Trispecific antibody targeting BCMA, GPRC5d, and CD3

AU2022221884B2Pending Publication Date: 2026-07-30JANSSEN PHARMA NV
View PDF 4 Cites 0 Cited by

Patent Information

Authority / Receiving Office
AU · AU
Patent Type
Applications
Current Assignee / Owner
JANSSEN PHARMA NV
Filing Date
2022-02-15
Publication Date
2026-07-30

AI Technical Summary

Technical Problem

Current treatments for multiple myeloma lack effective curative options, with existing therapies facing challenges such as clonal resistance and the need for targeting multiple tumor antigens to enhance tumor eradication and prevent antigen escape.

Method used

Development of multispecific antibodies that bind to B-cell maturation antigen (BCMA), G-protein coupled receptor class C, group 5, member D (GPRC5D), and cluster determinant 3 (CD3), which are trispecific, allowing for simultaneous targeting of these antigens to enhance cancer cell killing and minimize cytokine release syndrome.

Benefits of technology

The multispecific antibodies effectively target BCMA and GPRC5D-expressing cancer cells, promoting efficient tumor eradication, reducing the risk of antigen escape, and potentially mitigating cytokine release syndrome, thereby improving treatment outcomes for multiple myeloma.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000001_0000
    Figure 00000001_0000
  • Figure 00000240_0000
    Figure 00000240_0000
  • Figure 00000241_0000
    Figure 00000241_0000
Patent Text Reader

Abstract

Provided herein are multispecific antibodies that bind to BCMA, GPRC5D and CD3 and multispecific antigen-binding fragments thereof. Also described are related polynucleotides capable of encoding the provided multispecific antibodies or multispecific antigen-binding fragments, cells expressing the provided multi specific antibodies or multispecific antigen-binding fragments, as well as associated vectors and detectably labeled multispecific antibodies or multispecific antigen-binding fragments. In addition, methods of producing and using the provided multispecific antibodies and multispecific antigen-binding fragments are described. Further provided herein are antibodies that bind to BCMA and antigen-binding fragments thereof. Also described are related polynucleotides capable of encoding the provided BCMA-specific antibodies or antigen- binding fragments, cells expressing the provided BCMA-specific antibodies or antigen- binding fragments, as well as associated vectors and detectably labeled BCMA-specific antibodies or antigen-binding fragments. In addition, methods of producing and using the provided BCMA-specific antibodies and antigen-binding fragments are described.
Need to check novelty before this filing date? Find Prior Art

Description

CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of United States Provisional Application Serial Number 63 / 149,921, filed 16 February 2021. The entire content of the aforementioned application is incorporated herein by reference in its entirety. TECHNICAL FIELD The disclosure provided herein relates to multispecific antibodies that bind B-cell maturation antigen (BCMA), G-protein coupled receptor, class C, group 5, member D (GPRC5D), and cluster determinant 3 (CD3), monoclonal antibodies that bind BCMA, and methods of producing and using the described antibodies. BACKGROUND Multiple myeloma (MM) is the second most common hematological malignancy and constitutes 2% of all cancer deaths. MM is a heterogenous disease and caused mostly by chromosome translocations inter alia t(l 1; 14),t(4; 14),t(8;14),del(13),del(17) (Drach et al., (1998) Blood 92(3):802-809; Gertz et al., (2005) Blood 106(8):2837-2840; Facon et al., (2001) Blood 97(6): 1566-1571). MM-affected patients may experience a variety of disease-related symptoms due to, bone marrow infiltration, bone destruction, renal failure, immunodeficiency, and the psychosocial burden of a cancer diagnosis. As of 2006, the 5-year relative survival rate for MM was approximately 34% highlighting that MM is a difficult-to-treat disease where there are currently no curative options. B-cell maturation antigen, also known as BCMA, CD269, TNFRSF17 (UniProt Q02223), is a member of the tumor necrosis receptor superfamily that is preferentially expressed in differentiated plasma cells [Laabi et al. (1992) EMBO J 11(11):3897-3904; Madry etal. (1998) Int Immunol 10(11):1693-1702]. BCMA is a non-glycosylated type I transmembrane protein, which is involved in B cell maturation, growth and survival. BCMA is a receptor for two ligands of the TNF superfamily: APRIL (a proliferationinducing ligand, CD256, TNFSF13), the high-affinity ligand to BCMA, and the B cell activation factor BAFF (THANK, BlyS, B lymphocyte stimulator, TALL-1 and zTNF4), the low-affinity ligand to BCMA. APRIL and BAFF show structural similarity and overlapping yet distinct receptor binding specificity. The negative regulator TACI also binds to both BAFF and APRIL. The coordinate binding of APRIL and BAFF to BCMA and / or TACI activates transcription factor NF-kB and increases the expression of prosurvival Bcl-2 family members (e.g. Bcl-2, Bcl-xL, Bcl-w, Mcl-1, Al) and down regulates expression of pro-apoptotic factors (e.g. Bid, Bad, Bik, Bim, etc.), thus inhibiting apoptosis and promoting survival. This combined action promotes B cell differentiation, proliferation, survival and antibody production (as reviewed in Rickert RC et al., Immunol Rev (2011) 244 (1): 115-133). In line with this finding, BCMA also supports growth and survival of malignant human B cells, including multiple myeloma (MM) cells. Novak et al. found that MM cell lines and freshly isolated MM cells express BCMA and TACI protein on their cell surfaces and have variable expression of BAFF-R protein on their cell surface (Novak et al., (2004) Blood 103(2):689-694). The use of anti-BCMA antibodies for the treatment of lymphomas and multiple myeloma are mentioned in WO2002066516 and WO2010104949. Antibodies against BCMA are described e.g. in Gras M-P. et al. Int Immunol. 