Variants of SAC7D and their use in cancer therapy
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- AFFILOGIC
- Filing Date
- 2021-03-10
- Publication Date
- 2026-08-06
AI Technical Summary
Current cancer treatments using immune checkpoint inhibitors face challenges in effectively targeting both human and mouse PD-L1 due to structural homology and the small size of existing molecules, which limits their ability to sterically obstruct the narrow binding site between PD-L1 and PD-1, and existing drugs may not be cross-reactive across species.
Development of polypeptides comprising variants of the Sac7d family proteins that bind to human and mouse PD-L1, with specific mutations in the binding interface to inhibit the PD-L1/PD-1 interaction, allowing for effective cancer treatment by decreasing tumor weight.
The Sac7d variants demonstrate the ability to bind to both human and mouse PD-L1, inhibiting tumor growth and providing a therapeutic option for cancer treatment, with specific mutations enhancing affinity and efficacy in preclinical studies.
Smart Images

Figure 00000059_0000 
Figure 00000060_0000 
Figure 00000060_0001
Abstract
Description
COMPOSITIONS AND METHODS FOR TREATING CANCER The invention is in the field of cancer treatment and relates in particular to the development of new binders to PDL-1 usable for such purpose. Introduction Cancer immunotherapy has become a treatment of choice for some cancers. It consists essentially in using the patient's immune system to fight the cancer cells. In particular, cell-based immunotherapies make use of immune effector cells such as lymphocytes (notably T lymphocytes) as well as of non-specialized cells such as macrophages, dendritic cells, or natural killer cells (NK Cell) to target tumor antigens expressed on the surface of tumor cells. It has however been observed that tumor cells are able to evade the immune response by stimulating immune checkpoint targets. Immune checkpoints are regulators of the immune system that can lower or inhibit the immune response when stimulated. Immune checkpoints include CTLA4, PD-1, and PD-L1. PD-1 is the transmembrane programmed cell death 1 protein (also called PDCD1 and CD279), and interacts with PD-L1 (PD-1 ligand 1, or CD274). Upregulation of PD-L1 on the cell surface may inhibit T cells. Blocking the interaction between PD-1 and PD-L1 may allow the T-cells to fight the tumor cells. This protein is present in the UniProt database under accession number QONZQ7 (human protein) or Q9EP73 (mouse protein). RefSeq accession numbers are NP_001254635, NP_001300958 and NP_054862 (human protein) and NP_068693 (mouse protein). HSP110, also called Hsp110, HSPH1 or Hsp105 (Hsp105a or Hsp105), is a mammalian member of the HSP105 / 110 family, a subgroup of the HSP70 family. Hsp105a is expressed constitutively and in response to various forms of stress, while Hsp105B is an alternatively spliced form of Hsp105a that is expressed specifically during mild heat shock and was cloned by Yasuda et al (J Biol Chem 270, 29718-29723) and Ishihara et al (Biochim Biophys Acta 1444, 138-142). HSP110 has been shown as being a major determinant for both prognosis and treatment response in colorectal cancer (CRC), in particular by Dorard et al (Nat Med. 2011 Sep 25;17(10):1283-9). In particular, the binding between Hsp110 and STATS3 allows controlling cancers, notably CRC cancers (Gozzi et al, Cell Death Differ. 2020 Jan;27(1):117-129), and may improve response to chemotherapies (Dubrez et al, Oncogene. 2020 Jan;39(3):516-529). This protein is present in the UniProt database under accession number Q92598 (human protein) or Q61699 (mouse protein). It is thus interesting to identify inhibitors of the HSP110-STAT3 binding. The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is a transmembrane protein that is a receptor for members of the epidermal growth factor family (EGF family) of extracellular protein ligands. EGFR overexpression has been associated with a number of cancers, including adenocarcinoma of the lung (40% of cases), anal cancers, glioblastoma (50%) and epithelian tumors of the head and neck (80-100%). Mutations, amplifications or misregulations of EGFR or family members are implicated in about 30% of all epithelial cancers. Anticancer drugs targeting EGFR have been developed, including gefitinib, erlotinib, afatinib, brigatinib and icotinib for lung cancer, and cetuximab for colon cancer. Other drugs include panitumumab and osimertinib. Such of these drugs are monoclonal antibodies, whereas others are tyrosine kinase inhibitors. This protein is present in the UniProt database under accession number PO0533 (human protein) or Q01279 (mouse protein). EP1930342 discloses that it is possible to screen for variants of proteins of the Sac7d family. WO 2019 / 096797 discloses the generation of multi-specific molecules using Sac7d variants, and some variants binding to IL-17. Goux et al (Bioconjug Chem. 2017 Sep 20;28(9):2361-2371) disclose that anti- EGFR nanofitin (variant of Sac7d) can be used used as a targeted PET radiotracer for in vivo imaging of EGFR-positive tumor. Gocha et al (Sci Rep 7, 12021; 2017) disclose identification and characterization of a novel Sso7d scaffold-based binder against Notch1. Marchetti et al (J Thorac Dis. 2017 Dec; 9(12): 4863-4866) discuss the role of PD-L1 and PD1 in cancer therapy. Altogether, none of these documents disclose nor suggests, alone or in combination that it is possible to obtain a variant of a protein of the Sac7d family able to inhibit the PD-L1 / PD1 binding, or able to bind both human and murine PD- L1. Indeed, all of these documents rely on the binding ability to a protein, whereas biological activity (inhibition of the effect) also require proper affinity and binding at a strategic location. As explained below, human PDL1 and mouse PDL1, although having structural homology, present a low percentage of identity, and some drugs are not able to target both proteins. Furthermore, the surface of the binding site between PD-L1 / PD1 is small and binding inhibition may require steric obstruction which may not be reached with small molecules (proteins of the Sac7d family are 60-70 amino acid long). SUMMARY OF THE INVENTION The invention relates a polypeptide comprising a variant of the Sac7d protein or of a protein of the Sac7d family that binds to the PD-L1. In some embodiments, the variant binds to human PD-L1. In other embodiments, the variant binds to both human and mouse PD-L1. In another embodiment, the invention relates a polypeptide comprising a variant of the Sac7d protein or of a protein of the Sac7d family that binds to the Hsp110 protein. Generating neutralizing ligands against PDL1 can be challenging considering the relatively narrow interaction area between PDL1 and PD1. This is especially true for small alternative to antibodies such as the Nanofitins (variants of proteins of the Sac7d family). Considering their very compact structure, Nanofitins need to engage PDL1 in the very proximity of its interaction area with PD1 to exhibit a direct neutralization capability. Indeed, the small size of such variants hampers neutralization through only steric obstruction as may be possible with larger proteins such as antibodies. The extracellular domain of PDL1 consists of a 220 amino acid (aa) with two immunoglobulin-like domains: an Ig like V type (aa19-aa127) and Ig like C2 type (aa133-aa225). Interaction with PD1 is involving only the Ig like V type domain. Therapeutic antibodies such as Atezolizumab, Durvalumab and Avelumab are all targeting the Ig like V type domain with their epitopes overlapping with the interaction area between PDL1 and PD1 (Figure 14). Interestingly, the extracellular domain of human PDL1 and mouse PDL1 have been found to share a high structural homology but yet a relatively low percentage of identity (72 %), which results in a different druggability profiles (Magiera-Mularz et al., iScience. 2021 Jan:24(1):101960). As an example, both Atezolizumab and Avelumab were demonstrated cross reactive to human and mouse PDL1, while Durvalumab was found specific to human PDL1 only. Many developments are being made to improve the predictability potential of murine tumor models, especially with regards to the evaluation of immune check point inhibitors combinations (Sanmamed et al, Annals of Oncology, 27 (7), 2016, 1190-1198; Chulpanova et al. Int J Mol Sci. 2020;21(11):4118). All these efforts are the reflect that murine models remain pivotal in oncology drug development schemes considering their low cost, short reproductive cycle, high tumor growth rates, and their ease at being genetically modified. In this landscape, development of novel immune check point inhibitors can be streamlined by the use of cross reactive ligands that can address both the murine and human forms of the target. As such, murine models can be used for efficacy evaluation as well as target engagement, biodistribution, and toxicity as examples. The invention thus comprises a polypeptide comprising a variant of a member of the Sac7d family binding to human PD-L1 and inhibiting the liaison of PD-L1 with PD1. In a specific embodiment, the polypeptide consists in such variant. In a specific embodiment, the variant comprises from 4 to 20 mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand. In a specific embodiment, the variant comprises from 8 to 14 mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand. The polypeptide comprising the variant of a member of the Sac7d family binding to human PD-L1 may be such that the variant comprises from 4 to 20 (in particular from 8 to 14) mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand, and wherein said variants comprises the Y8M, V26L, S31L, R42L and A44F mutations, or the Y8I, V26I, S31L, R42M, and A44L mutations, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1. The variants comprising the Y8M, V26L, S31L, R42L and A44F mutations correspond to SEQ ID NO: 51-71. The variants comprising the Y8I, V26l, S31L, R42M, and A44L mutations correspond to SEQ ID NO: 15-23, SEQ ID NO: 30-50. In a specific embodiment, the polypeptide also binds to mouse PD-L1. In this embodiment, the polypeptide may comprise the Y8M, W24T, V26L, M29A, S31L, T33R, R42L and A44F mutations, or the Y8I, W24R, V26I, M29Y, S31L, T33K, R42M, and A44L mutations, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1. The variants comprising the Y8M, W24T, V26L, M29A, S31L, T33R, R42L and A44F mutations correspond to SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 64, SEQ ID NO: 85, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71. The variants comprising the Y8I, W24R, V26l, M29Y, S31L, T33K, R42M, and A44L mutations correspond to SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 20 SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 18, SEQ ID NO: 17. In a specific embodiment, the variant further comprises at least one mutation selected from D16E, N37Q and M57L, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1. Such variant is able to be used for cancer treatment, as it makes it possible to decrease tumor weight, as shown in the examples. Such variant comprises SEQ ID NO: 16, SEQ ID NO: 17 or SEQ ID NO: 18. In particular, said variant is a variant of the Sac7d protein, and comprises SEQ ID NO: 19, SEQ ID NO: 20 or SEQ ID NO: 21. In another embodiment, said variant is a variant of the Sso7d protein, and comprises SEQ ID NO: 22 or SEQ ID NO: 23. In particular, in some embodiments, said variant is based on the Sac7d protein, and comprises SEQ ID NO 33, SEQ ID NO: 36, SEQ ID NO: 39, SEQ ID NO: 54, SEQ ID NO: 57, SEQ ID NO: 60 (all binding to human PD-L1), SEQ ID NO 34, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO 55, SEQ ID NO: 56, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 61, or SEQ ID NO: 62 (all binding to human and mouse PD-L1). In some embodiments, said variant is based on the Aho7c protein, and comprises SEQ ID NO: 42, SEQ ID NO: 45, SEQ ID NO: 48, SEQ ID NO: 63, SEQ ID NO: 66, SEQ ID NO: 69 (all binding to human PD-L1), SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, or SEQ ID NO: 71 (all binding to both human and mouse PD-L1). In some embodiments, said variant is based on the Sso7d protein, and comprises SEQ ID NO: 22 or SEQ ID NO: 23. All these sequences describe specific variants based on proteins of the Sac7d family. As explained below, it is possible, using the alignment of Figure 1, to design variants of other proteins of the family. A sequence that is consensus for proteins Sac7d and Aho7c and that pertains to a variant binding to PD-L1 can also comprise SEQ ID NO: 30, SEQ ID NO: 51 (all binding to human PD-L1), SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 52 or SEQ ID NO: 53 (all binding to human and mouse PD-L1). In case of discrepancy between the specification and the sequence listing, the sequences mentioned in the specification are preponderant. The invention also relates to a polypeptide comprising a variant of the Sac7d protein or of a protein of the Sac7d family that binds to the HSP110. Such variant is able to be used for cancer treatment, as it makes it possible to decrease tumor weight, as shown in the examples. Such variant comprises SEQ ID NO: 24 or SEQ ID NO: 25. In particular, said variant is a variant of the Sac7d protein, and comprises SEQ ID NO: 26 or SEQ ID NO: 27. In another embodiment, said