clinical trial in the third quarter of 2020. The results from our current preclinical studies provide a strong rationale for combining SV.IL12 with agonistic anti-OX40 antibodies in a therapeutic format in patients with solid tumors. In summary, the studies described herein clearly show that even in absence of direct SV tumor targeting, SV.IL12 in combination with anti-OX40, or SV vector encoding IL-12 and anti-OX40, can alter the tumor microenvironment in distinct solid tumors through an indirect and immunity driven mechanism that enhances T cell infiltration and intratumoral T cell immunity. [000421] Example 2: Combination of IL-12 and anti-OX40 expressed by Sindbis viral vectors synergistically enhances survival of subjects with established tumors. [000422] The study described herein investigates the effect of administering IL-12 and anti- 0X40 antibody, both expressed by Sindbis viral vectors, on established tumors. This strategy is particularly advantageous for treatment of cancers like ovarian cancer, wherein the combination of SV.IL-12 and anti-OX40 antibody is not found to be as effective, as observed in colon and prostate cancers. The administration of SV / IL-12 and an anti-OX40 antibody enhanced clearance of established tumor of colon and prostate cancer cell lines, CT26 and MyC-Cap respectively. C57 / BI6 albino (female) mice re-injected with Alm5-2Fluc-17 ovarian cancer cells to establish a tumor (FIG. 19), and treated with: a) a SV vector expressing [L-12; b) a combination of SV vectors expressing IL-12 and an anti-OX-40 antibody (aOX40 REP-IL12), c) a 50% mixture of either a fragmented SV expressing OX-40 IgG plus a fragmented SV expressing IL-12 (RepOX40IgG_Rep-IL12 ) or d) a 50% mix of a fragmented SV expressing 0X-40 IgG plus a full length SV expressing IL-12 (RepOX40IgG_SV-IL12). The percentage survival rate of the treatment groups RepOX40IgG_SV-IL12 and aOX40_Rep-IL12 were comparable, and higher than the SV-IL-12 and RepOX40IgG_Rep-IL12 treatment group. However, the results showed that, the RepOX40IgG_SV-IL12 treatment group showed the highest enhancement of survival rate (FIG. 20). [000423] The study described herein, provides plasmid constructs for expressing IL-12, and anti-OX40 in a SV vector. The study described herein, provides plasmid constructs encoding IL- 12 a and b subunits (FIG. 38), anti-OX40 IgG2a heavy and light chains (FIG. 39) and a single chain antibody to 0X40 (FIG. 40). [000424] SV.IL12 plasmid used in this study has been published in 2002 [Tseng JC et al., J Natl Cancer Inst. 2002]. To construct a Sindbis viral vector containing genes for interleukin 12 (IL-12), the Sindbis viral vector SinRep / 2PSG was first constructed, which contains a secondary subgenomic promoter that is responsive to the Sindbis replicase. Two DNA oligonucleotide primers (sequence 5° CGCGTAAAGCATCTCTACGGTGGTCCTAATAGTGCATG-3’; SEQ ID NO: 29) and its complementary strand 5’CACTATTAGGACCACCGTCGAGATGCTTTA- 3’; SEQ ID NO: 30) containing the subgenomic promoter sequence were annealed and ligated into the Mlul and Sphl sites of the SinRep plasmid. The murine IL-12 a subunit gene (mp35; ATCC 87596) and the IL-12 B subunit gene (mp40; ATCC 87595) were subcloned into the Mlul and the Stul sites of SinRep / 2PSG, respectively, to produce the Sin-Rep / IL12 plasmid. [000425] The H and L chains of the 0X40 Ab are expressed from a single SV using two subgenomic promoters. The synthesized sequences were designed to encode an IL-12 secretory signal peptide upstream of both H and L polypeptide sequences preceded by a ribosome binding site and the start codon. The variable Ab binding sequences that functionally bind to activate the 0X40 Receptor contain complementarity determining regions that are not unique. The variable chain is linked to the respective L (GenBank accession BAR42292) and H chain (GenBank accession CAC20702) constant region sequences of mouse IgG2a; the murine IgG2a isotype is comparable to the BioXcell 0X40 Ab used in parallel in vivo experiments. [000426] In summary results described herein clearly show the possibility of using a combination of SV vectors expressing IL-12 and anti-OX40 antibody or a SV vector expressing both expressing IL-12 and anti-OX40 antibody, for treatment of cancers that may be resistant to treatment with anti-OX40 antibody administered directly. [000427] Example 3. Molecular and metabolic pathways mediating curative treatment of a non-Hodgkin B cell lymphoma by Sindbis viral vectors and anti-4-1BB monoclonal antibody. [000428] The studies described herein use an antibody directed at 4-1BB (CD137, TNFRSF9), a T cell costimulatory molecule. 4-1BB agonist stimulation greatly enhances NK and cytotoxic T cell activity. There are preclinical studies showing that a4-1BB effectively treats lymphoma and that depletion of Treg cells enhances the therapeutic effect of a4-1BB [Houot R et al, Blood, 2009]. The A20 tumor cells uses in the study described herein were derived from a spontaneously arising reticulum cell sarcoma (a non-Hodgkin lymphoma) in a BALB / c mouse. [000429] Previously, SV carrying NYESO-1 was used, which encodes the cancer testis TAA, NYESO-1, to cure CT26 tumors expressing NYESO-1 [Scherwitzl I et al., Mol. Ther. Oncolytics, 2018]. The studies described herein show that systemically disseminated A20 lymphoma can be completely cured by SV plus a4-1BB mAb combination therapy without the need to produce a SV that encodes a TAA known to be present in the A20 lymphoma cells. Further, neither intratumoral injection of the SV vectors nor infection of the tumors is required as the A20 B lymphoma cells used in the current model are resistant to SV infection. [000430] One difference in the current study, compared with those previously published, is the use of SV vector combination therapy that involves an agonistic mAb for a costimulatory receptor versus targeting checkpoint blockade molecules such as CTLA4 and PD- 