7 (1995) 10931106, WO200124811, and WO200124812. Nevertheless, despite the fact that BCMA, BAFF-R and TACI, i.e., B cell receptors belonging to the TNF receptor superfamily, and their ligands BAFF and APRIL are subject to therapies in fighting against cancer, further options for the treatment of such medical conditions are needed. G-protein coupled receptor, class C, group 5, member D (GPRC5D) is an orphan, atypical, class C GPCR first identified in 2001 (Brauner-Osborne et al. Biochim Biophys Acta. 1518(3):237-248, 2001). GPRC5D and other group 5 GPCRs have unusually short amino-terminal domains for class C receptors, and are therefore, predicted to be conformationally similar to class A receptors. In this regard they are unique, with sequence homology to class C GPCRs and predicted structural topology comparable to class A receptors. Functional consequence of GPRC5D activation has not been described and the ligand remains unknown. The gene has three exons and is located on chromosome 12p 13.3 in humans. GPRC5D receptor is highly conserved among various species and shares 92% identity with cynomolgus monkey GPRC5D. The use of anti-GPRC5D antibodies for the treatment of multiple myeloma are mentioned in WO2016090329, WO2018017786, WO2018147245, and WO2019154890. Nevertheless, despite the fact that GPRC5D is subject to therapies in fighting against cancer, further options for the treatment of such medical conditions are needed. GPRC5D mRNA is predominantly expressed in all malignant plasma cells from MM patients (Atamaniuk JA et al. Eur J Clin Invest 42(9) 953-960; 2012; Frigyesi-blood and Cohen, et al. Hematology 18(6): 348-35; 2013). GPRC5D expression is variable among the patients and correlate well with plasma cell burden and genetic aberrations such as Rb-1 deletion (Atamaniuk JA et al. Eur J Clin Invest 42(9) 953-960; 2012). Clonal resistance is a common mechanism in relapse refractory myeloma. Targeting more than one myeloma tumor antigen and engaging T-cells could lead to efficient killing of malignant plasma cells and minimal residual disease (MRD) negativity. Dual BCMA and GPRC5D targeting enhances antibody avidity and potency, maximizes tumor eradication in presence of a heterogenous cell population, prevents tumor antigen escape (e.g., captures MM cells that do not express enough BCMA or GPRC5D alone), improves tumor efficacy and may mitigate potential for cytokine release syndrome (CRS). Accordingly, there is a need for therapeutic antibodies that target both BCMA and GPRC5D for the treatment of multiple myeloma and / or related medical conditions. SUMMARY In one aspect, provided herein are multispecific antibodies that bind, or specifically bind, to BCMA, GPRC5D and CD3 and multispecific antigen-binding fragments thereof. In some embodiments, provided herein are trispecific antibodies that bind, or specifically bind, to BCMA, GPRC5D and CD3 and trispecific antigen-binding fragments thereof. Also described are related polynucleotides capable of encoding the provided BCMA x GPRC5D x CD3-multispecific antibodies or multispecific antigen-binding fragments, cells expressing the provided antibodies or multispecific antigen-binding fragments, as well as associated vectors and detectably labeled multispecific antibodies or multispecific antigen binding fragments. In addition, methods of using the provided multispecific antibodies are described. For example, the BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments may be used to treat cancer (e.g., BCMA and / or GPRC5D-expressing cancer); the BCMA x GPRC5D x CD3-multispecific antibodies may be used to diagnose or monitor BCMA and / or GPRC5D-expressing cancer progression, regression, or stability; to determine whether or not a patient should be treated for cancer; or to determine whether or not a subject is afflicted with BCMA and / or GPRC5D-expressing cancer and thus may be amenable to treatment with a BCMA and / or GPRC5D-specific anti-cancer therapeutic, such as the BCMA x GPRC5D x CD3-multispecific antibodies described herein. BCMA x GPRC5D x CD3-Multispecific Antibodies Described herein are isolated multispecific antibodies that bind BCMA, GPRC5D and CD3 (“BCMA x GPRC5D x CD3 multispecific antibodies”) and multispecific antigenbinding fragments thereof. In preferred embodiments, the BCMA x GPRC5D x CD3 multispecific antibody or antigen-binding fragment is a trispecific antibody or antigen-binding fragment. In some embodiments, an isolated BCMA x GPRC5D x CD3 trispecific antibody, or a trispecific binding fragment thereof, comprises: (a) a first antigen-binding arm comprising a first heavy chain variable domain (VH1) and a first light chain variable domain (VL1); (b) a second antigen-binding arm comprising a second heavy chain variable domain (VH2) and a second light chain variable domain (VL2); and (c) a third antigen-binding arm comprising a third heavy chain variable domain (VH3) and a third light chain variable domain (VL3). In some embodiments, the first antigen-binding arm binds to an epitope on CD3, the second antigen-binding arm binds to an epitope on GPRC5D, and the third antigen-binding arm binds to an epitope on BCMA. In some embodiments, the first antigen-binding arm of the trispecific antibody, or a trispecific binding fragment thereof comprises a first heavy chain portion (HC1) comprising the VH1 and a light chain portion comprising the VL1. The VH1 and the VL1 form a first antigen-binding domain that binds a first antigen. The second antigen-binding arm of the trispecific antibody or trispecific binding fragment thereof comprises a second heavy chain portion (HC2) comprising the VH2. The VH2 of the HC2 forms a second antigen-binding domain that binds a second antigen. The HC1 or the HC2 is further coupled to the third antigen-binding arm comprising the VH3 that forms a third antigenbinding domain that binds a third antigen. The HC1 and HC2 each optionally comprise a Fragment crystallizable (Fc) domain, where the Fc domain comprises a constant heavy chain region 2 (CH2) and CH3. In some embodiments, the first antigen is cluster of differentiation 3 (CD3), and the second antigen is B cell maturation antigen (BCMA), and the third antigen is G-protein coupled receptor family C group 5 member D (GPRC5D). In some embodiments, the first antigen is cluster of differentiation 3 (CD3), and the second antigen is G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen is B cell maturation antigen (BCMA). Some aspects of the BCMA x GPRC5D x CD3 trispecific antibody, or a trispecific binding fragment thereof, are further described in the Detailed Description and Examples sections below. In some embodiments, the BCMA-binding arm binds human BCMA but not to cynomolgus monkey BCMA. In some embodiments, the BCMA-binding arm binds bind to an epitope including one or more residues from the BCMA extracellular domain (ECD). In some embodiments, the BCMA-binding arm (or “BCMA-specific arm”) of the BCMA x GPRC5D x CD3 multispecific antibody is derived from a BCMA antibody described herein (for example, from an antibody having the CDR sequences listed in Table 1). In some embodiments, the GPRC5D-specific arm of the multispecific antibody binds human GPRC5D but not to cynomolgus monkey GPRC5D. In some embodiments, the GPRC5D-specific arm of the BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments binds the extracellular domain of human GPRC5D. In some embodiments, the GPRC5D-binding arm (or “GPRC5D-specific arm”) of the BCMA x GPRC5D x CD3 multispecific antibody is derived from a GPRC5D antibody described herein (for example, from an antibody having the CDR sequences listed in Table 2). The redirection of T-lymphocytes to MM cells expressing BCMA and / or GPRC5D via the TCR / CD3 complex represents an attractive alternative approach. The TCR / CD3 complex of T-lymphocytes consists of either a TCR alpha (a) / beta ((P) or TCR gamma (y) / delta (6) heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma (y), delta (6), epsilon (a), zeta (Q, and eta (q). In some embodiments, the multispecific antibodies or multispecific antigen-binding fragments described herein bind to CD3s. In some embodiments, the CD3-binding arm (or “CD3-specific arm”) of the BCMA x GPRC5D x CD3 multispecific antibody is derived from the monoclonal antibody CD3B376. In some embodiments, the CD3-binding arm (or “CD3-specific arm”) of the BCMA x GPRC5D x CD3 multispecific antibody is derived from the monoclonal antibody SP34, a mouse IgG3 / lambda isotype. (K.R. Abhinandan and A. C. Martin, 2008. Mol. Immunol. 45, 3832-3839). In some embodiments, the CD3-binding arm of the BCMA x GPRC5D x CD3 multispecific antibody comprises the heavy chain CDRs and / or light chain CDRs described in Table 3, or any one VH domain and / or any one VL domain selected from Table 3. In some embodiments, the BCMA-, GPRC5D- and / or CD3-specific arms of the BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments are IgG, or derivatives thereof. The IgG class is divided in four isotypes: IgGl, IgG2, IgG3 and IgG4 in humans. They share more than 95% homology in the amino acid sequences of the Fc regions but show major differences in the amino acid composition and structure of the hinge region. The Fc region mediates effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the Fc region of an antibody binds to Fc receptors (FcyRs) on the surface of immune effector cells such as natural killers and macrophages, leading to the phagocytosis or lysis of the targeted cells. In CDC, the antibodies kill the targeted cells by triggering the complement cascade at the cell surface. For many applications of therapeutic antibodies, Fc-mediated effector functions are not part of the mechanism of action. These Fc-mediated effector functions can be detrimental and potentially pose a safety risk by causing off-mechanism toxicity. Modifying effector functions can be achieved by engineering the Fc regions to reduce their binding to FcyRs or the complement factors. The binding of IgG to the activating (FcyRI, FcyRIIa, FcyRIIIa and FcyRIIIb) and inhibitory (FcyRIIb) FcyRs or the first component of complement (Clq) depends on residues located in the hinge region and the CH2 domain. Mutations have been introduced in IgGl, IgG2 and IgG4 to reduce or silence Fc functionalities. In one embodiment, the antibody comprises an Fc region with one or more of the following properties: (a) reduced effector function when compared to the parent Fc; (b) reduced affinity to FcyRI, FcyRIIa, FcyRIIb, FcyRIIIb and / or FcyRIIIa, (c) reduced affinity to FcyRI (d) reduced affinity to FcyRIIa (e) reduced affinity to FcyRIIb, (f) reduced affinity to FcyRIIIb or (g) reduced affinity to FcyRIIIa. In some embodiments, the CD3-specific antibody or antigen-binding fragment from which the CD3-specific arm of the multispecific antibody is derived is IgG, or a derivative thereof. In some embodiments, the CD3-specific antibody or antigen-binding fragment from which the CD3-specific arm of the multispecific antibody is derived is IgGl, or a derivative thereof. In some embodiments, for example, the Fc region of the CD3-specific IgGl antibody from which the CD3-binding arm is derived comprises L234A, L235A, and D265S substitutions in its Fc region. In some embodiments, the CD3-specific antibody or antigen-binding fragment from which the CD3-specific arm of the multispecific antibody is derived is IgG4, or a derivative thereof. In some embodiments, for example, the Fc region of the CD3-specific IgG4 antibody from which the CD3-binding arm is derived comprises S228P, L234A, L235A, F405L, and R409K substitutions in its Fc region. In some embodiments, the CD3-specific antibody or antigen-binding fragment from which the CD3-specific arm of the multispecific antibody is derived binds CD3s on primary human T cells and / or primary cynomolgus T cells. In some embodiments, the CD3-specific antibody or antigen-binding fragment from which the CD3-specific arm of the multispecific antibody is derived activates primary human CD4+ T cells and / or primary cynomolgus CD4+ T cells. In addition to the described BCMA x GPRC5D x CD3-multispecific antibodies, also provided are polynucleotide sequences capable of encoding the described BCMA x GPRC5D x CD3-multispecific antibodies. In some embodiments, an isolated synthetic polynucleotide encoding the one or more CDRs of the heavy chain variable domain and / or one or more CDRs of the light chain variable domain of each antigen-binding arm of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment is provided. In some embodiments, an isolated synthetic polynucleotide encoding one or more heavy chain variable domains and / or one or more light chain variable domains of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment is provided. In some embodiments, an isolated synthetic polynucleotide encoding one or more polypeptide chains of the first, second, and / or third antigen-binding arms of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment is provided. Vectors comprising the described polynucleotides are also provided, as are cells expressing the BCMA x GPRC5D x CD3-multispecific antibodies provided herein. In another embodiment, an isolated cell expressing the multispecific antibody or multispecific binding fragment is provided. Also described are cells capable of expressing the disclosed vectors. These cells may be mammalian cells (such as 293 cells, 293F cells, CHO cells), insect cells (such as Sf7 cells), yeast cells, plant cells, or bacteria cells (such as E. coli). The described antibodies