variant is a variant of the Sso7d protein, and comprises SEQ ID NO: 28 or SEQ ID NO: 29. In particular, in some embodiments, said variant is based on the Sac7d protein, and comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82 or SEQ ID NO: 83. In some embodiments, said variant is based on the Aho7c protein, and comprises SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91 or SEQ ID NO: 92. A sequence that is consensus for proteins Sac7d and Aho7c and that pertains to a variant binding to HSP110 can also comprise SEQ ID NO: 72, SEQ ID NO: 73 or SEQ ID NO: 74. Such variant inhibits the binding of HSP110 to Stat3. It is to be noted that some of the sequences indicated above comprise a methionine at its N-terminal, but that it is also possible to perform the invention when such methionine listed at the N-terminal end of each sequence is not included The invention also relates to nucleic acid coding for the variants, polypeptides including the variants and an active substance, methods of production, and of use of the variants alone or combined with active substances. In particular, the invention relates to A polypeptide herein disclosed which consists in the variant of a member of the Sac7d family binding to human and / or mouse PD-L1. A polypeptide herein disclosed, wherein the variant of a member of the Sac7d family binding to human and / or mouse PD-L1 is conjugated to an organic molecule. A polypeptide herein disclosed, wherein the variant of a member of the Sac7d family binding to human and / or mouse PD-L1 is conjugated to another polypeptide. A polypeptide herein disclosed, wherein the other polypeptide is another variant of a protein of the Sac7d family. A nucleic acid molecule coding for a polypeptide herein disclosed. An expression vector comprising a nucleic acid molecule herein disclosed. A host cell comprising a nucleic acid molecule herein disclosed, or the expression vector herein disclosed. A pharmaceutical composition comprising a polypeptide herein disclosed, a nucleic acid herein disclosed, an expression vector herein disclosed, or a host cell herein disclosed, and a pharmaceutically acceptable carrier A Method for producing a polypeptide herein disclosed, comprising (a)Culturing a cell culture wherein the cells have been transformed by an expression vector herein disclosed, And (b)Recovering the polypeptide. A polypeptide herein disclosed as a medicament. A polypeptide herein disclosed for use for the treatment of prevention of a disease, wherein the variant is associated with an substance active for treatment or prevention of the disease. DETAILED DESCRIPTION OF THE INVENTION It is to be noted that the specification discloses variants of Sac7d (SEQ ID NO: 1) Aho7c (SEQ ID NO: 14), Sso7d (SEQ ID NO: 2), but the teachings are applicable to the other proteins of the Sac7d family, in particular Sto7 (SEQ ID NO: 94) which is very similar to Sac7d and Aho7c. The amino acids to mutate are identified using alignment of the sequences with the Sac7d sequence, in particular as disclosed in Figure 1. The teachings are also applicable to other OB-fold domains as disclosed in WO2007139397. The invention is also applicable to SH3 domains, a small protein domain of about 60 amino acid residues, initially, described as a conserved sequence in the viral adaptor protein v-Crk and described under PF00018 in the PFAM database. The SH3 domain has a characteristic beta-barrel fold that consists of five or six -strands arranged as two tightly packed anti-parallel B sheets. The linker regions may contain short helices. It is to be noted that OB-fold and SH3 domains share homology and that, in view of the knowledge of the sequence and structure of these domains, it is possible to determine, in any of OB-fold or SH3 domain, to which amino acids correspond the amino acids as disclosed below for Sac7d. In a specific embodiment, the polypeptide consists in the variant of a protein of the Sac7d family binding to PD-L1. In a specific embodiment, the polypeptide consists in the variant of a protein of the Sac7d family binding to HSP110. In a specific embodiment, the variant of a protein of the Sac7d family binding to PD-L1 is linked or fused to another protein or polypeptide. In particular, the other protein or polypeptide comprises another variant of a protein of the Sac7d family. In this embodiment, it is preferred when the other variant of the Sac7d family binds to HSP110. Such other variant may comprise SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or any of SEQ ID NO: 72-92. SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 77, SEQ ID NO: 80, SEQ ID NO: 83, SEQ ID NO: 86, SEQ ID NO: 89 or SEQ ID NO: 92 are particularly preferred. SEQ ID NO: 80, SEQ ID NO: 83 are particularly preferred. In another embodiment, the other variant of the Sac7d family binds to EGFR. In specific embodiments, the variant is present in a polypeptide and is thus covalently linked by amine bounds to other proteins presenting a biological interest. In an embodiment, the polypeptide is conjugated to an organic molecule that presents some functionality, in particular a tyrosine kinase inhibitor that is used as a EGFR inhibitor. The invention also pertains to a genetic construct comprising a DNA sequence coding for the polypeptide described herein, to a vector comprising such genetic construct, and to a host cell comprising the genetic construct in its genome. The invention also pertains to a method for producing the polypeptide herein disclosed, comprising the steps consisting of a. Culturing a cell culture wherein the cells have been transformed by a genetic construct as disclosed, and b. Recovering the polypeptide. The invention also relates to a polypeptide herein disclosed as a medicament. The invention also relates to a polypeptide herein disclosed for use thereof for the treatment of cancer, alone or in combination with chemotherapy or treatment with CAR-T cells. The invention also relates to a method for treating a subject in need thereof comprising administering a therapeutic amount of a polypeptide herein disclosed to the subject, in particular when the subject has a cancer. The invention also relates to a composition containing a polypeptide according to any one of claims 1 to 12 and a chemotherapy agent or CAR-T cells for simultaneous, separate or sequential (spread out over time) use in the treatment of cancer. Itis particularly adapted when the cancer is as disclosed below. The invention also relates to these variants in therapeutic, diagnostic or purification uses. The invention also relates to composition, in particular oral or topical (dermal), containing the polypeptide or the variants. It is reminded that the sequence of Sac7d is: MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKEL LDMLARAEREKK (SEQ ID NO: 1). The variants binding to PD-L1 herein disclosed contain mutations at positions corresponding to the positions 7, 8, 9, 21, 22, 24, 26, 29, 31, 33, 40, 42, 44 and 46 of the Sac7 sequence. It is however to be noted that the lysine at position 21 may be maintained in the variants, as well as the threonine at position 40, or the serine at position 46. It is also noted that the methionine at position 1 can be deleted, as well as some the amino acids 59-66. The variants may thus contain amino acids corresponding to amino acids 2-58, 2-59, 2-60, 2-61, 2-62, 2-63, 2-64, 2-65 or 1- 58, 1-59, 1-60, 1-61, 1-62, 1-63, 1-64, 1-65 of Sac7d. This corresponds to amino acids 1-57, 1-58, 1-59, 1-60, 1-61, 1-62, or 1-63 of any of SEQ ID NO: 33 to SEQ ID NO: 41, SEQ ID NO: 54 to SEQ ID NO: 62 or SEQ ID NO: 75 to SEQ ID NO: 83. In preferred embodiments, the polypeptide comprises the sequence MXXXVXFXIXGEEKXVDXSKIXXVXRIGKXXLFXY DXXXGKXGMGLVXEKDAPKEL XXXLXXXXXXXK (SEQ ID NO: 18). In this sequence, the amino acids designated as X at positions 8, 10, 22-23, 25, 30, 34, 42, 48 can be any amino acid. The other amino acids designated as X are indicated in table 1 (where “= designates no amino acid). Position Amino acid Eq ly 8 15 18 31 37 to 39 57 58 59 B61to B67 2 XisV, Aor T 3 XisTorK 4 Xis —or K “6 Xis Ror K “15 XisEorQ 18 XisT orl 31 Xis Vor] 371039 | XXXis EGG or DN— “57 XisMorL “58 XisQ, DorE “59 Xis Mor K 61to 67 As in the sequence listing Table 1. description of amino acids These amino acids, of Table 1, are the amino acids that vary between the different sequences of proteins of the Sac7d family. As shown in this table, there is little variation between these proteins. In another embodiment, the polypeptide comprises the sequence MXXXVXFXIXGEEKXVDXSKIXXVRRIGKYXLFKYDXXXGKXGMGLVXEKDAPKE XOKLXXXXXXXK (SEQ ID NO: 17). In this sequence, the amino acids designated as X at positions 8, 10, 22-23, 42, 48 can be any amino acid. The other amino acids designated as X are indicated in table 1. In another embodiment, the polypeptide comprises the sequence MXXXVXFVIGGEEKXVDXSKIKTVRRIGKYXLFKYDXXXGKTGMGLVSEKDAPKE LXXXLXXXXXXXK (SEQ ID NO: 18). In this sequence, the amino acids designated as X are indicated in table 1. In a preferred embodiment, the polypeptide comprises the sequence MVKVKFXIXGEEKEVDTSKIXXVXRIGKXVLFXYDDNGKXGMGLVXEKDAPKELLD MLARAEREKK (SEQ ID NO: 19). In this sequence, the amino acids designated as X at positions 7, 9, 21-22, 24, 29, 33, 40, 46 can be any amino acid. In a preferred embodiment, the polypeptide comprises the sequence MVKVKFXIXGEEKEVDTSKIXXVRRIGKYVLFKYDDNGKXGMGLVXEKDAPKELL DMLARAEREKK (SEQ ID NO: 20). In this sequence, the amino acids designated as X at positions 7, 9, 21-22, 40, 46 can be any amino acid. In a preferred embodiment, the polypeptide comprises the sequence MVKVKFVIGGEEKEVDTSKIKTVRRIGKYVLFKYDDNGKTGMGLVSEKDAPKELL DMLARAEREKK (SEQ ID NO: 21). Such sequence is particularly preferred. In another embodiment, the polypeptide comprises the sequence MATVKFXIXGEEKEVDISKIXXVXRIGKXILFXYDEGGGKXGMGLVXEKDAPKELL QMLEKQKK (SEQ ID NO: 22). In this sequence, the amino acids designated as X at positions 7, 9, 21-22, 24, 29, 33, 41, 47 can be any amino acid. In another embodiment, the polypeptide comprises the sequence MATVKFVIGGEEKEVDISKIKTVRRIGKYILFKYDEGGGKTGMGLVSEKDAPKELL QMLEKQKK (SEQ ID NO: 23). The polypeptide may also comprise SEQ ID NO: 21, where between 1 to 10, more preferably from 1 to 8, more preferably from 1 to 6, more preferably from 1 to 5, more preferably from 1 to 4, more preferably from 1 to 3, more preferably 2, more preferably 1 amino acid selected from the group consisting of V7, G9, K21, T22, R24, Y29, K33, T40, and S46, more preferably from the group consisting of V7, G9, K21, T22, T40, and S46, have been replaced by any other amino acid. The variants binding to HSP110 herein disclosed contain mutations at positions corresponding to the positions 7, 8, 9, 21, 22, 24, 26, 29, 31, 33, 40, 42, 44 and 46 of the Sac7 sequence. It is however to be noted that the tryptophan at position 24 may be maintained in the variants. In preferred embodiments, the polypeptide comprises the sequence MXXXVXFXWRGEEKXVDXSKIWDVWRXGKXXYFHYDXXXGKMGXGKVXEKDA PKELXXXLXXXXXXXK (SEQ ID NO: 24). In this sequence, the amino acids designated as X at positions 8, 28, 30, 44, 48 can be any amino acid. The other amino acids designated as X are indicated in table 1 (where “= designates no amino acid). In another embodiment, the polypeptide comprises the sequence MXXXVXFMWRGEEKXVDXSKIWDVWRSGKTXYFHYDXXXGKMGQGKVHEKDA PKELXXXLXXXXXXXK (SEQ ID NO: 25). In this sequence, the amino acids designated as X are indicated in table 1. In a preferred embodiment, the polypeptide comprises the sequence MVKVKFXWRGEEKEVDTSKIWDVWRXGKXVYFHYDDNGKMGXGKVXEKDAPK ELLDMLARAEREKK (SEQ ID NO: 26). In this sequence, the amino acids designated as X at positions 7, 26, 29, 42, 46 can be any amino acid. In a preferred embodiment, the polypeptide comprises the sequence MVKVKFMWRGEEKEVDTSKIWDVWRSGKTVYFHYDDNGKMGQGKVHEKDAPK ELLDMLARAEREKK (SEQ ID NO: 27). Such sequence is particularly preferred. In another embodiment, the polypeptide comprises the sequence MATVKFXWRGEEKEVDISKIWDVWRXGKXIYFHYDEGGGKMGXGKVXEKDAPK ELLQMLEKQKK (SEQ ID NO: 28). In this sequence, the amino acids designated as X at positions 7, 26, 29, 43, 47 can be any amino acid. In another embodiment, the polypeptide comprises the sequence MATVKFMWRGEEKEVDISKIWDVWRSGKTIYFHYDEGGGKMGQGKVHEKDAPK ELLQMLEKQKK (SEQ ID NO: 29). The polypeptide may also comprise SEQ ID NO: 29, where between 1 to 5, more preferably from 1 to 4, more preferably from 1 to 3, more preferably 2, more preferably 1 amino acid selected from the group consisting of M7, S26, T29, Q43, and H47 have been replaced by any other amino acid. Description of PD-L1-binding variants based on Sac7d and Aho7¢c Sac7d and Aho7c are proteins that have large similarity. One can also note that Sto (SEQ ID NO: 94) also present similarity with these proteins. SEQ ID NO: 93 corresponds to the consensus sequence of after alignment of amino acids 2-66 of Sac7d (SEQ ID NO: 1) and 3-60 of Aho7c (SEQ ID NO: 14). The starting amino acids have been omitted as they are not essential in the structure of the proteins. XKVKFKYKGEEKEVDXSKIKKVWRVGKMXSFTYDDNGKTGRGAVSEKDAPK ELLXXXXXXXXXX (SEQ ID NO: 94) In this consensus sequences, X (or Xaa) are as in Table 2. [Position Amino-acid Preferred 1 Sac7d | Preferred 2 Aho7c 16 Torl T | 29 Vorl Vv | 55-64 DMLARAEREK or | DMLARAEREK EKLK EKLK------ Table 2. Description of some amino acids represented as Xaa in SEQ ID