1. The studies described herein show that agonistic mAbs in combination with SV vectors trigger a cascade of events that results in curative results. The findings disclosed herein reveal the potential of SV combination therapy to cure tumors for which TAAs are completely unknown. [000431] Materials and Methods [000432] Firefly luciferase (Fluc)-expressing A20 cells generation [000433] A20 cells were transfected with pGL4-neo_Fluc plasmid (Promega) by electroporation via Nucleofector™ kit V (Lonza). Fluc-A20 cell clones were selected and maintained in RPMI1640 (Cellgro) + 10% FBS (Gibco) + 250 pg / ml G418 (Gibco). One A20 clone stably expressed fLuc and was used for tumor inoculation and consecutive experiments. [000434] SV production [000435] SV-LacZ production and titering were done the same as previously described [ Scherwitzl I et al., Mol. Ther. Oncolytics, 2018]. [000436] SV-GFP infection [000437] A20 cells and control BHK cells were infected by SV carrying GFP for 1 h. The GFP expression was observed the next day by fluorescence microscopy. [000438] A20 tumor inoculation and In Vivo Imaging System (IVIS) Imaging [000439] 3 x 10° fLuc-A20 cells were inoculated to BALB / C mice by i.p injection. Tumor growth was monitored as previously described [Scherwitzl I et al., Mol. Ther. Oncolytics, 2018]. [000440] SV and a4-1BB Ab treatment [000441] Treatment was started after successful tumor inoculation (4 days after tumor cell injection, confirmed by IVIS imaging). Tumor growth was measured every week by noninvasive bioluminescent imaging. SVLacZ was injected 4 times per week, for totally 3 weeks. The virus (107-10® TU / mL) in a total volume of 500 uL was i.p. injected. For 2 groups (4-1BB and SV plus 4-1BB), 350 ug / mouse 41BB Ab was injected 3 times / week for 2 weeks. InVivo MAb anti- mouse 4-1BB was ordered from BioXCell (Clone: LOB12.3, Cat.No. BE0169). In low dose treatment protocol, SVLacZ was injected i.p. 3 times per week, for totally 3 weeks. 41BB Ab (50 ug / mouse) was injected once a week for 3 weeks. [000442] Elispot [000443] Mouse IFNy ELISPOT was performed according to the manufacturer's protocol (BD Biosciences). 2 x 10° splenocytes or 1 x 10° T cells were plated per well O / N in RPMI supplemented with 10% FBS. For a positive control, splenocytes were stimulated with 5 ng / ml PMA + 1 ug / ml Ionomycin. [000444] Flow cytometry [000445] Fluorochrome-conjugated antibodies against mouse CD3, CD4, CD8, CD25, CD44, CD62L, ICOS, CD11a, ICAM-1 were purchased from Biolegend (San Diego, CA). Fluorochrome-conjugated antibodies against mouse Foxp3, EOMES and CCRS were purchased from Thermofisher. BUV395 conjugated antibody against mouse CD8a was purchased from BD Biosciences. For surface staining, cells were washed and stained with anti-mouse direct conjugated antibodies. Cells were analyzed using the LSRII flow cytometer (BD Biosciences) and data were analyzed using Flowjo software (Treestar, Ashland, OR). For intracellular cytokines staining, stimulated cells were fixed with cytofix / cytoperm solution (BD Biosciences), permeablized with perm / wash buffer (BD Biosciences) and stained with anti-mouse IFNy antibodies. For nuclear antigen, cells were fixed and permeabilized by Foxp3 fixation / permeabilization buffer (eBioscience) and stained with anti-Foxp3, T-bet, Ki67 and EOMES antibody. [000446] RNA isolation and transcriptome analysis [000447] Total RNA was harvested by RNAeasy isolation kit (Qiagen, Valencia, CA). For each group, 3 BALB / C mice were used as biological repeats. RNA-seq was performed by NYUMC Genome Technology Center (GTC). To identify significant differences in expression between any pair of groups, differential expression analysis was performed using Deseq?2 and an adjusted p value cutoff of 0.05 was applied [19, Love MI et al, Genome Biol. 2014] (q < 0.05). To increase stringency, only genes with a Log2 fold change>1 (upregulated) or <— 1 (downregulated) were selected for further analysis. Gene cluster analysis was performed by DAVID analysis using the selected differentially expressed genes [Huang da W et al., Nucleic Acids Res 2009, Huang da W et al., Nat Protoc. 2009]. RNA-seq results (normalized counts) were used as input to perform with Gene Set Enrichment Analysis (GSEA) [Subramanian A, et al., Proc Natl Acad Sci U S A. 2005]. Molecular Signatures Database (MSigDB)v4.0 were used as screening database. For each gene, the gene expression value is normalized by the relative log2 fold change compared to the median value of this gene. Expression heatmap is drawn by Morpheus (https: / / software. broadinstitute.org / morpheus / ). Cannonical pathway and disease and biological functional analysis were generated by ingenuity pathway analysis (IPA; Ingenuity Systems, Redwood City, CA) using the statistical differential expressed genes list. To increase the sample representativeness, for IPA, we choose nominal p < 0.05 as cutoff value. [000448] Tumor infiltrating lymphocyte (TIL) harvest [000449] To investigate the phenotype of TIL, all treatments were started 11 days after tumor inoculation, After 7 days treatment, tumor mass was harvested and the phenotype of TIL were analyzed as previously described [18, Scherwitzl I, Mol Ther Oncolytics. 2018]. [000450] T cell seahorse assay [000451] T cells were isolated from spleen by using pan T cell isolation kit (Stemcells). T cells were plated at 6 x 10° cells / well in 24 well plate. Oxygen consumption rate (OCR) and excellular acidification rate (ECAR) were measured by Agilent Seahorse XFe24. [000452] Statistical analysis [000453] For the two group comparison, statistical difference was determined by unpaired two tail Student t-test. The multiple sample comparison was analyzed by one way ANOVA. P < 0.05 was determined to be significant for all experiments. All values were calculated with Excel (Microsoft) and Prism software (GraphPad). [000454] SV and a4-1BB mAb combination complet...