may also be produced by hybridoma cells. In some embodiments, methods for generating the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment by culturing cells is provided. Further provided herein are pharmaceutical compositions comprising the BCMA x GPRC5D x CD3 multispecific antibodies or antigen-binding fragments and a pharmaceutically acceptable carrier. Methods of using BCMA x GPRC5D x CD3-Multispecific Antibodies Methods of using the described BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments thereof are also disclosed. For example, the BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments thereof may be useful in the treatment of a GPRC5D and / or BCMA-expressing cancer in a subject in need thereof. In some embodiments, the GPRC5D and / or BCMA-expressing cancer is a lymphoma, such as multiple myeloma including smoldering multiple myeloma (SMM). In some embodiments, the GPRC5D and / or BCMA-expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. The described methods of treating GPRC5D and / or BCMA-expressing cancer in a subject in need thereof include administering to the subject a therapeutically effective amount of a described BCMA x GPRC5D x CD3-multispecific antibody or multispecific antigen-binding fragment thereof. In some embodiments, the subject is a mammal, preferably a human. In preferred embodiments are provided methods for treating a subject having cancer by administering a therapeutically effective amount of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific antigen-binding fragment to a patient in need thereof for a time sufficient to treat the cancer. Further provided herein are methods for inhibiting growth or proliferation of cancer cells by administering a therapeutically effective amount of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment to inhibit the growth or proliferation of cancer cells. Also provided herein are methods of redirecting a T cell to a GPRC5D and / or BCMA-expressing cancer cell by administering a therapeutically effective amount of the BCMA x GPRC5D x CD3 trispecific antibody or trispecific binding fragment to redirect a T cell to a cancer. The skilled person will understand that the methods of using the described BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments thereof may be specified in medical use format, for example in the form of BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments for use in the treatment of disease as defined herein, in particular cancer. This skilled person will also understand that the methods of using the described BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments thereof may be specified in so-called Swiss form, for example in the form of the use of BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments for the manufacture of a medicament for the treatment of disease as defined herein, in particular cancer. This applies throughout the disclosure. BCMA x GPRC5D x CD3-Specific Antibody Kits Described herein are kits including the disclosed BCMA x GPRC5D x CD3-multispecific antibodies. The described kits may be used to carry out the methods of using the BCMA x GPRC5D x CD3-multispecific antibodies provided herein, or other methods known to those skilled in the art. In some embodiments the described kits may include the antibodies described herein and reagents for use in treating a GPRC5D and / or BCMA-expressing cancer. Accordingly, the described kits may include one or more of the multispecific antibodies, or a multispecific antigen-binding fragment(s) thereof, described herein and a vessel for containing the antibody or fragment when not in use, and / or instructions for use of the antibody or fragment, the antibody or fragment affixed to a solid support, and / or detectably labeled forms of the antibody or fragment, as described herein. BCMA-Specific Antibodies Also provided herein are antibodies that bind to BCMA and antigen-binding fragments thereof. Also described are related polynucleotides capable of encoding the provided BCMA-specific antibodies and antigen-binding fragments, cells expressing the provided antibodies and antigen-binding fragments, as well as associated vectors and detectably labeled antibodies and antigen-binding fragments. In addition, methods of using the provided antibodies and antigen-binding fragments are described. For example, the BCMA-specific antibodies and antigen-binding fragments may be used to treat cancer (e.g., BCMA-expressing cancer); the BCMA-specific antibodies and antigen-binding fragments may be used to diagnose or monitor BCMA-expressing cancer progression, regression, or stability; to determine whether or not a patient should be treated for cancer; or to determine whether or not a subject is afflicted with BCMA-expressing cancer and thus may be amenable to treatment with a BCMA-specific anti-cancer therapeutic, such as the multispecific antibodies against BCMA and CD3 described herein. Some aspects of the BCMA-specific antibody, or an antigen-binding fragment, are further described in the Detailed Description and Examples sections below. Methods of using BCMA-Specific Antibodies Methods of using the described BCMA-specific antibodies or antigen-binding fragments are also disclosed. Particular antibodies for use in the methods discussed in this section include those with the set of CDRs described for antibodies in Table 1 (e.g., BCMB519). For example, these antibodies or antigen-binding fragments may be useful in treating cancer, by interfering with BCMA-receptor interactions or where the antibody is conjugated to a toxin, so targeting the toxin to the BCMA-expressing cancer. Further, these antibodies or antigen-binding fragments may be useful for detecting the presence of BCMA in a biological sample, such as blood or serum; for quantifying the amount of BCMA in a biological sample, such as blood or serum; for diagnosing BCMA-expressing cancer; determining a method of treating a subject afflicted with cancer; or monitoring the progression of BCMA-expressing cancer in a subject. In some embodiments, BCMA-expressing cancer may be a lymphoma, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM). In some embodiments, the BCMA-expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. The described methods may be carried out before the subject receives treatment for BCMA-expressing cancer, such as treatment with a multispecific antibody against BCMA and CD3. Furthermore, the described methods may be carried out after the subject receives treatment for