NO: 87 and SEQ ID NO: 30-32, 51-53 or 72-74. Consensus sequence for variants binding to PD-L1 are represented by 30 31 32 51 53 SEQ ID NO: | Sequence “30 XKVKFXIXGEEKEVXXSKIXXVXRIGKXXLFXYDDXGKXGMGLV XEKDAPKELLXXXXXXXXXX 31 XKVKFXIXGEEKEVXXSKIXXVRRIGKYXLFKYDDXGKXGMGLV XEKDAPKELLXXXXXXXXXX 32 XKVKFVIGGEEKEVXXSKIKTVRRIGKYXLFKYDDXGKTGMGLV SEKDAPKELLXXXXXXXXXX E51 XKVKFXMXGEEKEVXXSKIXXVXRLGKXXLFXYDDXGKXGLGF VXEKDAPKELLXXXXXXXXXX “83 XKVKFXMXGEEKEVXXSKIXXVTRLGKAXLFRYDDXGKXGLGF VXEKDAPKELLXXXXXXXXXX “54 XKVKFVMGGEEKEVXXSKIRYVTRLGKAXLFRYDDXGKTGLGF VQEKDAPKELLXXXXXXXXXX Table 3: sequences of the variants based on the consensus sequence of Sac7d- Aho7c. Amino acids represented by X are further described in Tables 2, 4, and 5. Position Type of Amino-acid | Preferred Preferred 1 | Preferred 2 Property (B11) (G02) 8 anv amino acid tolerant V V V V R,I,LVorM aliphatic chain | M 8 any amino acid “tolerant G6 G "20 | any amino acid “tolerant KO “R 21 any amino acid “tolerant 2 23 |T.S,R,K H,D,E, | charged, polar “R | Property Bl 6 any amino acid “tolerant RT, LVorM “aliphatic chain | 8 any amino acid “tolerant “20 [any amino acid “tolerant 21 any amino acid “tolerant "23 |T.S,RKH,DE,]| charged, polar QN 25 LILV,FY hydrophobic 28 any amino acid tolerant Y A 30 LMILVY hydrophobic 32 K,R, HQ N positively K "R 28 any amino acid 30 LMLVY 32 KR, H QN charged, polar “39 any amino acid “tolerant 41 TIM LILA “hydrophobic ~~ M _ “43 TL LV.ForY "hydrophobic “F “45 [any amino acid “Tolerant Ss a 43 |LLV,ForY hydrophobic F “45 [any amino acid “Tolerant Ss a Table 4. description of amino acids indicated as Xaa in SEQ ID NO: 30, 31, 33, 34, 36, 37, 39, 40, 42, 43, 45, 46, 48, 49, 51, 52, 54, 55, 57, 58, 60, 61, 63, 64, 66, 67, 68, 69. It is to be noted that this table is to be used for the sequences mentioned above, for the Xaa that they bear. For some sequences, an amino acid is specified at some of the positions of Table 4 and the line of the table is thus not applicable. In these sequences, some amino acids that are not involved in binding can also be modified on the variants, without modifying the binding and biological properties of the proteins. They are represented in Table 5. Position Amino-acid 15 XaaisDorE 36 Xaais NorQ 56 XaaisMorL Table 5. Amino acids represented as Xaa in SEQ ID NO: 30-32, SEQ ID NO: 33- 35, SEQ ID NO: 42-44, SEQ ID NO: 51-53, SEQ ID NO: 54-56, SEQ ID NO: 63-65, SEQ ID NO: 72-74, SEQ ID NO: 75-77 and SEQ ID NO: 84-85. Xaa at position 56 is only present in SEQ ID NO: 33-35, SEQ ID NO: 54-56, and SEQ ID NO: 75-77. Description of PD-L1-binding variants based on Sac7d (SEQ ID NO: 1) Specific variants based on Sac7d, binding to human and / or mouse PD-L1 are depicted by SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62. In these sequences, the starting methionine (M) of the Sac7d protein has been omitted. It has indeed been shown by the Applicant that the activity of the proteins is not modified when this amino acid is deleted. Likewise, it is possible to omit the last 7 amino acids from the variants and retain activity. Consequently, proteins depicted by amino acids 1-57 of any of SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62 are also variants according to the invention. One can also cite proteins depicted by amino acids 1- 58, 1-59, 1-60, 1-61, 1-62, 1-63 of any of SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62, which are also variants according to the invention. Consequently, the polypeptide comprise any of SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62, or any truncated protein based on these sequences, and as disclosed above. Such variants are represented by 33 34 35 36 SEQ ID NO: | Sequence 33 VKVKFXIXGEEKEVXTSKIXXVXRIGKXVLFXYDDXGKXGMGLV XEKDAPKELLDXLARAEREK “34 VKVKFXIXGEEKEVXTSKIXXVRRIGKYVLFKYDDXGKXGMGLV XEKDAPKELLDXLARAEREK “35 VKVKFVIGGEEKEVXTSKIKTVRRIGKYVLFKYDDXGKTGMGLV SEKDAPKELLDXLARAEREK “36 VKVKFXIXGEEKEVDTSKIXXVXRIGKXVLFXYDDNGKXGMGLV XEKDAPKELLDMLARAEREK “37 VKVKFXIXGEEKEVDTSKIXXVRRIGKYVLFKYDDNGKXGMGLV 39 40 41 54 55 56 57 58 59 60 B61 62 XEKDAPKELLDMLARAEREK “38 VKVKFVIGGEEKEVDTSKIKTVRRIGKYVLFKYDDNGKTGMGLV SEKDAPKELLDMLARAEREK “39 VKVKFXIXGEEKEVETSKIXXVXRIGKXVLFXYDDQGKXGMGLV XEKDAPKELLDLLARAEREK “40 VKVKFXIXGEEKEVETSKIXXVRRIGKYVLFKYDDQGKXGMGLV XEKDAPKELLDLLARAEREK a VKVKFVIGGEEKEVETSKIKTVRRIGKYVLFKYDDQGKTGMGLV SEKDAPKELLDLLARAEREK “54 VKVKFXMXGEEKEVXTSKIXXVXRLGKXVLFXYDDXGKXGLGFV XEKDAPKELLDXLARAEREK = VKVKFXMXGEEKEVXTSKIXXVTRLGKAVLFRYDDXGKXGLGFV XEKDAPKELLDXLARAEREK = VKVKFVMGGEEKEVXTSKIRYVTRLGKAVLFRYDDXGKTGLGF VQEKDAPKELLDXLARAEREK E57 VKVKFXMXGEEKEVDTSKIXXVXRLGKXVLFXYDDNGKXGLGF VXEKDAPKELLDMLARAEREK “B8 VKVKFXMXGEEKEVDTSKIXXVTRLGKAVLFRYDDNGKXGLGF VXEKDAPKELLDMLARAEREK 759 VKVKFVMGGEEKEVDTSKIRYVTRLGKAVLFRYDDNGKTGLGF VQEKDAPKELLDMLARAEREK “60 VKVKFXMXGEEKEVETSKIXXVXRLGKXVLFXYDDQGKXGLGF VXEKDAPKELLDLLARAEREK “61 VKVKFXMXGEEKEVETSKIXXVTRLGKAVLFRYDDQGKXGLGF VXEKDAPKELLDLLARAEREK “62 VKVKFVMGGEEKEVETSKIRYVTRLGKAVLFRYDDQGKTGLGF VQEKDAPKELLDLLARAEREK Table 6: sequences of the variants based on Sac7d. Amino acids represented by X are further described in Tables 4 and 5. SEQ ID NO: 36-38 (resp. 39-41) correspond to SEQ ID NO: 33-35 respectively with the amino acids not involved in the binding and biological properties being specified. SEQ ID NO: 36-38 also correspond to SEQ ID NO: 19-21. SEQ ID NO: 57-59 (resp. 60-62) correspond to SEQ ID NO: 54-56 respectively with the amino acids not involved in the binding and biological properties being specified. As indicated above, it is possible to modify D16 of Sac7d (which is located at position 15 in SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62, as the M1 present in Sac7d has been omitted), N37 of Sac7d (herein located at position 36) or M57 of Sac7d (herein located at position 56) as disclosed in Table 5. As for the consensus sequence of Sac7d / Aho7c, any combination of substitution is foreseen (numbering is with respect to SEQ ID NO: 33 to SEQ ID NO: 41 and SEQ ID NO: 54 to SEQ ID NO: 62), even though the sequence listing doesn’t all depict them: D15 N36 M56 SEQ ID NO: 36-38 and SEQ ID NO: 57-59 D15 N36 L568 D15 Q36 M56 D15 Q36 L56 E15 N36 M58 E15 N38 L568 E15 Q38 M58 E15 Q36 L568 SEQ ID NO: 39-41 and SEQ ID NO: 60-62 As indicated above, the sequences all contain the five mutated amino acids 17, 125, L30, M41, and L43, or M7, L25, L30, L41 and F43 (corresponding respectively to position 8, 26, 31, 42 and 44 of SEQ ID NO: 1, which contain the N-terminus methionine), which differ from the amino acids that are naturally present in Sac7d. The Applicant has indeed found that these amino acids are present in various variants binding to PD-L1, and that modification of such leads to decrease of binding (loss of affinity or loss of binding). The other amino acids can be variable, under conditions mentioned in Table 4. When the variants also contain R23, Y28, K32, they bind both human and mouse PD-L1. Very interesting variants are depicted by SEQ ID NO: 21, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 62. These variants bind to both human and mouse PD-L1. SEQ ID NO: 21 corresponds to SEQ ID NO: 38. SEQ ID NO: 41 (named B11) is of particular interest, as well as SEQ ID NO: 38. SEQ ID NO: 62 (named G02) is also of particular interest, as well as SEQ ID NO: 59. Description of proteins based on Aho7c (SEQ ID NO: 14) Variants of Aho7c, binding to human and / or mouse PD-L1 are depicted by SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50. As indicated above, such protein is very similar to Sac7d. It has also been shown and reminded herein that mutations of Sac7d can be carried from Sac7d to another protein (WO 2012 / 150314). In these sequences, the starting methionine and alanine (MA) of the Aho7c protein (SEQ ID NO: 14) have been omitted. It has indeed been shown by the Applicant that the activity of the proteins is not modified when these amino acids are deleted. Likewise, it is possible to omit the last 4 amino acids from the variants and retain activity. Consequently, proteins depicted by amino acids 1-55 of any of SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50 are also variants according to the invention. One can also cite proteins depicted by amino acids 1- 56, 1-57, 1-58 of any of SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50, which are also variants according to the invention. Consequently, the polypeptide comprise any of SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50, or any truncated protein based on these sequences, and as disclosed above. Such variants are represented by B83 64 SEQ ID NO: | Sequence “63 TKVKFXMXGEEKEVXISKIXXVXRLGKXILFXYDDXGKXGLGFVX EKDAPKELLEKLK “64 TKVKFXMXGEEKEVXISKIXXVTRLGKAILFRYDDXGKXGLGFVX EKDAPKELLEKLK “65 | TKVKFVMGGEEKEVXISKIRYVTRLGKAILFRYDDXGKTGLGFV 66 67 68 69 70 71 42 43 44 45 46 47 48 49 50 Table 7: sequences of the variants based on Ao7c. Amino acids represented by X are further described in Tables 4 and 5. As indicated above, it is possible to modify D17 of Aho7c (which is located at position 15 in SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50, as the M1A2 present in Aho7c have been omitted), or N38 of Aho7c (herein located at position 36) as disclosed in Table 5. As for the consensus sequence of Sac7d / Aho7c, any combination of substitution is foreseen (numbering is with respect to SEQ ID NO: 63 to SEQ ID NO: 71 and SEQ ID NO: 42 to SEQ ID NO: 50), even though the sequence listing doesn’t all depict them: D15 N36 SEQ ID NO: 66-88 and 45-47 D15 Q36 E15 N36 E15 Q36 SEQ ID NO: 69-71 and 48-50 As indicated above, the sequences all contain the mutated amino acids 17, 125, L30, M41, and L43, or M7, L25, L30, L41 and F43 (corresponding respectively to position 9, 26, 32 43 and 45 of SEQ ID NO: 14, which contain the methionine and alanine in N-terminus), which differ from the amino acids that are naturally present in Aho7c. The Applicant has indeed found that these amino acids are present in various variants binding to PD-L1, and that modification of such leads to decrease of binding (loss of affinity or loss of binding). The other amino acids can be variable, under conditions mentioned in Table 4 and 5. When the variants also contain R23, Y28, K32, they bind both human and mouse PD-L1. Very interesting variants are depicted by SEQ ID NO: 66, SEQ ID NO: 64, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 49 and SEQ ID NO: 50. SEQ ID NO: 70 (based on G02) is of particular interest. SEQ ID NO: 50 (based on B11) is also of particular interest. In some embodiments, the polypeptide is such that the variant of a protein of the Sac7d family binding to PDL-1 is linked or fused to another protein or polypeptide, in particular another variant of a protein of the Sac7d family or an antibody, in particular binding to HSP-110 (in particular the ones disclosed by SEQ ID NO: 24 to SEQ ID NO 29, and in particular SEQ ID NO: 27) or to EGFR. In some embodiments, the polypeptide is such that the variant of a protein of the Sac7d family binding to HSP-110 is linked or fused to another protein or polypeptide, in particular another variant of a protein of the Sac7d family or an antibody, in particular binding to PDL-1 (in particular the ones disclosed by SEQ ID NO: 16 to SEQ ID NO 23, and in particular SEQ ID NO: 21) or to EGFR. Variants binding to Hsp-110 Description of Hsp-110 variants based on Sac7d and Aho7c Such variants are represented by 72 73 6 Xaa is anv amino acid tolerant M WwW 8 XaaisR L R 20 XaaisW,H, LV hydrophobic WwW 21 D “D 23 WwW WwW 25 XaaisS NTKRHQ positively charaed / polar S 28 positively charged / polar positively charged / polar 30 XaaisY. F W aromatic Y 32 | H CH 39 XaaisW, |, M,L hydrophobic M 41 Xaa is any amino acid tolerant Q SEQ ID NO: | Sequence 72 XKVKFXWXGEEKEVXXSKIXDVWRXGKXXXFHYDDXGKXGXG KVXEKDAPKE LLXOXXXXXXXXX 73 XKVKFXWRGEEKEVXXSKIWDVWRXGKXXYFHYDDXGKMGX GKVXEKDAPKELLXXXXXXXXXX 74 XKVKFMWRGEEKEVXXSKIWDVWRSGKTXYFHYDDXGKMGQ GKVHEKDAPKE LLXXXXXXXXXX Table 8: sequences of the variants based on the consensus sequence of Sac7d- Aho7c. Amino acids represented by X are further described in Tables 2, 5 and 9. Position | Amino-acid [Preferred property [Preferred 6 Xaa is any amino acid tolerant M w Wo “8 [XeaisR,L R "20 [XaaisW,H, LV "hydrophobic Wo “21 |D DO “23 [WwW Wo "25 [XaaisS,N, TKR HQ s "28 [XaaisT,QKR,H oe ra—] "30 [XaasY,F,W “aromatic YO “32 [H HO 739 | XaaisW, I, ML "hydrophobic ™ “41 | Xaais any amino acid “tolerant a 45 Xaa is anv amino acid tolerant H 43 K K 45 Xaa is any amino acid tolerant H ~ Table 9. description of amino acids indicated as Xaa in SEQ ID NO: 72-SEQ ID NO: 92. It is to be noted that this table is to be used for the sequences mentioned above, for the Xaa that they bear. For some sequences, an amino acid is specified at some of the positions of Table 6 and the line of the table is thus not applicable. In these sequences, some amino acids that are not involved in binding can also be modified on the variants (see in particular SEQ ID NO: 72-SEQ ID NO: 77, 84-86). They are represented in Table 5. Description of variants based on Sac7d (SEQ ID NO: 1) Variants based on Sac7d, binding to human Hsp110 are depicted by SEQ ID NO: 75 to SEQ ID NO: 83. In these sequences, the starting methionine (M) of the Sac7d protein has been omitted. It has indeed been shown by the Applicant that the activity of the proteins is not modified when this amino acid is deleted. Likewise, it is possible to omit the last 7 