Claims

What we claim is:

1. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector and (b) an antibody directed against a co-stimulatory molecule, or a nucleic acid encoding same; or an antibody to an immune system agonist molecule, or a nucleic acid encoding same.

2. The method of claim 1, wherein the antibody is selected from the group consisting of anti-OX40 antibody, anti-4-1BB antibody, anti-CD28 antibody, anti-GITR antibody, anti- CD137 antibody, anti-cd37 antibody, and anti-HVEM antibody. 3 The method of claim 1, wherein the Sindbis viral vector comprises at least one nucleic acid encoding an immunostimulatory or an immunomodulatory protein.

4. The method of claim 2, wherein the immunostimulatory or immunomodulatory protein is IL-1, IL-2, IL-3, IL- 4, IL-5, IL-6 IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, TL-13, IL- 14, IL-15,1IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL- 27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, [L-34, IL-35 or IL-36.

5. The method of claim 3, wherein theimmunostimulatory or immunomodulatory protein isIL-12.

6. The method of claim 1, wherein the Sindbis viral vector and the antibody induce an immune response in a tumor associated antigen (TAA) nonspecific manner.

7. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.

8. The method of claim 7, wherein the Sindbis viral vector comprising the nucleic acid encoding interleukin-12 further comprises the nucleic acid encoding the anti-OX40 monoclonal antibody.

9. The method of claim 7, comprising administering a Sindbis viral vector comprising the nucleic acid encoding interleukin-12 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.

10. The method of claim 7, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.

11. The method of claim 7, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.

12. The method of claim 7, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof.

13. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered systemically.

14. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered parenterally.

15. The method of claim 7, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered intraperitoneally.

16. The method of claim 7, wherein the Sindbis viral vector is replication defective.

17. The method of claim 7, wherein the cancer comprises a solid tumor.

18. The method of claim 7, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.

19. A Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an anti-OX40 monoclonal antibody.

20. The Sindbis viral vector of claim 19, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.

21. The Sindbis viral vector of claim 19, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.

22. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same.

23. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody.

24. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1, thereby treating cancer in the subject.

25. The method of claim 24, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.

26. The method of claim 24, wherein the nucleic acid encoding NY-ESO-1 comprises a nucleic acid sequence of SEQ ID NO:

14.

27. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered systemically.

28. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered parenterally.

29. The method of claim 24, wherein the (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 or (b) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding NY-ESO-1 are administered intraperitoneally.

30. The method of claim 24, wherein the Sindbis viral vector is replication defective.

31. The method of claim 24, wherein the cancer comprises a solid tumor.

32. The method of claim 24, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.

33. A Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and a nucleic acid encoding an NY-ESO-1. 34, The Sindbis viral vector of claim 33, wherein the nucleic acid encoding interleukin-12 comprises the nucleic acid sequence encoding interleukin 12 alpha subunit of SEQ ID NO: 1, the nucleic acid encoding interleukin 12 beta subunit of SEQ ID NO: 2, or a combination thereof.

35. The Sindbis viral vector of claim 33, wherein the nucleic acid encoding the NY-ESO-1 comprises a nucleic acid sequence of SEQ ID NO:

14.

36. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding interleukin-12 and (b) a Sindbis viral vector comprising a nucleic acid encoding an NY-ESO-1.

37. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.

38. The method of claim 37, wherein the Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 further comprises the nucleic acid encoding the anti-OX40 monoclonal antibody.

39. The method of claim 37, comprising administering a Sindbis viral vector comprising the nucleic acid encoding NY-ESO-1 and administering a Sindbis viral vector comprising the nucleic acid encoding the anti-OX40 monoclonal antibody.

40. The method of claim 37, wherein the nucleic acid encoding NY-ESO-1 comprises anucleic acid sequence of SEQ ID NO:

14.

41. The method of claim 37, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.

42. The method of claim 37, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof. 43, The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered systemically.

44. The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered parenterally.

45. The method of claim 37, wherein the Sindbis viral vector and the anti-OX40 monoclonal antibody are administered intraperitoneally.

46. The method of claim 37, wherein the Sindbis viral vector is replication defective.

47. The method of claim 37, wherein the cancer comprises a solid tumor.

48. The method of claim 37, wherein the cancer is colon cancer, prostate cancer or ovarian cancer.

49. A Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and a nucleic acid encoding an anti-OX40 monoclonal antibody.

50. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the NY-ESO-1 comprises the nucleic acid sequence of SEQ ID NO:

14.

51. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence selected from of SEQ ID NO:6, SEQ ID NO:10, SEQ ID NO:32, SEQ ID NO:36, SEQ ID NO:40, SEQ ID NO:44 and SEQ ID NO:48 encoding an anti-OX40 antibody heavy chain, a nucleic acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the nucleic acid sequence of SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:34, SEQ ID NO:38, SEQ ID NO:42, SEQ ID NO:46 and SEQ ID NO:50 encoding an anti-OX40 antibody light chain, or any combination of heavy chain nucleic acid sequence or light chain nucleic acid sequence thereof.

52. The Sindbis viral vector of claim 49, wherein the nucleic acid encoding the anti-OX40 monoclonal antibody comprises a nucleic acid encoding an anti-OX40 antibody heavy chain amino acid sequence, an anti-OX40 antibody light chain amino acid sequence, that binds to a target antigen of the amino acid sequence of SEQ ID NO: 13, or a combination thereof.

53. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) an anti-OX40 monoclonal antibody or a nucleic acid encoding same.

54. A composition comprising (a) a Sindbis viral vector comprising a nucleic acid encoding NY-ESO-1 and (b) a Sindbis viral vector comprising a nucleic acid encoding an anti-OX40 monoclonal antibody.

55. A method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount (a) a Sindbis viral vector and (b) an anti-4- 1BB monoclonal antibody or a nucleic acid encoding same, thereby treating cancer in the subject.

56. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered systemically.

57. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered parenterally.

58. The method of claim 55, wherein the Sindbis viral vector and the anti-4-1BB monoclonal antibody are administered intraperitoneally.

59. The method of claim 55, wherein the Sindbis viral vector is replication defective.

60. The method of claim 55, wherein the cancer is a hematologic cancer.

61. The method of claim 55, wherein the cancer is a B cell lymphoma.

Citation Information

Patent Citations

  • Induction and enhancement of antitumor immunity involving virus vectors expressing multiple epitopes of tumor associated antigens and immune checkpoint inhibitors or proteins

    WO2018161092A1