BCMA-expressing cancer, such as treatment with a multispecific antibody against BCMA and CD3 described herein. The described methods of detecting BCMA in a biological sample include exposing the biological sample to one or more of the BCMA-specific antibodies or antigen-binding fragments described herein. The described methods of diagnosing BCMA-expressing cancer in a subject also involve exposing the biological sample to one or more of the BCMA-specific antibodies or antigen-binding fragments described herein; however, the methods also include quantifying the amount of BCMA present in the sample; comparing the amount of BCMA present in the sample to a known standard or reference sample; and determining whether the subject’s BCMA levels fall within the levels of BCMA associated with cancer. Also described herein are methods of monitoring BCMA-expressing cancer in a subject. The described methods include exposing the biological sample to one or more of the BCMA-specific antibodies or antigen-binding fragments described herein; quantifying the amount of BCMA present in the sample that is bound by the antibody, or antigenbinding fragment thereof; comparing the amount of BCMA present in the sample to either a known standard or reference sample or the amount of BCMA in a similar sample previously obtained from the subject; and determining whether the subject’s BCMA levels are indicative of cancer progression, regression or stable disease based on the difference in the amount of BCMA in the compared samples. The samples obtained, or derived from, subjects are biological samples such as urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated, tissues, surgically resected tumor tissue, biopsies, fine needle aspiration samples, or histological preparations. The described BCMA-specific antibodies or antigen-binding fragments may be labeled for use with the described methods, or other methods known to those skilled in the art. For example, the antibodies described herein, or antigen-binding fragments thereof, may be labeled with a radiolabel, a fluorescent label, an epitope tag, biotin, a chromophore label, an ECL label, an enzyme, ruthenium, niIn-DOTA, luIn-diethylenetriaminepentaacetic acid (DTPA), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, or poly-histidine or similar such labels known in the art. BCMA-Specific Antibody Kits Described herein are kits including the disclosed BCMA-specific antibodies or antigen-binding fragments thereof. The described kits may be used to carry out the methods of using the BCMA-specific antibodies or antigen-binding fragments provided herein, or other methods known to those skilled in the art. In some embodiments the described kits may include the antibodies or antigen-binding fragments described herein and reagents for use in detecting the presence of BCMA in a biological sample. Accordingly, the described kits may include one or more of the antibodies, or an antigenbinding fragment(s) thereof, described herein and a vessel for containing the antibody or fragment when not in use, instructions for use of the antibody or fragment, the antibody or fragment affixed to a solid support, and / or detectably labeled forms of the antibody or fragment, as described herein. BRIEF DESCRIPTION OF THE DRAWINGS FIG. 1A-1B. Depiction of BGCB463 trispecific antibody (FIG. 1A) and proposed mode of action (FIG. IB). FIGs. 2A-2D. BGCB463 (circles) or negative control B23B251 (triangles) were all incubated with H929 wild type (WT) (FIG. 2A), H929-GPRC5D knock out (KO) (FIG. 2B), H929-BCMA KO (FIG. 2C), and H929-GPRC5D / BCMA KO (FIG.2D) cells for Ihr at 37°C at a starting concentration of 2pM. After secondary detection with AF647-labeled material, the MFI signal was analyzed to generate an ECso and EC90. Curves are representative of five independent experiments. EC50 or EC90 values are averages of these. FIGs. 3A-3D. BGCB463 (circles) or negative control B23B251 (triangles) were all incubated with MM.1R WT (FIG. 3 A), MM.1R -GPRC5D KO (FIG. 3B), MM.1R -BCMA KO (FIG. 3C), and MM. 1R -GPRC5D / BCMA KO (FIG. 3D) cells for Ihr at 37°C at a starting concentration of 2pM. After secondary detection with AF647-labeled material, the MFI signal was analyzed to generate an EC50 and EC90. Curves are representative of five independent experiments. FIGs. 4A-4C. BGCB463 (circles) or negative control B23B251 (triangles) were all incubated with Pan T cells (3 random donors, FIG. 4A-4C) for Ihr at 37°C at a starting concentration of 2pM. After secondary detection with AF647-labeled material, the MFI signal was analyzed to generate an EC50 and EC90. Data are representative of two individual runs, both with three donors. FIGs. 5A-5C. BGCB463 was incubated with Pan T cells (3 random donors, FIG. 5A, FIG. 5B, and FIG. 5C) for Ihr at 4°C (circles) or 37°C (triangles) at a starting concentration of 2pM. After secondary detection with AF647-labeled material, the MFI signal was analyzed to generate an EC50. FIGs. 6A-6C. BGCB463.003 (circles), BGCB463.004 (squares), and negative control B23B251 (triangles) were tested with H929 (FIG. 6A), MM.1R (FIG. 6B), and Pan T (FIG, 6C) cells from 3 donors. Molecules were incubated for Ihr at 37°C at a starting concentration of 2pM. After secondary detection with AF647-labeled material, the MFI signal was analyzed. FIGs. 7A-7D. H929 (FIG. 7A), H929-GPRC5D KO (FIG. 7B), H929-BCMA KO (FIG. 7C), and H929-GPRC5D / BCMA KO (FIG. 7D) cells were all incubated for Ihr, 3hr, 5hr, and 24hr at three optimized concentrations of BGCB463 at 37°C. Cells were then washed and incubated for 30min on ice with AF647-anti-human IgG. Read out is MFI of AF647 signal. FIGs. 8A-8D. MM.1RWT (FIG. 8A), MM.1R -GPRC5D KO (FIG. 8B), MM.1R -BCMA KO (FIG. 8C), and MM.1R -GPRC5D / BCMA KO (FIG. 8D) cells were all incubated for Ihr, 3hr, 5hr, and 24hr at three optimized concentrations of BGCB463 at 37°C. Cells were then washed and incubated for 30min on ice with AF647-anti-human IgG. Read out is MFI of AF647 signal. FIGs. 9A-E. BGCB463 (circles) or negative control B23B251 (triangles) were all incubated with K562 cells expressing human GPRC5D (FIG. 9A), human BCMA (FIG. 9B), cynomolgus GPRC5D (FIG. 9C) or cynomolgus BCMA (FIG. 9D) for Ihr at 37°C at a starting concentration of 2pM. After secondary detection with AF647-anti-human IgG, the MFI signal was analyzed to generate an ECso and EC90 (FIG. 9E). Data are representative of two independent experiments. FIGs. 10A-10B. BGCB463 (circles) or negative control B23B251 (triangles) at a starting concentration