amino acids from the variants and retain activity. Consequently, proteins depicted by amino acids 1-57 of any of SEQ ID NO: 75 to SEQ ID NO: 83 are also variants according to the invention. One can also cite proteins depicted by amino acids 1-58, 1-59, 1-60, 1-61, 1-62, 1-63 of any of SEQ ID NO: 75 to SEQ ID NO: 83, which are also variants according to the invention. Consequently, the polypeptide comprise any of SEQ ID NO: 75 to SEQ ID NO: 83, or any truncated protein based on these sequences, and as disclosed above. Such variants are represented by 75 76 77 SEQ ID NO: | Sequence 75 VKVKFXWXGEEKEVXTSKIXDVWRXGKXVXFHYDDXGKXGXG KVXEKDAPKELLDXLARAEREK 76 VKVKFXWRGEEKEVXTSKIWDVWRXGKXVYFHYDDXGKMGX GKVXEKDAPKELLDXLARAEREK “5? VKVKFMWRGEEKEVXTSKIWDVWRSGKTVYFHYDDXGKMGQ GKVHEKDAPKELLDXLARAEREK 78 VKVKFXWXGEEKEVDTSKIXDVWRXGKXVXFHYDDNGKXGXG 80 81 82 83 KVXEKDAPKELLDMLARAEREK 79 VKVKFXWRGEEKEVDTSKIWDVWRXGKXVYFHYDDNGKMGX | GKVXEKDAPKELLDMLARAEREK "80 | VKVKFMWRGEEKEVDTSKIWDVWRSGKTVYFHYDDNGKMGQ GKVHEKDAPKELLDMLARAEREK “81 | VKVKFXWXGEEKEVETSKIXDVWRXGKXVXFHYDDQGKXGXG KVXEKDAPKELLDLLARAEREK “82 VKVKFXWRGEEKEVETSKIWDVWRXGKXVYFHYDDQGKMGX | GKVXEKDAPKELLDLLARAEREK "83 | VKVKFMWRGEEKEVETSKIWDVWRSGKTVYFHYDDQGKMGQ GKVHEKDAPKELLDLLARAEREK Table 10: sequences of the hsp110- binding variants based on Sac7d. Amino acids represented by X are further described in Tables 5 and 9. As indicated above, it is possible to modify D16 of Sac7d (which is located at position 15 in SEQ ID NO: 45-65, as the M1 present in Sac7d has been omitted), N37 of Sac7d (herein located at position 36) or M57 of Sac7d (herein located at position 56) as disclosed in Table 7. As for the consensus sequence of Sac7d / Aho7c, any combination of substitution is foreseen (numbering is with respect to SEQ ID NO: 45-65), even though the sequence listing doesn’t all depict them: D15 N36 M56 SEQ ID NO: 78-80 D15 N38 L568 D15 Q38 M58 D15 Q38 L566 E15 N38 M56 E15 N36 L586 E15 Q36 M56 E15 Q36 L586 SEQ IDNO: 81-83 As indicated above, the sequences all contain the mutated amino acids W7, D21; W23, H32 and K43, (corresponding respectively to position 8, 22, 24, 33 and 44 of SEQ ID NO: 1, which contain the N-terminus methionine), which differ from the amino acids that are naturally present in Sac7d. The Applicant has indeed found that these amino acids are present in various variants binding to Hsp110, and that modification of such leads to decrease of binding (loss of affinity or loss of binding). The other amino acids can be variable, under conditions mentioned in Table 9. Very interesting variants are depicted by SEQ ID NO: 27, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 82 and SEQ ID NO: 83. SEQ ID NO: 83 is of particular interest, as well as SEQ ID NO: 80. SEQ ID NO: 80 corresponds SEQ ID No: 27. Description of proteins based on Aho7c (SEQ ID NO: 14) Variants of Aho7c, binding to human and / or mouse PD-L1 are depicted by SEQ ID NO: 84 to SEQ ID NO: 92. As indicated above, such protein is very similar to Sac7d. It has also been shown and reminded herein that mutations of Sac7d can be carried from Sac7d to another protein (WO 2012 / 150314). In these sequences, the starting methionine and alanine (MA) of the Aho7c protein (SEQ ID NO: 14) have been omitted. It has indeed been shown by the Applicant that the activity of the proteins is not modified when these amino acids are deleted. Likewise, it is possible to omit the last 4 amino acids from the variants and retain activity. Consequently, proteins depicted by amino acids 1-55 of any of SEQ ID NO: 84 to SEQ ID NO: 92 are also variants according to the invention. One can also cite proteins depicted by amino acids 1-56, 1-57, 1-58 of any of SEQ ID NO: 84 to SEQ ID NO: 92, which are also variants according to the invention. Consequently, the polypeptide comprise any of SEQ ID NO: 84 to SEQ ID NO: 92, or any truncated protein based on these sequences, and as disclosed above. Such variants are represented by 84 85 SEQ ID NO: | Sequence “84 TKVKFXWXGEEKEVXISKIXDVWRXGKXIXFHYDDXGKXGXGK VXEKDAPKELLEKLK “85 TKVKFXWRGEEKEVXISKIWDVWRXGKXIYFHYDDXGKMGXGK VXEKDAPKELLEKLK “8 TKVKFMWRGEEKEVXISKIWDVWRSGKTIYFHYDDXGKMGQG KVHEKDAPKELLEKLK 88 89 90 91 92 “87 TKVKFXWXGEEKEVDISKIXDVWRXGKXIXFHYDDNGKXGXGK VXEKDAPKELLEKLK “88 TKVKFXWRGEEKEVDISKIWDVWRXGKXIYFHYDDNGKMGXG KVXEKDAPKELLEKLK EE TKVKFMWRGEEKEVDISKIWDVWRSGKTIYFHYDDNGKMGQG KVHEKDAPKELLEKLK “eo TKVKFXWXGEEKEVEISKIXDVWRXGKXIXFHYDDQGKXGXGK VXEKDAPKELLEKLK Tol TKVKFXWRGEEKEVEISKIWDVWRXGKXIYFHYDDQGKMGXG KVXEKDAPKELLEKLK Te2 TKVKFMWRGEEKEVEISKIWDVWRSGKTIYFHYDDQGKMGQG KVHEKDAPKELLEKLK Table 11: sequences of the variants based on Ao7c. Amino acids represented by X are further described in Tables 5 and 9. As indicated above, it is possible to modify D17 of Aho7c (which is located at position 15 in SEQ ID NO: 84-92, as the M1A2 present in Aho7c have been omitted), or N38 of Aho7c (herein located at position 36) as disclosed in Table 5. As for the consensus sequence of Sac7d / Aho7c, any combination of substitution is foreseen (numbering is with respect to SEQ ID NO: 84-92), even though the sequence listing doesn’t all depict them: D15 N36 SEQ ID NO: 87-89 D15 Q36 E15 N36 E15 Q36 SEQ ID NO: 90-92 As indicated above, the sequences all contain the mutated amino acids W7, D21; W23, H32 and K43 (corresponding respectively to position 9, 22, 24, 35 and 45 of SEQ ID NO: 14, which contains the methionine and alanine in N-terminus), which differ from the amino acids that are naturally present in Aho7c. Very interesting variants are depicted by SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 91 and SEQ ID NO: 92. SEQ ID NO: 92 is of particular interest, as well as SEQ ID NO: 89. The invention thus also relates to a polypeptide comprising a variant of a member of the Sac7d family binding to human Hsp110, wherein the variant comprises from 4 to 20 (preferably from 8-14) mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand. In particular, this variant also binds to murine HSP110.. In a preferred embodiment, and the variant comprises the Y8W, K22D, W24W, T33H, and A44K mutations, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1. This corresponds in particular to SEQ ID NO: 72-92. Preferably, the polypeptide comprising a variant of a member of the Sac7d family binding to human Hsp110, comprises the Y8W, K21W, K22D, W24W, S31Y, T33H, T39M and A44K mutations, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1. This corresponds in particular to SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 91, SEQ ID NO: 92. Such variant can be modified, produced and used as disclosed herein, as are modified, produced and used the variants binding to PD-L1. Modification of the variant In another embodiment, the polypeptide is conjugated to an organic molecule, in particular a tyrosine kinase inhibitor. It also allows obtaining a genetic construct comprising a DNA sequence coding for a polypeptide defined above, a vector comprising such genetic construct and a host cell comprising such genetic construct in its genome. It is possible to perform a method for producing the polypeptide, comprising culturing a cell culture wherein the cells have been transformed by a genetic construct, and recovering the polypeptide. One can also embody a polypeptide as disclosed as a medicament. The invention also pertains to a polypeptide herein disclosed, wherein said polypeptide binds to PDL-1, HSP-110 or EGFR, alone or in combination including as a multimeric polypeptide), for use thereof for the treatment of cancer, in particular solid tumors and lymphomas. Such cancer is in particular non-small cell lung carcinoma, urothelial carcinoma, gastric cancer, liver cancer, kidney cancer, head and neck squamous cell cancer, esophageal squamous cell carcinoma, primary mediastinal B-cell lymphoma, classical Hodgkin lymphom, melanoma, merkel cell carcinoma, cervical cancer, microsatellite instability-high cancer, bladder cancer, breast cancer, small cell lung cancer, colorectal cancer, pancreatic cancer, prostate cancer. The anti-PD-L1 variant is useful for a broad range of cancers as disclosed above and in particular for non-small cell lung carcinoma, urothelial carcinoma, gastric cancer, liver cancer, kidney cancer, head and neck squamous cell cancer, esophageal squamous cell carcinoma, primary mediastinal B-cell lymphoma, classical Hodgkin lymphom, melanoma, merkel cell carcinoma, cervical cancer, microsatellite instability-high cancer, bladder cancer, breast cancer, small cell lung cancer which are already treated with anti-PD-L1 agents. The anti-HSP110 variant is particularly useful for treating colorectal cancer, pancreatic cancer, prostate cancer or breast cancer. The invention also pertains to a polypeptide herein disclosed, wherein said polypeptide binds to PDL-1, HSP-110 and / or EGFR, for its use for the treatment of cancer in combination with chemotherapy or treatment with CAR-T cells, in particular the cancers cited above. The Sac7d protein family The Sac7d family is defined as relating to the Sac7d protein and corresponds to a family of 7 kDa DNA-binding proteins isolated from extremophilic bacteria. It is herein disclosed as a representative species of OB-fold domains, that is preferably used in the context of the invention. Since SH3 domains share homology with OB- fold domains, the teachings pertaining to Sac7d are also applicable to SH3 scaffolds. These proteins and this family are in particular described in WO 2008 / 068637. Thus, within the context of the present invention, a protein belongs to the Sac7d family when it has one of the sequences SEQ ID NO: 1 to SEQ ID NO: 14, or when it has a sequence corresponding to the sequence SEQ ID NO: 15, which is a consensus sequence (obtained from SEQ ID NO: 1 to SEQ ID NO: 9 and SEQ ID NO: 12 to SEQ ID NO: 14, and SEQ ID NO: 94. In this consensus sequence, a dash — indicates no amino acid, the proteins not having all the same size). This Sac7d family comprises in particular the Sac7d or Sac7e proteins derived from Sulfolobus acidocaldarius, the Sso7d protein derived from Sulfolobus solfataricus, the DBP 7 also called Sto7 protein derived from Sulfolobus tokodaii, the Ssh7b protein derived from Sulfolobus shibatae, the Ssh7a protein derived from Sulfolobus shibatae, Mse7 derived from Metalfosphaera sedula, Mcu7 derived from Metallosphaera cuprina, Aho7a or Aho7b or Aho7c derived from Acidianus hospitalis, Sis7a or Sis7b derived from Sulfolobus isfandicus and the p7ss protein derived from Sulfolobus solfataricus. In view of the broad similarity of the sequences of the proteins of the Sac7d family, it is directly possible and easy to identify the amino acids of another protein than Sac7d that correspond to given amino acids of Sac7d. In particular, one can also use the teachings of WO 2008 / 068637 that shows (in the figures) and explains (in the specification) that such proteins are superimposable. WO 2012 / 150314 shows that the mutations from one protein of the Sac7d family can be carried to another protein of the same family. This portability amounts to creating a mutant of another protein of the Sac7d family, starting from a mutant of one protein of said family. The first mutant may have been obtained in particular by carrying out the process of WO 2008 / 068637. Consequently, it is possible, using in particular the teachings of WO 2012 / 150314 and of figure 1, to obtain a mutant of any protein of the Sac7d family, starting from a mutant of any other protein of such family. As an illustration, for a mutant of Sac7d, one can introduce the mutated amino acids of the Sac7d mutant within the scaffold of another protein, using the sequence alignment of figure 1. As an illustration, variants of Sso7d, obtained from the Sac7d variants herein disclosed, are described as SEQ ID NO: 22, SEQ ID NO: 27, SEQ ID NO: 28 and SEQ ID NO: 29, or above. The number of mutated residues introduced within a wild-type protein sequence to obtain a variant is preferably between 4 and 25, or more specifically between 4 and 22. It is thus possible to obtain variants preferably having at least 4, more preferably at least 5, more preferably at least 6, more preferably at least 7 or 8, even more preferably at least 10, but generally less than 25, more preferably less than 22, even more preferably less than 20 or less than 15 or 14 substituted amino acids compared with the wild-type OB-fold protein (or domain). It is to be noted that all and any ranges are considered herein, (such as 5-20 or 7-25 and so forth). Particularly preferred ranges are 4-17 and 6-17, 4-14 and 6-14. Itis preferred when 7, 8, 9, 10, 11, 12, 13 or 14 amino acids are mutated in the binding site of the OB-fold domain, relative to the wild-type OB-fold domain. These mutations are introduced in the amino acids corresponding to V2, K3, K5, K7, Y8, K9, G10, E11, K13, E14, T17, K21, K22, W24, V26, G27, K28, M29, S31, T33, Y34, D36, N37, G38, K39, T40, R42, A44, S46, E47, K48, D49, A50 and P51 of Sac7d (SEQ ID NO: 1) In particular, it is interesting when the number of mutated amino acids is between 7 and 14 (limits included). In particular, the variants can also comprise amino acid insertions as indicated above As indicated, proteins of the Sac7d family are Sac7d or Sac7e derived from Sulfolobus acidocaldarius, Sso7d derived from Sulfolobus solfataricus, DBP 7 also called Sto7 derived from Sulfolobus tokodaii, Ssh7b derived from Sulfolobus shibatae, Ssh7a derived from Sulfolobus shibatae, Mse7 derived from Metallosphaera sedufa, Mcu7 derived from Metallosphaera cuprina, Aho7a or Aho7b or Aho7c derived from Acidianus hospitalis, Sis7a or Sis7b derived from Sulfolobus isfandicus and p7ss derived from Sulfolobus solfataricus. The various sequences of the Sac7d, Sso7d, Sac7e, Ssh7b, Ssh7a, DBP7, Sis7a (3 alleles), Mse7, Mcu7, Aho7a, Aho7b and Aho7c proteins are represented by SEQ ID NO: 1 to SEQ ID NO: 14 respectively. SEQ ID NO: 94 represents the Sto7 protein from Sulfurisphaera tokodaii. A variant of a protein of this Sac7d family may be called a nandfitin. The invention is thus preferentially implemented on variants of the proteins represented by SEQ ID NO: 1 to SEQ ID NO: 14 and SEQ ID NO: 94, or a protein having the sequence SEQ ID NO: 15, in particular on variants of Sac7d. Link of Sac7d protein with OB-fold proteins and SH3 domains The OB-fold proteins are known in the art. They are in particular described in the documents cited above, and also in Arcus (Curr Opin Struct Biol. 2002 Dec; 12(8):794-801). OB-fold is in the form of a cylinder having five beta (B) sheets. Most OB-fold proteins use the same binding interface of their natural ligand, which may be an oligosaccharide, an oligonucleotide, a protein, a metal ion or a catalytic substrate. This binding interface comprises mainly the residues located in the beta sheets. Certain residues located in the loops may also be involved in the binding of an OB-fold protein with its natural ligand. Thus, applications WO 2007 / 139397 and WO 2008 / 068637 and the Arcus document (2002, op. cit.) describe the OB-fold- protein domains for binding with their natural ligand. In particular, document WO 2008 / 068637 describes precisely how to identify the binding domain of an OB-fold protein. By superimposing several sequences and 3D structures of proteins having OB-fold domains, using the websites WU- Blast2 (http: / / www.ebi.ac.uk / blast2 / index.html) (Lopez et al., 2003, Nucleic Acids Res 31, 3795-3798), T-COFFEE (http: / / www.ch.embnet.org / software / T Coffee. html) (Notredame et al, 2000, J Mol Biol 302, 205-217) and DALI lite (http: / / www.ebi.ac.uk / DaliLite / ) (Holm and Park, 2000, Bioinformatics 16, 566-567), it is possible to identify the positions of the binding domains and in particular the amino acids which can be modified. Taking the sequence of Sac7d (SEQ ID NO: 1) as a reference, these are the residues V2, K3, K5, K7, Y8, K9, G10, E11, K13, E14, T17, K21, K22, W24, V26, G27, K28, M29, S31, T33, Y34, D35, D36, N37, (G38, K39, T40, G41, R42, Ad4, S468, E47, K48, D49, A50 and P51. WO 2008 / 068637 describes that it is possible to perform a superimposition of 3D structures of OB-fold proteins or domains (10 domains were used in this application, including Sac7d), using the DALI website (http: / / www.ebi.ac.uk / dali / interactive.html)(Holm and Sander, 1998, Nucleic Acids Res 26, 316-319). Thus, it is easy to identify, for any OB-fold protein (or any OB- fold domain), the amino acids involved in the binding site and corresponding to the Sac7d amino acids mentioned above. Consequently, providing the amino acids that can be mutated in one of these proteins makes it possible to identify the corresponding amino acids for any other OB-fold domain. It is also to be noted that OB-fold domains resemble SH3 domains and that it is also possible to identify equivalents of amino acids of Sac7d in SH3 domains. Example of OB-fold or SH3 domain Non-limitative examples of OB-fold proteins which can be used according to the invention are Sac7d, Sso7d, the N-terminal domain of SEB (Papageorgiou et al., 1998), the chain A of the Shiga-like toxin lle (PDB 2bosa), the human Neutrophil Activatin Peptide-2 (NAP-2, PDB 1tvxA), the Molybdenum Binding Protein (modg) of Azotobacter vinelandii (PDB 1h9j), the N-terminal domain of SPE-C (Roussel et al., 1997), the B5 subunit of E. coli Shiga-like toxin (Kitov et al., 2000), Cdc13 (Mitton-Fry et al., 2002), the cold-shock DNA-binding domain of the human Y-box protein YB-1 (Kloks et al, 2002), the E. coli inorganic pyrophosphatase EPPase (Samygina et al., 2001), or any of the proteins listed in Table 3 of the article by (Arcus, 2002), such as 1krs (Lysyl-tRNA synthetase LysS, E.coli), 1c0aA (Asp- tRNA synthetase, E.coli), 1b8aA (Asp- tRNA synthetase, P. kodakaraensis), 1lylA (Lysyl-tRNA synthetase LysU, E.coli), 1qugA (Replication protein A, 32kDa subunit, Human), 1qugB (Replication protein A, 14kDa subunit, Human), 1jmcA (Replication protein A, 70kDa subunit (RPA70) fragment, Human), 1otc (Telomere-end-binding protein, O. nova), 3ullA (Mitochondrial ssDNA-binding protein, Human), 1prtF (Pertussis toxin S5 subunit, B. pertussis), 1bcpD (Pertussis toxin S5 subunit (ATP bound), B. pertussis), 3chbD (Cholera Toxin, V. cholerae), 1tiD (Heat-labile toxin, E. coli), 2bosA (Verotoxin-1 / Shiga toxin, B-pentamer, E. coli), 1br9 (TIMP-2, Human), 1an8 (Superantigen SPE-C, S. pyogenes), 3seb (Superantigen SPE, S. aureus), 1aw7A (Toxic shock syndrome toxin, S. aureus), 1jme (Major cold-shock protein, E.coli), 1bkb (Initiation translation factor 5a, P. aerophylum), 1sro (S1 RNA-binding domain of PNPase, E.coli), 1d7gA (Initiation translation factor 1, elF1a, Human), 1ah9 (Initiation translation factor 1, IF1, E.coli), 1b9mA (Mo-dependent transcriptional regulator ModE, E.coli), 1ckmA (RNA guanylyltransferase, Chlorella virus, PBCV-1), 1a0i (ATP-dependent DNA ligase, Bacteriophage T7), 1snc (Staphylococcal nuclease, S. aureus), 1hjp (DNA helicase RuvA subunit, N-terminal domain, E.coli), 1pfsA (Gene V protein, Pseudomonas bacteriophage pf3), 1gvp (Gene V protein, Filamentous bacteriophage (f1, M13)), 1gpc (Gene 32 protein (gp32) core, Bacteriophage T4), 1wgjA (Inorganic pyrophosphatase, S. cerevisiae), and 2prd (Inorganic pyrophosphatase, T. thermophilus). Non-exhaustive examples of proteins with SH3 domains are Signal transducing adaptor proteins, CDC24, Cdc25, PI3 kinase, Phospholipase, Ras GTPase-activating protein, Vav proto-oncogene, GRB2, p54 S6 kinase 2 (S6K2), SH3D21, C100rf76 (potentially), STAC3, Some myosins, SHANK1,2,3, ARHGAP12, C8orf46, TANGO1, Integrase, Focal Adhesion Kinase (FAK, PTK2), Proline-rich tyrosine kinase (Pyk2, CADTK, PTK2beta), or TRIP10 (cip4). Production of the identified variants The sequence of the identified variant can be cloned in any appropriate vector by any molecular genetic methods known in the art. These recombinant DNA constructs comprising a nucleotide sequence, coding for a polypeptide comprising a variant as described above, are used in connection with a vector, such as a plasmid, phagemid, phage or viral vector. These recombinant acid molecules can be produced by techniques described in Sambrook et al., 1989 (Sambrook J, Fritschi EF and Maniatis T (1989) Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory Press, New York). Alternatively, the DNA sequences may be chemically synthesized using, for example, synthesizers. Recombinant constructs of the invention comprise the expression vectors that are capable of expressing the RNA and thus lead to production of proteins from the above genetic sequences. The vector may thus further comprise regulatory sequences, including a suitable promoter operably linked to the open reading frame (ORF) of the genetic sequences herein disclosed. The vector may further comprise a selectable marker sequence such as an antibiotic resistance gene. Specific initiation and bacterial secretory signals also may be required for efficient translation of the coding sequences when bacteria as used as the expression host. Production of the molecules Cells are transfected or transformed with vectors containing the sequences coding for the polypeptides comprising the variant as disclosed above. The cells are the cultured in such conditions as to have the protein expressed and favorably secreted. The conditions of culture of the cells are the conditions generally used for recombinant antibody production and are known in the art. Such conditions that are known in the art can also be optimized by the person skilled in the art if needed. Kunert and Reinhart (Appl Microbiol Biotechnol. 2016; 100: 3451- 3461) review such methods and provide ample references thereto. One can use bacterial, phage (Shukra et al, Eur J Microbiol Immunol (Bp). 2014: 4(2): 91-98) or eukaryotic systems of production. One shall prefer to use eukaryotic cells in order to obtain proper post- translational modifications such as glycosylation. In particular, one can use CHO (Chinese Hamster Ovary) cells, PER.C8 cells (human cell line, Pau et al, Vaccine. 2001 21;19(17-19):2716-21), HEK 293b cells (Human embryonic kidney cells 293), NSO cells (cell line derived from the non- secreting murine myeloma) or EB66 cells (a duck cell line Valneva, Lyons, France). Also provided by the present disclosure are host cells containing at least one of the DNAs constructs coding for a polypeptide comprising the variant as disclosed herein. The host cell can be any cell for which expression vectors are available. As indicated above, it may be a higher eukaryotic host cell, such as a mammalian cell, a lower eukaryotic host cell, such as a yeast cell, or a prokaryotic cell, such as a bacterial cell. Introduction of the recombinant construct into the host cell is performed by any method known in the art (such as calcium phosphate transfection, lipofection, DEAE, dextran mediated transfection, electroporation or phage infection). The vectors can be inserted within the genome of the host cell, or be maintained as an extragenomic vector (such as a Bacterial Artificial Chromosome or a Yeast Artificial Chromosome). When introduced within the cell genome, such introduction may be random or targeted using methods known in the art (homologous recombination or the like). Bacterial hosts and expression Useful expression vectors for bacterial use are constructed by inserting the recombinant DNA sequence together with suitable translation initiation and termination signals in operable reading phase with a functional promoter. The vector will comprise one or more phenotypic selectable markers and an origin of replication to ensure maintenance of the vector and, if desirable, to provide amplification within the host. Suitable prokaryotic hosts for transformation include E. coli, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus. Eukaryotic hosts and expression Examples of the eukaryotic host cells include vertebrate cells, insect cells, and yeast cells. In particular, one can use the cells mentioned above. The transformed or transfected cells are cultured according to methods known in the art and the polypeptide are recovered from intracellular or extracellular fractions (depending on whether it is secreted or not). Isolation of the molecules The recombinant protein produced can be separated and purified by any of various known separation methods utilizing the physical or chemical property of the protein, from the intracellular or extracellular fraction. In particular, one can use methods such as precipitation, ultrafiltration, various types of liquid chromatography such as molecular sieve chromatography (gel filtration), adsorption chromatography, ion exchange chromatography, and affinity chromatography, dialysis, and a combination thereof. In general, any method known and used to purify recombinant polypeptides is adapted for the purification of the molecules herein disclosed. If a tag has been introduced within the recombinant sequence (such as a poly- Histidine tag), one can purify the molecules using this tag. However, it is preferred to use affinity to purify the molecules. One can, in particular, use the fact that the molecule herein produced binds to a specific target and use any affinity method (affinity column, FACS, beads) to isolate such molecules. One particular advantage of the molecules herein disclosed is that they don’t need to be glycosylated to be active and can thus be produced in any type of cells, and not necessarily eukaryotic cells. They are particularly well produced in bacterial cells. Modification of the variants The variants described above, and having the ability to bind PD-L1 or HSP110 can be modified by any method known in the art. Preparing a polypeptide comprising the variant It is possible to prepare a DNA sequence that would contain two coding sequences, one for the variant herein disclosed and another for a protein or peptide of interest. The resulting expressed protein would thus be a polypeptide that would contain both proteins. The vector may be built in such a way that it would contain a sequence coding for a linker that would be located between the two proteins in the expressed polypeptide. Consequently, the invention also encompasses a polypeptide comprising the variant of a protein of the OB-fold protein (preferably of the Sac7d family) binding to PDL-1, or HSP110 which is linked (preferably through amine bound as disclosed above) to another protein or polypeptide. In a specific embodiment, the other protein or polypeptide comprises another variant of a protein of the Sac7d family, in particular as herein disclosed. Are of particular interest A polypeptide comprising a variant of an OB-fold protein of the Sac7d family binding to HSP-110, fused with a variant of an OB-fold protein of the Sac7d family binding to PD-L1 (in N- or