of lOnM were incubated with K562 cells expressing human or cynomolgus GPRC5D or lOOnM for K562 expressing human / cynomolgus BCMA as targets cells. Human activation and cytotoxicity in FIG. 10A. Cynomolgus activation and cytotoxicity in FIG. 10B. Human Pan T cells (1 donor) were added with an effector to target (E:T) ratio of 3:1 and incubated for 72hr at 37°C. Cytotoxicity was determined using live / dead fixable dye and CD25 was measured using BV421-conjugated anti-CD25. FIG. 11. H929 cells were incubated with increasing concentration of BGCB463 or negative control B23B251 for Ihr at 37°C with AF647- anti-human IgG in the presence of media (RPMI containing 10% FBS) or RPMI containing 90% human serum. BGCB463 binding is unaffected by the presence of serum. FIG. 12. T cells were incubated with increasing concentration of BGCB463 or negative control B23B251 for Ihr at 37°C with AF647-anti-human IgG in the presence of media (RPMI containing 10% FBS) or RPMI containing 90% human serum. Data are representative of three donors tested in two experiments. BGCB463 binding is unaffected by the presence of serum. FIGs. 13A-13B. H929-GFP cells were incubated with BGCB463 and human Pan T cells from 3 donors at an E:T ratio of 3:1 with anti-CD25-AF647 added to track T cell activation (FIG. 13 A). Percent cytolysis was calculated based on GFP signal in treated vs. untreated wells (FIG. 13B). The incubation lasted about 140 hours with images acquired every three hours. FIGs. 14A-14F. H929-GFP cells were incubated with BGCB463, or B23B251 (isotype control) molecules and human Pan T cells from four donors at an E:T ratio of 1:1 and 5:1 with anti-CD25-AF647 added to track T cell activation. Percent cytolysis was calculated based on GFP signal in treated vs. untreated wells. The incubation lasted about 140 hours with images acquired every three hours. BGCB463, 1:1 ratio, cytolysis (FIG. 14A). BGCB463, 1:1 ratio, total integrated intensity (FIG. 14B). BGCB463, 5:1 ratio, cytolysis (FIG. 14C). BGCB463, 5:1 ratio, total integrated intensity (FIG. 14D). B23B251, 5:1 ratio, cytolysis (FIG. 14E). B23B251, 5:1 ratio, total integrated intensity (FIG. 14F). FIGs. 15A-15D. Determination of soluble BCMA interference using patient serums. Donor 1 (FIG. 15A); Donor 2 (FIG. 15B); Donor 3 (FIG. 15C); and normal serum (FIG. 15D). Patient serums with known levels of sBCMA were incubated (90% serum to 10% media) with directly labeled BGCB463-AF647 and B23B251-AF647 isotype control for Ihr at 37°C on H929 cells. 50% and 10% patient serum was diluted with normal serum to a final concentration of 50% and 10% respectively. FIG. 16. Depiction of BGCB491 trispecific antibody. FIGs. 17A-17B. BGCB463, BGCB491, and three controls (BGCB482 (CD3xNullxNull), BGCB483 (CD3xNullxBCMA), BGCB484 (CD3xGPRC5DxNull)) were tested against BCMA+ GPRC5D+ cells (FIG. 17A) and BCMA' GPRC5D" cells (FIG. 17B). Effector to target (E:T) ratio of 3:1; n=l T-cell donors, 72 hours incubation, top concentration 53 nM, 1-5 dilution. Tests were performed for both cytotoxicity and T-cell activation. FIGs. 18A-18B. BGCB463 and BGCB491 depleted H929 WT, GPRC5D KO, and BCMA KO cell lines both 72 and 96 hours after primary incubation (FIG. 18A). The E:T ratio was 3:1, n=5 T-cell donors; 72(5) and 96(4) hours incubation; top concentration 532 mM, 1-5 dilution gradient. Both antibodies show increased T-cell activation both 72 and 96 hours in the same H929 WT, GPRC5D KO, and BCMA KO cells as above (FIG. 18B). FIG. 19. BGCB463 and BGCB491 were testing in cytotoxicity and T-cell activation assays with H929, RAMOS and GRANTA-519 cells lines. E:T was 5:1, n=l T-cell donors; 72 hours incubation only; top concentration of 53 nM; and a 1-5 dilution. FIG. 20. BGCB463 and BGCB491 were testing in cytotoxicity and T-cell activation whole blood assays with H292 cells. E:T was 5:1, n=2 whole blood donors; 48 hours incubation; top concentration of 532 nM; and a 1-5 dilution. FIGs. 21A-21B. BGCB463 was shown to regress tumor growth in MM.IS and RPMI 8226 xenograft mouse models if given in a high enough dose: either 2ug or lOug in the MM.IS model (FIG. 21 A) or 5ug or lOug in the RPMI 8226 model (FIG. 21B). FIG. 22. BGCB463 and BGCB491were shown to regress tumor growth in H929 prophylactic xenograft mouse models. Compared to PBS controls both 0.5ug and 5ug doses slowed tumor growth in both H929-BCMA KO and H929-GPRC5D KO models, with the higher 5ug concentration showing more effect. FIG. 23. BGCB463 and BGCB491 were tested in a Ihr, 37°C DRC Pan-T binding assay. Two human Pan-T cell donors were used, and test molecules had 2uM starting concentrations with a 1:3 dilution and 11 point DRC. FIGs. 24A-24D. BGCB463, BGCB491, and a null control were tested against H929 WT (FIG. 24A), H929-BCMA KO (FIG. 24B), H929-GPRC5D KO (FIG. 24C), and H929-BCMA / GPRC5D double KO (FIG. 24D) cells in a 1 hour, 37°C DRC suite binding assay. FIG. 25. Representative binding profiles of BGCB491 on H929 WT, H929-BCMA KO cells, H929-GPRC5D KO cells, and / or H929-BCMA / GPRC5D double KO cells after 1 hour 37°C incubation. BGCB491 is indicated with • and negative control CD3xNullxNull BGCB510 is indicated with ■. Curves are representative of 5 independent experiments. H929-GPRC5D-KO clone Hl 5 is a heterozygous KO line with 2 copies of gene of 30% and 61% distribution. H929-BCMA-KO clone J8 is a heterozygous KO line with 2 copies of gene of equal 50% distribution. FIG. 26. Primary T cell binding profiles of BGCB491 on 7 donor cell preparations after 1 hour incubation at 37°C. MFI, mean fluorescence intensity. FIG. 27. Representative bioinformatic binding curve extrapolation with CD3B376xNull control antibody (GCDB381). FIGs. 28A-28B. BGCB491-mediated (FIG. 28A) cell cytotoxicity and (FIG. 28B) T cell activation of BCMA-GPRC5D-dual-positive and BCMA-GPRC5D-dual-negative cell lines. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.00005 to 533.33 nM, X axis) in the presence of pan T cells from 6 healthy donors (donor ID: 20063323, 20063309, 20062062, 20063310, 20062105, and 20061963) and Fc blocker (2 mg / mL) and incubated for 72 hours. The optimal E:T ratio of 3:1 was tested in these studies (for E:T ratio assessment see FIGs. 33 A-33B). The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. The data points aligned tightly along the generated fit curve and little variability was observed between T cell donors (6 donor averages plotted). In FIG. 28A, target cell death was measured and expressed as percent cytotoxicity on Y axis. In FIG. 28B, T cell activation was measured as percent CD25+CD3+ T cells. FIG. 29. BGCB491-mediated H929 CRISPR KO clonal cell cytotoxicity and T cell activation. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.00005 to 533.33 nM, X axis) in the presence of pan T cells from 4 healthy donors (donor ID: 20063323, 20063309, 20062062, and 20063310) and Fc blocker (2 mg / mL) and incubated for 72 hours. The E:T ratio of 3:1 was tested in these studies. The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. The data points aligned tightly along the generated fit curve and little variability was observed between T cell donors (4-donor averages plotted). Target cell death was measured and expressed as percent cytotoxicity in the top row and T cell activation measured as percent CD25 expressing CD3+ positive cells was shown in the bottom row (Y axis). FIG. 30. BGCB491-mediated target cell cytotoxicity in whole blood spiked with H929 MM cells (MABEL assay). MABEL, minimum anticipated biological effect level. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.00005 to 533.33 nM, X axis) to whole blood from 7 healthy donors (donor ID: 10145, 10403, 10420, 10083, 10463, 10493, and 10145; T cell source) in presence of H929 target myeloma cells at an adjusted E:T ratio of 5:1 for 48 hours. The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. The data points aligned tightly along the generated fit curve and little variability was observed between T cell donors (7 donor averages plotted). Target cell death was measured and expressed as percent cytotoxicity and T cell activation measured as percent CD25+CD3+ cells. In this experiment teclistamab and talquetamab were tested as positive controls. FIG. 31. Cytokine profiles of BGCB491from MABEL assay. MSD, Meso Scale Discovery. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.00005 to 533.33 nM, X axis) to whole blood from 3 healthy donors. H929 cell supernatants from the above cytotoxicity experiment (FIG. 7; 3 T cell donors; donor ID: 10083, 10463, and 10493) were collected and analyzed for cytokine levels using an MSD-based multiplex assay (Cat #: K15049D). Cytokine levels were measured as pg / mL. The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. The data points aligned tightly along the generated fit curve and little variability was observed between T cell donors (3 donor averages plotted). In this experiment teclistamab and talquetamab were tested as positive controls. FIG. 32. Cytotoxic potency of BGCB491 against human primary MM CD 13 8+ cells. MNC, mononuclear cell. Frozen bone-marrow-derived mononuclear cells from 4 different myeloma patients (MM BM MNC-626, 649, 652, and 653) were used to assess BGCB491 plasma cell depletion (top row) and T cell activation (bottom row) potential. T cells from a normal healthy donor (donor ID: 20063309) were exogenously added to patient BM MNC samples (E:T ratio of 1:1) and incubated with BGCB491, CD3xNullxNull, teclistamab, or talquetamab (0.00005 to 533.33 nM, X axis) for 48 hours. The loss of live plasma cells (CD 13 8+) and the concomitant upregulation of CD25 on T cells in response to BGCB491 treatment is observed. Variability in total initial plasma cell count was observed between the donors. Individual target receptor density values and percentage target-positive population are listed. FIGs. 33A-33B. BGCB491 cytotoxicity potential at various E:T ratios and incubation times (H929 cell line). (FIG. 33A) BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were tested in presence of pan T cells from 1 healthy donor (donor ID: 20063323) at 4 different E:T ratios (5:1, 3:1, 1:1, and 0.5:1) for 72 hours. (FIG. 33B) BGCB491 was tested at an E:T ratio of 3:1 and 1:1 for various time points (24 hours -Circle, 48 hours -Upward triangle, 72 hours -Downward triangle, 96 hours -Hexagonal, 120 hours -Diamond, 144 hours -Star, and 168 hours -Square) using 4 different T cell donors (donor ID: 20062105, 20063309, 20061963, and 20063310). Target cell death and T cell activation were measured and expressed as percent cytotoxicity and percent CD25+CD3+ T cells. The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. The data points aligned tightly along the generated fit curve and little variability was observed between T cell donors: (FIG. 33A) 1 and (FIG. 33B) 4 donor averages plotted. FIGs. 34A-34C. BGCB491 effect on T cell activation in absence of target cells. A T cell activation assay was performed using (FIG. 34A) 6 normal healthy donor T cells (donor ID: 20063323, 20063309, 20062062, 20063310, 20062105, and 20061963) or (FIG. 34B) 6 normal donor whole-blood samples (donor ID: 10274, 10402, 10427, 10470, 10500, and 10509). (FIG. 34C) Non-specific cytotoxicity was measured for various subsets. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.00005 to 533.33 nM, X axis) for (FIG. 34A) 72 hours and (FIG. 34B, 34C) 48 hours. FIG. 35. Antitumor efficacy of BGCB491, teclistamab, and talquetamab in subcutaneous (SC) RPMI 8226 xenografts in T cell-humanized NSG mice (Study A). KO, knock-out; NSG, non-obese diabetic (NOD) severe combined immunodeficiency (scid) gamma orNOD.CgPr^tZc^I^rg^^ / SzJ; PBS, phosphate-buffered saline; SEM, standard error of the mean. T cell-humanized NSG mice bearing established SC RPMI 8226 tumors were intraperitoneally (IP) dosed with BGCB491 at 0.1, 0.4, 1, and 2.5 mg / kg. Teclistamab was IP dosed at 0.4, 1, and 2.5 mg / kg. Talquetamab was IP dosed at 2.5 mg / kg. Treatments were administered on Days 19, 21, 25, 28, 31, 34, 38, and 41 (indicated by black line beneath X axis). Tumor volume was measured twice weekly, and the results presented as the mean tumor volume ± SEM for each group. Data graphically represented for each group with at least 70% of animals remaining in the study. FIG. 36. Antitumor efficacy of BGCB491, teclistamab, and talquetamab in subcutaneous (SC) H929-BCMA-KO and H929-GPRC5D-KO xenografts in T cell-humanized NSG mice (Study B). KO, knock-out; NSG, non-obese diabetic (NOD) severe combined immunodeficiency (scid) gamma or NOD.Cg Prkdc^ Il2rgmlw->1' / SzJ; PBS, phosphate-buffered saline; SEM, standard error of the mean. T cell humanized NSG mice bearing H929-BCMA-KO (left flank) and H929-GPRC5D-KO (right flank) tumors were dosed intraperitoneally (IP) with BGCB491 at 0.025, 0.1, 0.25, and 0.5 mg / kg. Teclistamab and talquetamab were IP dosed at 0.1 and 0.25 mg / kg. Treatments were administered on Days 1, 5, 9, 13, 16, 19, and 22 (indicated by black line beneath X axis). Tumor volume was measured twice weekly, and the