C-terminus) A polypeptide comprising a variant of an OB-fold protein of the Sac7d family binding to HSP-110, fused with a variant of an OB-fold protein of the Sac7d family binding to EGFR (in N- or C-terminus) A polypeptide comprising a variant of an OB-fold protein of the Sac7d family binding to HSP-110, fused with the same or another variant of an OB-fold protein of the Sac7d family binding to HSP110 (in N- or C- terminus) A polypeptide comprising a variant of an OB-fold protein of the Sac7d family binding to PD-L1, fused with the same or another variant of an OB- fold protein of the Sac7d family binding to PD-L1 (in N- or C-terminus) A polypeptide comprising a variant of an OB-fold protein of the Sac7d family binding to PD-L1, fused with a variant of an OB-fold protein of the Sac7d family binding to EGFR (in N- or C-terminus). In another embodiment, the other protein or polypeptide is an antibody. In this embodiment, the variant of the OB-fold domain is fused to at least one of the heavy or light chain of an immunoglobulin monomer, preferably at the N- or C-terminus of the light or heavy chain. In another embodiment, the variant may be fused to both heavy or light chains. In order to obtain such compounds, one can use a genetic construct comprising a DNA sequence selected from the group consisting of a. the sequence coding for the heavy chain of an antibody fused, at its 3'end with the sequence coding for the variant of an OB-fold protein (potentially with an sequence coding for a linker) b. the sequence coding for the heavy chain of an antibody fused, at its 5' end with the sequence coding for the variant of an OB-fold protein (potentially with an sequence coding for a linker) c. the sequence coding for the light chain of an antibody fused, at its 3’ end with the sequence coding for the variant of an OB-fold protein (potentially with an sequence coding for a linker) d. the sequence coding for the light chain of an antibody fused, at its 5’ end with the sequence coding for the variant of an OB-fold protein (potentially with an sequence coding for a linker). This fusion can be made at the N-terminus and / or the C-terminus of the antibody chain (heavy and / or light chain). It is to be noted that, especially when using a small OB-fold domain (about 70 amino acids) such as a protein from the Sac7d family, it is possible to obtain a molecule that will have the structure of the antibody (two light chains paired to two heavy chains, and such dimers paired together), with the antibody regions, and further binding regions consisting of the modified OB-fold domain. In a specific embodiment, the antibody part of the protein herein disclosed is a 1gG molecule. In another embodiment, the antibody part of the protein herein disclosed is a IgA molecule. In another embodiment, the antibody part of the protein herein disclosed is a IgM molecule. In another embodiment, the antibody part of the protein herein disclosed is a IgD molecule. In another embodiment, the antibody part of the protein herein disclosed is a IgE molecule. The antibody may be a human antibody, a rodent antibody (such as a mouse antibody or a rat antibody), a cat antibody, a dog antibody, a chicken antibody, a goat antibody, a camelid antibody (such as a camel antibody, a llama antibody, an alpaca antibody or a nanobody), a shark antibody, or an antibody from any other species. It may be a chimeric or humanized antibody. As reminded in Wikipedia, humanized antibodies are antibodies from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans. A chimeric antibody contains sequences from different species. It is preferred when the antibody that is part of the molecule herein disclosed is an antibody that comprises two identical heavy chains (of about 400 to 500 amino acids, generally around 450 amino acids) and two identical light chains. Consequently, the antibody comprises the same Fab variable regions. This antibody is therefore a monospecific antibody where both parts (combination of light and heavy chains) of the antibody bind to the same epitope of an antigen. However, the antibody may present different heavy and / or light chains. In particular, in some embodiments, the antibody is a bi-specific antibody. The term “antibody” thus encompasses both “classical antibodies” as disclosed above having identical heavy and light chains, but also engineered antibodies that have more than one specificity. In a specific embodiment, the antibody presents one heavy and light chain from one antibody and another heavy and light chain from another antibody. The antibody may bind to a target selected in the group consisting of: Cell surface receptors: Insulin receptor, Low density lipoprotein receptor- related protein 1, Transferrin receptor, Epidermal growth factor receptor, Epidermal growth factor receptor variant Ill, Vascular endothelial growth factor receptor 1, Vascular endothelial growth factor receptor 2, Her2, Her3, Herd, PMSA, IGF-1R, GITR, RAGE, CD28. Cell surface proteins: Mesothelin, EpCam, CD19, CD20, CD38, CD3, TIM-3, CEA, cMet, ICAM1, ICAM3, MadCam, a4b7, CD7, CD4, CD138. Angiogenesis factors and Growth factors: VEGF, Angiopoietin 2, HGF, PDGF, EGF, GM-CSF, HB-EGF, TGF Immune checkpoint inhibitors or activators: PD-1, PD-L1, CTLA4, CD28, B7-1, B7-2, ICOS, ICOSL, B7-H3, B7-H4, LAG3, KIR, 4-1BB, 0X40, CD27, CD40L, TIM3, A2aR Circulating proteins: TNFa, IL23, IL12, IL33, IL4, IL13, IL5, IL6, IL4, IFNg, IL17, RANKL, Bace1, alpha Synuclein, Tau, amyloid. It is particularly envisaged when the antibody targets IL17 or a cell surface receptor in particular involved in cancer. Hence are particularly foreseen A polypeptide comprising a variant as disclosed above, binding to PD-L1 and an antibody binding to HSP110 A polypeptide comprising a variant as disclosed above, binding to HSP110 and an antibody binding to PD-L1 (such as atezolizumab, avelumab or durvalumab) A polypeptide comprising a variant as disclosed above, binding to PD-L1 and an antibody binding to EGFR (such as cetuximab, panitumumab, zalutumumab, nimotuzumab, and matuzumab). A polypeptide comprising a variant as disclosed above, binding to HSP110 and an antibody binding to EGFR Alternatively, the polypeptide may contain a variant as disclosed above, and a biologically active molecule, such as an erythropoietin, an interferon, or etanercept. In another embodiment, the variant of the OB-fold domain (in particular the variant of a protein of the Sac7d family) is conjugated to an organic molecule. This may be done by any method known in the art. In particular, one can chemically link the molecule to the protein. As a molecule, one can cite antiproliferative (cytotoxic and cytostatic agents) include cytotoxic compounds (e.g. broad spectrum), angiogenesis inhibitors, cell cycle progression inhibitors, PBK / m-TOR / AKT pathway inhibitors, MAPK signaling pathway inhibitors, kinase inhibitors, protein chaperones inhibitors, HDAC inhibitors, PARP inhibitors, Wnt / Hedgehog signaling pathway inhibitors, RNA polymerase inhibitors and proteasome inhibitors. One can also use anti-inflammatory molecules. One can also use tubulin polymerization inhibitors such as auristatine or maytansine. One can cite in particular DNA-binding or alkylating drugs such as anthracyclines (doxorubicin, epirubicin, idarubicin, daunorubicin) and its analogs, alkylating agents, such as calicheamicins, dactinomycines, mitromycines, pyrrolobenzodiazepines, and the like. One can also cite cell cycle progression inhibitors such as CDK inhibitors, Rho-kinase inhibitors, checkpoint kinase inhibitors, aurora kinase inhibitors, PLK inhibitors, and KSP inhibitors. One can also cite thalidomide and its derivatives lenalidomide and pomalidomide. In order for treating inflammation disorders, one can also use cyclooxygenase-2 inhibitors, 5-lipoxygenase inhibitors, quercetin and / or resveratrol as molecules conjugated to the polypeptide comprising the variant. Interesting and preferred molecules are also disclosed above. Use of the variants The variants can be used in particular in therapeutic methods, especially for treating cancer. The invention thus relates to methods of treatment of cancer, comprising the administration of a therapeutic amount of a variant of an OB-fold herein disclosed (in particular a variant of a protein of the Sac7d family) to a subject in need thereof. The term “therapeutic amount” or “effective amount’, as used herein, is the amount sufficient to effect beneficial or desired results, such as clinical results, and an “effective amount” depends upon the context in which it is being applied. An effective amount is an amount that provides therapeutic improvement while minimizing side or adverse effect. Therapeutic improvement may be regression of tumor size in solid tumor, inhibition of metastatic spreading, improvement in life quality of the subject, improvement of the efficacy of a combined treatment. One can administer the variant by any method of the art. In particular, one can inject the variant. In another embodiment, one can apply the variant topically (either on the skin or on the eye of the patient) as disclosed in WO 2014 / 173899. In another embodiment, one can administer the variant orally, as disclosed in WO 2016 / 062874. The variants or polypeptides containing the variants can also be used in diagnostic methods. In particular, such variants or polypeptide may be linked to any marker known in the art and used in imagery methods. Indeed, PD-L1 is a marker of cancer cells, as is HSP110 which can be found at the cell surfaces. This is particularly interesting for detecting metastasis or following the efficacy of cancer treatment especially in vivo. One can administer such polypeptides of the invention that have bound to any imagery-detectable marker and follow the presence and binding of the administered molecules by imagery methods. The invention thus also relates to a method for detecting the presence of, or for quantifying, a subunit of a multimeric protein in a sample, comprising the step of a. Exposing the sample to a variant as disclosed, that binds to the subunit but not the fully formed multimeric protein, in such conditions that such binding is possible b. Recovering the variant and / or detecting, or measuring the amount of, quantifying, ELISA, fluorescence, columns] the subunit. The recovery of b) can be perfomed by various washes or methods common in the art. The detection or quantification can be performed by any method such as ELISA or other methods in the art. DESCRIPTION OF THE FIGURES Figure 1: alignment of proteins of the Sac7d family. Figure 2: binding of B11 to both human (upper curve) and mouse (lower curve) proteins. Figure 3: inhibition of binding of PD1 and PD-L1 using a variant (B11) protein binding to PD-L1. Figure 4: inhibition of binding of PD1 and PD-L1 using a variant (B11) protein binding to PD-L1, alone (triangles) or as a dimer (reverse triangles). Pembrolizumab (squares) and atezolizumab (circles) were used as controls. Figure 5: mean tumor weight (mg) measured in the different experimental groups at the end of study. NF1 = anti-HSP110 variant. NF2: anti-PD-L1 variant. NF1-NF2; dimer of both variants. Figure 6: Data analysis of chicken CD3 expression in tumor. Figure 7: data analysis of chicken MMD expression in tumor. Figure 8: number of dead and surviving embryos at the end of the study. Figure 9: mean tumor weight (mg) measured in the different experimental groups after 10 days of treatment on the CAM. Mean values + SEM of tumor weight measured for each experimental group. Figure 10: mean tumor weight (mg) measured in the different experimental groups after 10 days of treatment on the CAM. Mean values + SEM of tumor weight measured for each experimental group. Figure 11: mean tumor weight (mg) measured in the different experimental groups at the end of study. Mean values + SEM of tumor weight (mg). Figure 12: Relative Quantity of chicken CD3 Expression (+ SEM) in Tumor per Group. Figure 13: data analysis of chicken MMD expression in tumor. Relative Quantity of chicken MMD Expression (x SEM) in Tumor per Group. Figure 14: representation of PDL1 structure, with its two immunoglobulin-like domains (Ig like V type (aa19-aa127)) and (Ig like C2 type (aa133-aa225)), in complex from right to left with PD1 (PDB 4ZQK, A), Atezolizumab (PDB 5XXY, B), Avelumab (PDB 5GRJ, C) and Durvalumab (PDB 5XJ4, D). EXAMPLES Example 1. Characterization of a variant of Sac7d binding to PD-L1 Efficacy of the PDL1 neutralizing Nanofitins was evaluated using the PD1 / PDL1 blockade bioassay from Promega. The assay consists of two genetically engineered cell lines provided in a thaw and use format: Jurkat T cells expressing human PD-1 and a luciferase reporter driven by an NFAT response element (PD-1 Effector Cells) and CHO-K1 cells expressing human PD-L1 and an engineered cell surface protein designed to activate cognate TCRs in an antigen-independent manner (PD-L1 aAPC / CHO-K1 Cells). When the two cell types are co-cultured, the PD-1 / PD-L1 interaction inhibits TCR signaling and NFAT-RE-mediated luminescence. Neutralization of the PD1 / PDL1 interaction releases the inhibitory signal and results in TCR activation and NFAT-RE-mediated luminescence. Briefly, 0.5 mL of thaw-and-use PD-L1 aAPC / CHO-K1 cells suspension was transfered to 14.5 mL of cell recovery medium (90% Ham's F12 / 10% FBS) and mixed well by gently inverting 1-2 times. 100 uL of the cell suspension were dispensed to each of the inner 60 wells of two 96-well, white, flat-bottom assay plates. 100 pL of cell recovery medium were added to each of the outside wells of the assay plates. The assay plates was then covered with a lid, and incubated for 16-20 hours in a 37°C, 5% CO2 incubator. After overnight incubation, the medium was removed by flicking the plate. 40 pL of the test item concentration ranges and 40 pL of the thaw and use PD-1 effector cells suspension, all prepared in assay buffer (99% RPMI1640 / 1% FBS), were immediately added to the inner wells. Subsequently, 80 WL of assay buffer were added to the outside wells and the plate was covered and incubated for six hours in a 37°C, 5% CO2 incubator. After the incubation period, the plate was allowed to equilibrate to ambient temperature for 5-10 minutes. 80 pL of Bio-Glo™ Reagent were added to the inner 60 wells of the assay plates and the plate was allowed to incubate at ambient temperature for 5— 30 minutes. Luminescence was finally measured and data analysis was performed on GraphPad Prism software V6. A Sac7d variant (B11, SEQ ID NO: 21) was found to inhibit PD1 / PD-L1 binding (Figure 3). A correlation between affinity and efficacy of neutralization was also observed (not shown). A dimer of B11 was also shown to be as efficient as controls (Figure 4). B11 is also named NF2 in the examples. This variant was also found to interact with both the human and mouse PD-L1 proteins (figure 2). This property is of particular interest as such species crossing is not observed often for PD-L1 binders, and is useful for pre-clinical studies. Affinity of B11 to PD-L1 proteins (Surface Plasmon Resonance) is about Kp = 1.5x10°® M (human) and Kp = 3.2x10°® M (mouse). Maturation of the protein made it possible to determine that the key amino acids that need to be present for obtaining binding to human PD-L1 are 18, 126, L31, M42 and L44. R24, Y29, K33 are further needed for binding to mouse PD-L1. Example 2. Characterization of a variant of Sac7d binding to HSP110 A Sac7d variant (A-C2, SEQ ID NO: 27) was found to bind to HSP110 and to inhibit HSP110-Stat3 binding. A-C2 favored expansion of anti-tumoral M1 macrophages. A-C2 is also named NF1 in the examples. Maturation of the protein made it possible to determine that the key amino acids that need to be present for obtaining binding to human PD-L1 are W8, R9, W21, D22, W24, Y31, H33, M40 and K44. Example 3. In vivo experiments - _anti-HSP110 variant alone or in combination with anti-PD-L1 variant Material and methods All in vivo experiments were performed using the CAM technology, corresponding to the graft of cancer cells onto the chorioallantoic membrane (CAM) of chick embryos (see Kroiss et al, Oncogene. 2015 May 28;34(22):2846-55; Green et al, PLoS One. 2009 Aug 21:4(8):e6713). MDA-MB-231 human breast carcinoma cell line were grafted on the CAM of 9-days old chick embryos, with treatments between days 10 and 17 (1 to 8 days prior to grafting, followed by analysis for toxicity and tumor growth inhibition. In brief, fertilized White Leghorn eggs were incubated at 37.5°C with 50% relative humidity for 9 days. At that moment (ES), the chorioallantoic membrane (CAM) was dropped down by drilling a small hole through the eggshell into the air sac, and a 1 cm? window was cut in the eggshell above the CAM. At least 20 eggs (depending on embryo surviving rate after 9 days of development, there could be more than 20 eggs per group) were used for each group. An inoculum of 1.10° MDA-MB-231 cells was added onto the CAM of each egg Keytruda® (pembrolizumab) was used as the reference compound. Six experimental groups as described in Table 2. Group 1 Neg. Ctrl. (Vehicle) PBS [ = or 3 Description Compound Dose (mg / kg) Neg. Ctrl. (Vehicle) PBS |= Pos. Ctrl. Keytruda® 2 Exp. Cpd. 1[1] A-C2(NF1) |2 ra Exp. Cpd. 112] A-C2 20 Exp. Cpd. 2 [1] A-C2-B11 2 Exp. Cpd. 2 [2] A-C2-B11 20 EN 1 Exp. Cpd [6 Exp. Cpd Table 2. Study groups On day E10, tumors began to be detectable. Treatments corresponding to different groups are detailed in Table 3. After each treatment, eggs were individually checked daily for death or visible abnormalities (visual checks). 3 “ZINE NF1 mg / kg [a TZO[NFT NF1 mg / kg rs 6 [Group | Description Treatment | Injected [C] Final [C] Dosing (in 100 pl / egg) | (in ovo) Regimen Em “Neg Cit. [PBS = = E10, E12, E14, E15, E17 [2 [Reyiuda |Keytuda® [0.12mg / i00 ul | 2mgkg | E10, E12, E14, E15, E17 [3 Troe ZW T[oAZmg / t00 iT | 2mgkg E10, E12, mg / kg E14, E15, E17 [a Tre T20[NFT | [12mgAc0n [20mgkg | E10, E12, mg / kg E14, E15, E17 [6 T[NFT-NFz-2|NFT-NFZ | 0.12 mg / 00 il | 2 mg / kg E10, E12, mg / kg E14, E15, E17 [6 Tre Tee Tro Tow E10, E12, 20 mg / kg E14, E15, E17 Table 3. Description of treatment groups Quantitative Evaluation of Tumor Growth On day E18, the upper portion of the CAM (with tumor) was removed from all viable embryos with tumors, washed by PBS buffer and then directly transferred in PFA (fixation for 48 hrs.). After that, tumors were carefully cut away from normal CAM tissue and weighed. A one-way ANOVA analysis with post-tests is performed on the data. Quantitative Evaluation of immune Cell Infiltration On day E18, 6 tumor samples per group were collected to evaluate the infiltration of immune cells. Each tumor sample was removed, washed by PBS buffer and then directly transferred in 4% PFA (fixation for 48 hr). After that, genomic RNA was extracted from fixed tumor (commercial kit) and analyzed by RT-gPCR with specific primers for chicken CD3 and MMD sequences. For all points done in qPCR, expression of GAPDH is also analyzed, as reference gene expression, and used to normalize immune biomarker expression between samples. A one-way ANOVA analysis with post-tests is done on the data. Quantitative Evaluation of Embryonic Toxicity Embryonic viability was checked daily. The number of dead embryos was also counted on E18, in combination with the observation of eventual visible gross abnormalities, to evaluate treatment-induced embryo toxicity. Significance of Statistical Analysis For all analyses, statistical difference between groups are made visible on graphs by the presence of stars with the following meaning: « No star: No statistical difference (p value > 0.05); «* 0.05 2 p-value > 0.01; «** 0.01 2 p-value > 0.001; « *** 0.001 2 p-value. Results Quantitative Evaluation of Tumor Growth Figure 5 presents the mean tumor weight (mg) measured in the different experimental groups at the end of study. Quantitative Evaluation of immune Cell Infiltration Chicken CD3 expression in tumor Figure 6 present data analysis of data analysis of chicken CD3 expression in tumor. Chicken MMD expression in tumor Figure 7 present data analysis of chicken MMD expression in tumor. Quantitative Evaluation of Embryonic Toxicity Figure 8 present the number of dead and surviving embryos at the end of the study. Conclusion The aim of this project was to evaluate the toxicity and efficacy of an anti-HSP110 (NF1, A-C2) alone or as a dimer with an anti-PD-L1 (NF2, B11) against tumors initiated from MDA-MB-231 human breast carcinoma cell line in a CAM Model. Keytruda® was used as the Reference compound. In terms of tumor growth, when compared to the Negative Control, both NF1 and NF1-NF2 compounds induced a significant tumor growth inhibition at the high dose (20 mg / kg). The effect of NF1-NF2 compound is dose dependent, its performance at 20 mg / kg is evidently better than at 2 mg / kg. In terms of immune cells filtration in tumor, an increase tendency of CD3 positive cells infiltration was observed in presence of Keytruda; an increase tendency of MMD positive cells was observed in presence of the tested compounds, with a dose effect for NF1 alone. All these increases are not statistically significant. Finally, treatments with both NF1 and NF1-NF2 compounds did not induce any evident embryonic toxicity at all tested doses when compared to Negative Control. Example 4. Study of efficacy of NF-B11 compound on breast carcinoma tumors initiated from MDA-MB-231 cell lines The CAM model as described in example 3 was used. Treatments At day 10 (E10), tumors began to be detectable. They were then treated during 10 days, every two days (E11, E13, E15, E17) by dropping 100 pl of vehicle (in PBS), Ref Compound (Tecentrig / Atezolizumab), and NF-B11 at two different doses onto the tumor (see Table 4 for concentration). Group 2 Positive Ctrl (Ref. | Tecentriq 1,02pug / mL Group Molecule Name Concentration description Group 1 Negative Ctrl Neg Ctrl PBS vehicle Group 2 Positive Ctrl (Ref. | Tecentriq 1,02pug / mL Compound Group 3 Exp. Group 2 NF-B11 10XIC50 | 41ug / mL Group 4 Exp. Group 3 NF-B11 100XIC50 | 410ug / mL Table 4. Experiments Results Tumors Growth Table 5 presents the mean values of the tumor weights for the different experimental groups at E18. regression N / A 18,62 24,10 n Tumor weight | SD SEM % of tumor mo Neg Ctrl 12,19 6,88 1,98 N / A Tecentri 9,92 3,34 0,96 18,62 NF-B11 12 9,25 3,72 1,07 24,10 10XIC50 NF-B11 11 6,45 2,44 0,73 47,06 100XIC50 i NF-B11 11 6,45 2,44 0,73 47,06 100XIC50 Table 5. Mean value, SD, SEM and p-value of tumor weight (mg) for each experimental group Figure 9 presents the mean tumor weight (mg) measured in the different experimental groups after 10 days of treatment on the CAM. Toxicity Table 6 presents the number of dead and surviving embryos after 10 days of treatment in the different experimental groups. Total Alive Dead % alive % dead 16 11 5 69 31 16 12 4 75 25 NF-B11 16 12 4 75 25 10XIC50 NF-B11 16 12 4 75 25 100XIC50 TAN wr A NF-B11 16 12 4 75 25 100XIC50 Table 6. Number of dead and surviving embryo for each experimental group. In term of results, Tecentriq has no statistical effect compared to negative control while NF-B11 treatment shows a 47% reduction of tumor weight, for the treatment at 50 times the IC50 respectively. For the dose of 10 times the IC50, the tumor reduction is around 24% but is not statistically different compare to negative control. Example 5. Study of efficacy of NF-B11 compound on breast carcinoma tumors initiated from MDA-MB-231 cell lines Treatments At day 10 (E10), tumors began to be detectable. They were then treated during 10 days, every two days (E11, E13, E15, E17) by dropping 100 pl of vehicle (in PBS), Ref Compound (Tecentrig), NF-B11 or NF-B11-B11 compounds (see Table 7 for concentration). Group description Molecule Name Final Concentration Neg Ctrl 0 Positive Ctrl (Ref. Tecentriq 200x IC50 Group 1 Neg Ctrl 0 Group 2 Positive Ctrl (Ref. Tecentriq 200x IC50 Compound Group 3 NF-B11 100xIC50 NF-B11 100xIC50 Group 4 10x 1C50 Group 5 100x IC50 Table 7. Groups for the study Tumor growth analysis At day 18 (E18) the upper portion of the CAM was removed, washed in PBS and then directly transferred in PFA (fixation for 48h). The tumors were then carefully cut away from normal CAM tissue. Tumors were then weighed. A one-way ANOVA analysis with post-tests has been done on these data. Significance on statistical analysis For tumor weight and metastasis, statistical difference between groups are visible on graphs by presence of stars with the following signification: - No stars: no statistical different (p value > 0.05); - One star (*): 0.052 p value > 0.01; - Two stars (**): 0.01 2 p value > 0.001; - Three stars (***): 0.001 = p value. Toxicity The number of dead embryo evaluates the acute toxicity after 10 days of the treatment. Results Tumors Growth Figure 10 presents the mean tumor weight (mg) measured in the different experimental groups after 10 days of treatment on the CAM. Toxicity Table 8 presents the number of dead and surviving embryos after 10 days of treatment in the different experimental groups. Total Alive Dead % alive % dead 18 18 0 100 0 16 13 3 81 19 NF-B11 18 17 1 94 6 NF-B11- 17 13 4 76 24 B11 10x NF-B11- 18 17 1 94 6 B11 100x NF-B11- 18 17 1 94 6 B11 100x Table 8 Number of dead and surviving embryo for each experimental group. The study tested the efficacy of anti-PD-L1 (NF-B11) compounds on tumor initiated from MDA-MB-231 cells. In this study, Tecentriq, and NF-B11-B11 at 10 times IC50 have a significant effect on tumor weight (16-17 % reduction). Concerning toxicity, the ratio of dead embryo is higher in treated group NF-B11- B11 at 10 time IC50, but is lower in treated group NF-B11-B11 at 100X IC50 showing that there is no specific toxicity due to treatment (at the doses tested). Example 6. Evaluation of In Vivo Toxicity and Efficacy of 2 Compounds in Tumors Derived from MDA-MB-231 Human Breast Cell Line in a CAM Model Group Description Description Compound Dose (mglkg) PBS ns Pos. Ctrl. 2 Exp. Cpd. 11 NF2 2 Exp. Cpd. 12 NF2 20 Exp. Cpd. 2 [1 NF1-NF3 2 6 Exp. Cpd. 2[2 NF1-NF3 20 Table 9. Compounds and concentration NF1: anti-HSP110 Sac7d variant (A-C2) NF2 : anti-PD-L1 sac7d variant (B11) NF3 : variant of Sac7d binding to EGFR Treatments On day E10, tumors began to be detectable. Treatments corresponding to different groups are detailed in Table 10. After each treatment, eggs were individually checked daily for death or visible abnormalities (visual checks). Group | Description | Treatment Injected [C] | Final [C] Dosing (in 100 (in ovo) Regimen lle: 1 Neg. Ctrl. PBS — | = E10, E12, rz = NF2-2 NF2 mg / kg ra NF2 - 20 NF2 mg / kg 5 re Mm Neg. Ctrl. | PBS — wm E10, E12, | E14, E15, E17 2 Keytruda Keytruda® 0.12 mg / 100 | 2 mg / kg E10, E12, ul E14, E15, E17 EN NF2-2 NF2 0.12mg / 100 | 2 mg / kg E10, E12, mg / kg Hl E14, E15, E17 ra NF2 - 20 NF2 12mg / 00 | 20 mgikg E10, E12, ma / kg ul E14, E15, E17 [5 NF1-NF3-2 | NF1-NF3 0.12mg / 100 | 2 mg / kg E10, E12, ma / kg ul E14, E15, E17 6 NF1-NF3- | NF1-NF3 12mg / 00 | 20 mgikg E10, E12, 20 mg / kg ul E14, E15, E17 Table 10. Description of treatment groups. Results Quantitative Evaluation of Tumor Growth Figure 11 presents the mean tumor weight (mg) measured in the different experimental groups at the end of study. Mean values + SEM of tumor weight (mg). Quantitative Evaluation of immune Cell Infiltration Chicken CD3 expression in tumor Figure 12 present data analysis of chicken CD3 expression in tumor. Chicken MMD expression in tumor Figure 13 present data analysis of data analysis of chicken MMD expression in tumor. Quantitative Evaluation of Embryonic Toxicity Table 11 present the number of dead and surviving embryos at the end of the study. rz Group | Description | Total Alive Dead | % Alive | % Dead EN Neg. Ctrl. 23 17 6 73,91 26,09 [2 "[Keytruda 20 14 G5 70,00 30,00 ERLE 2] 24 18 [8 [6250 [37.50 mg / kg a TIN Tmo(z [ |7 fees [33 mg / kg [8 T[NFINFs-2(24 [16 [8 [6667 [3333 mg / kg [6 T[NFiNFs-2021 [14 |7 [e667 [3333 mg / kg Table 11. Number of dead and alive embryos per group First, in terms of tumor growth, when compared to the Negative Control, both NF2 and NF1-NF3 compounds didn’t impact tumor growth at the low dose (2 mg / kg); at the high dose (20 mg / kg), we observed the tumor growth regression tendency for both compounds, but the tumor growth inhibition was significant only for NF1-NF3. Second, in terms of tumor immune cells filtration, we observed an increase tendency of CD3 positive cells infiltration in presence of Keytruda; an increase tendency of MMD positive cells in presence of the Sac7d variants, with a dose effect for NF2 alone. All these increases are not statistically significant. Finally, treatments with both NF2 and NF1-NF3 compounds did not induce any evident embryonic toxicity at all tested doses when compared to Negative Control. Example 7. Further elements Nanofitins were derived by ribosome display against human PDL1 using the 200 aa long recombinant ECD from R&D system (ref 156-B7), that consists of the two immunoglobulin-like domains fused to an IgG1 Fc fragment. A large number of different Nanofitins were isolated with a specific signal in ELISA for human PDL1, which was immobilized by physisorption. It was possible to group these proteins into cluster of sequences based on the homology of their variable domains. Candidates were then screened for their ability at engaging their target in a biolayer interferometry set up (Octet RED96). In this setup, the target was immobilized on protein A biosensors to ensure a native and oriented presentation of the target. 60 % of the candidates retained their ability at engaging human PDL1 in this set up, out of which only 30% (16 % of the total) were found to cross react with murine PDL1. All the cross reactive Nanofitin were restricted within one cluster, highlighting the differential drugability of human and murine PDL1. The ability of the Nanofitins from this cluster at neutralizing the interaction between PDL1 and PD1 was evaluated in a competition ELISA, and compared to candidates from other clusters. Competition ELISA was performed according to the following procedure. Human PD1 was immobilized on NUNC maxisorp plate (100 HL, 1 pg / mL, 1 hr). The well were blocked using TBS-BSA (20 mM Tris, 150 mM NaCl, 0.5 % BSA, pH 7.4) for 1 hr (300 uL / well). Between each of the following steps, each well was washed 3 time using 300 pL of TBS-T (20 mM Tris, 150 mM NaCl, 0.1 % Tween 20, pH 7.4). The Nanofitins were mixed with biotinylated human PDL1 (100 nM) in TBS-T (100 pL final) and applied to the wells. Revelation was then carried over by the addition of 100 pl of streptavidin HRP conjugate diluted 1:10000 in TBS-T for 1 h, followed by the addition of 100 pl of o- Phenylenediamine dihydrochloride substrate (Sigma-Aldrich) solution at 1 mg / ml in revelation buffer (0.05 M citric acid, 0.05% hydrogen peroxide). Absorbance at 450 nm was measured using a Varioskan ELISA plate reader (Thermo Scientific). Two Nanofitin candidates from the cluster were capable of neutralizing the interaction between human PDL1 and human PD1 with a neutralization potential appearing to be well correlated with their affinity, with the lowest affinity providing the highest neutralization efficiency. It was noted that similar affinity does not directly translate with similar neutralization potential between the different clusters. It was shown that the two selected nanofitins (SEQ ID NO: 38 and SEQ ID NO: 59) are targeting the |g like V type domain of PDL1 ECD on an epitope that is in close proximity or overlapping with the interaction area between human PDL1 and human PD1, and that is shared on murine PDL1. These variants show the highest affinity on human PDL1 and SEQ ID NO: 38 / SEQ ID NO: 41 showed the highest level of cross reactivity on human and mouse PDL1, whereas SEQ ID NO: 68 / SEQ ID NO: 71 had the best efficacy. Modification of D16, N36 and M56 (replacement by E, Q and L respectively) didn’t change the affinity or neutralization potential. Modifications of the mutated amino acids showed that 18, 126, L31, M42, L44 (and R24, Y29 and K33 for murine binding) are important for maintaining binding and neutralization for one Nanofitin, and that M8, L26, L31, L42 and F44 (and T24, A29 and R33 for murine binding) are important for maintaining binding and neutralization for the other. Example 8. Anti-HSP110 binders Nanofitines were also generated as Hsp110 binders. In brief, screening was performed with Sac7d variants, and the identified and sequenced proteins were grouped among four groups according to their sequence and signature. Among these groups, 20 different Nanofitin binding site compositions could be identified. These 20 Nanofitin candidates were compared for their binding level in ELISA at a fixed concentration (1 uM). The variant corresponding to SEQ ID NO: 80 (or SEQ ID NO: 27, A-C2) was determined to present the best affinity and neutralization potential. Substitutions of amino acids, as described above, showed that W8, D22, W24 (which is conserved with regards to the wild-type protein), H33 and K44 are important for maintaining binding and affinity. Affinity for this protein was below 1 nM, and it was shown that it was unable to penetrate into eukaryotic cells. A combinational immunotherapeutic effect of A-C2 and an anti PD-L1 Nanofitin was shown in vivo in the chicken choricallantoic membrane (CAM) model (see also example 3 above). Altogether, these results demonstrate the therapeutic interest of A-C2 in cancer by itself, despite a lack on internalization, through an effect believed to involve macrophages, as well as its complementarity with a protein inhibiting binding of PD-L1 and PD1 (in particular a Nanofitin anti-PD-L1).
Claims
CLAIMS 1. A polypeptide comprising a variant of a member of the Sac7d family binding to human PD-L1 and inhibiting the liaison of PD-L1 with PD1, wherein the variant comprises from 4 to 20 mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand.
2. The polypeptide of claim 1, wherein the variant comprises the Y8M, V26L, S31L, R42L and A44F mutations, or the Y8I, V28I|, S31L, R42M, and A44L mutations, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO:
1.
3. The polypeptide of claim 1 or 2, wherein the variant comprises the Y8M, W24T, V26L, M29A, S31L, T33R, R42L and A44F mutations, or, the Y8I, W24R, V26l, M29Y, S31L, T33K, R42M, and A44L mutations with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO: 1, wherein said variant also binds to mouse PD-L1.
4. The polypeptide of any one of claims 1 to 3, wherein the variant further comprises at least one mutation selected from D16E, N37Q and M57L, with the numbering corresponding to the position in the Sac7d sequence SEQ ID NO:
1.
5. The polypeptide of any one of claims 1 to 4, wherein the mutated residues in the interface of binding of the member of the Sac7d family to its natural ligand are selected from the group consisting of V2, K3, K5, K7, Y8, K9, G10, E14, T17, K21, K22, W24, V26, G27, K28, M29, S31, T33, D36, N37, G38, K39, T40, Add, S46, E47, K48, D49, AB0 and P51 of Sac7d.
6. The polypeptide of any one of claim 1 to 5, which is selected from the group consisting of Sac7d from Sulfolobus acidocaldarius, Sac7e from Sulfolobus acidocaldarius, SSo7d from Sulfolobus solfataricus, Ssh7b from Sulfolobus shibatae, Ssh7a from Sulfolobus shibatae, DBP7 from Sulfolobus tokodaii, Sis7a from Sulfolobus islandicus, Mse7 from Metallosphaera sedula, Mcu7 from Metallosphaera cuprina, Aho7a from Acidianus hospitalis, Aho7b from Acidianus hospitalis, Aho7c from Acidianus hospitalis and Sto7 from Sulfurisphaera tokodaii.
7. The polypeptide of any one of claims 1 to 6, which comprises a sequence selected from SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, and amino acids 1-57 of these sequences.
8. The polypeptide of claim 7, which comprises a sequence selected from SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 82, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and amino acids 1-57 of these sequences.
9. The polypeptide of claim 7, which comprises a sequence selected from SEQ ID NO: 62, SEQ ID NO: 59, SEQ ID NO: 41, SEQ ID NO: 38, and amino acids 1-57 of these sequences.
10. The polypeptide of any one of claims 1 to 6, which comprises SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, or SEQ ID NO: 23 or amino acids 2-54 of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, or SEQ ID NO:
23.
11. The polypeptide of any one of claims 1 to 8, which comprises SEQ ID NO: 21 or amino acids 2-54 of SEQ ID NO:
21.
12. The polypeptide of any one of claims 1 to 6, which comprises a sequence selected from SEQ ID NO: 71, SEQ ID NO: 68, SEQ ID NO: 50, SEQ ID NO: 47, and amino acids 1-54 of these sequences.
13. The polypeptide of any one of claims 1 to 12, which consists in the variant of a member of the Sac7d family binding to human and mouse PD-L1.
14. The polypeptide of any one of claims 1 to 13, wherein the variant of a member of the Sac7d family binding to human PD-L1 is conjugated to an organic molecule.
15. The polypeptide of any one of claims 1 to 13, wherein the variant of a member of the Sac7d family binding to human PD-L1is conjugated to another polypeptide, in particular another variant of a protein of the Sac7d family.
16. The polypeptide of claim 15, wherein the other protein is a variant of the Sac7d family binds to HSP110 or to EGFR.
17. The polypeptide of claim 16, wherein the other variant comprises a polypeptide selected from the group consisting of SEQ ID NO: 83, SEQ ID NO: 80, SEQ ID NO: 75, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28 or SEQ ID NO: 29, and amino acids 1-57 of these sequences.
18. The polypeptide of claim 17, wherein the other variant comprises the sequence SEQ ID NO: 83 or SEQ ID NO: 80, or amino acids 1-57 of these sequences.
19. A nucleic acid molecule coding for the polypeptide of any one of claims 1 to 13, and 15to 18.
20. A pharmaceutical composition comprising the polypeptide of any one of claims 1-18, or the nucleic acid of claim 19, and a pharmaceutically acceptable carrier 21. A method for producing the polypeptide of any one of claims 1 to 13 and 15 to 18, comprising the steps consisting of a. Culturing a cell culture wherein the cells have been transformed by the nucleic acid of claim 19, and b. Recovering the polypeptide.
22. A polypeptide according to any one of claims 1 to 18 as a medicament.
23. A polypeptide according to any one of claims 1 to 18, for use thereof for the treatment of cancer, in particular a non-small cell lung carcinoma, an urothelial carcinoma, a gastric cancer, a liver cancer, a kidney cancer, a head and neck squamous cell cancer, an esophageal squamous cell carcinoma, a primary mediastinal B-cell lymphoma, a classical Hodgkin lymphom, a melanoma, a merkel cell carcinoma, a cervical cancer, a microsatellite instability-high cancer, a bladder cancer, a breast cancer, a small cell lung cancer, a colorectal cancer, a pancreatic cancer or a prostate cancer.
24. The polypeptide for use according to claim 23, in combination with chemotherapy or treatment with CAR-T cells.
25. A composition containing a polypeptide according to any one of claims 1 to 18 and a chemotherapy agent or CAR-T cells for simultaneous, separate or sequential (spread out over time) use in the treatment of cancer, in particular a non-small cell lung carcinoma, an urothelial carcinoma, a gastric cancer, a liver cancer, a kidney cancer, a head and neck squamous cell cancer, an esophageal squamous cell carcinoma, a primary mediastinal B-cell lymphoma, a classical Hodgkin lymphom, a melanoma, a merkel cell carcinoma, a cervical cancer, a microsatellite instability-high cancer, a bladder cancer, a breast cancer, a small cell lung cancer, a colorectal cancer, a pancreatic cancer or a prostate cancer.
Citation Information
Patent Citations
OB-fold used as scaffold for engineering new specific binders
EP1930342A1
OB-fold is used as a scaffold for engineering and manipulating new specific conjugates.
JP2010511691A
Multi specific molecules
WO2019096797A1