results presented as the mean tumor volume ± SEM for each group. Data graphically represented for each group with at least 70% of animals remaining in the study. FIGs. 37-38. Individual BGCB491 serum concentration - time profiles following a single intravenous (IV) 0.5 mg / kg dose in female cynomolgus monkey (FIG. 37) and predicted model (FIG. 38). BQL, below quantification limit. Data points with concentrations below the lowest quantifiable concentration are not shown in the graph. FIG. 39A-39B. Mean (SD) BGCB491 concentration - time profiles following a single dose of BGCB491 in male minipigs and model prediction. BQL, below quantification limit; SD, standard deviation. Data points with concentrations below the lowest quantifiable concentration are not shown in the graph. Group 1: Dose = 0.01 mg / kg, subcutaneous (SC) administration. Group 2: Dose = 0.1 mg / kg, SC. Group 3: Dose = 0.1 mg / kg, IV. FIG. 40. Kinetic binding profiles of BGCB463 on H929 WT and MM. 1R WT cell lines throughout 24 hour 37°C incubation. MFI: mean fluorescence intensity. FIG. 41. BGCB491 binding to endogenous BCMA-GPRC5D-expressing cell lines. Geo, geometric. BGCB491, BCMAxGPRC5DxNull, and CD3xNullxNull were added at various concentrations (0.096 to 1,000 nM, X axis) and incubated for 1 hour at 37°C. The plots were generated using Prism 8 by fitting separate 4PL models to the observed data. Binding intensities expressed as geometrical mean (Y axis). FIG. 42. Kinetic cytotoxicity and T-cell activation of BGCB491 and CD3B2271 (null control) using T cells from 3 T-cell donors at (FIG. 42A) 1:1 and (FIG. 42B) 1:3 E:T ratios. The CD25 measurement on the Incucyte is a measure of T cell count and CD25 expression (total integrated intensity). CD25 is a later marker of T cell activation, typically detectable 24 hours after activation and peaking around 96 hours. It does not necessarily line up with cytotoxicity with regards to timing. Percent cytolysis was calculated based on green fluorescent protein (GFP) signal in treated versus untreated wells. FIG. 43. Percent cytolysis and T-cell activation of BGCB491 and CD3B2271(null control) at 72-, 93-, and 120-hour timepoints at 1:1 effector-to-target (E:T) ratio. FIG. 44. Percent cytolysis and T-cell activation of BGCB491 and CD3B2271 (null control) at 72-, 93-, and 120-hour timepoints at 1:3 E:T ratio. FIG. 45. Antitumor efficacy of JNJ-79635322, teclistamab, and talquetamab in subcutaneous MM.IS xenografts in T cell-humanized NSG mice (Study C). NSG, nonobese diabetic (NOD) severe combined immunodeficiency (scid) gamma or NQV)S^g-Prkdc^Il2rgtm1^ PBS, phosphate-buffered saline; SEM, standard error of the mean. T-cell-humanized NSG mice bearing established SC MM. 1S tumors were IP dosed with BGCB491 at 0.025, 0.1, 0.5, and 1 mg / kg. Talquetamab was IP dosed at 0.025 and 0.1 mg / kg. Teclistamab was IP dosed at 0.1 and 0.5 mg / kg treatments were administered on Days 15, 19, 22, 26, 30, 34, and 37 (indicated by black line beneath X-axis). Tumor volume was measured twice weekly, and the results presented as the mean tumor volume ± SEM for each group. Data graphically represented for each group with at least 70% of animals remaining in the study. Animals were monitored post treatment until signs of graft-versus-host disease (GvHD)-related morbidity manifested at which time the animals were euthanized and the study was concluded on Day 51. FIGs. 46A-46B. BCMA lead (BCMB519) demonstrates comparable binding and cytotoxicity as Teclistamab with ideal scFv biophysical properties. FIGs. 47. GPRC5d lead (GC5B680) demonstrates specific and improved binding compared to Talquetamab with ideal scFv biophysical properties. DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS Definitions Various terms relating to aspects of the description are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definitions provided herein. As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a cell” includes a combination of two or more cells, and the like. The term “about” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of up to ±10% from the specified value, as such variations are appropriate to perform the disclosed methods. Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements. “Isolated” means a biological component (such as a nucleic acid, peptide or protein) has been substantially separated, produced apart from, or purified away from other biological components of the organism in which the component naturally occurs, i.e., other chromosomal and extrachromosomal DNA and RNA, and proteins. Nucleic acids, peptides and proteins that have been “isolated” thus include nucleic acids and proteins purified by standard purification methods. “Isolated” nucleic acids, peptides and proteins can be part of a composition and still be isolated if such composition is not part of the native environment of the nucleic acid, peptide, or protein. The term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids. An "isolated” antibody or antigen-binding fragment, as used herein, is intended to refer to an antibody or antigen-binding fragment which is substantially free of other antibodies or antigen-binding fragments having different antigenic specificities (for instance, an isolated antibody that specifically binds to BCMA is substantially free of antibodies that specifically bind antigens other than BCMA). An isolated antibody that specifically binds to an epitope, isoform or variant of BCMA or GPRC5D may, however, have cross-reactivity to other related antigens, for instance from other species (such as BCMA or GPRC5D species homologs). “Polynucleotide,” synonymously referred to as “nucleic acid molecule,” “nucleotides” or “nucleic acids,” refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. “Polynucleotides” include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, “polynucleotide” refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications may be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. “Polynucleotide” also embraces relatively short nucleic acid chains, often referred to as oligonucleotides. The meaning of “substantially the same” can differ depending on the context in which the term is used. Because of the natural sequence variation likely to exist among heavy and light chains and the genes encoding them, one would expect to find some level of variation within the amino acid sequences or the genes encoding the antibodies or antigen-binding fragments described herein, with little or no impact on their unique binding properties (e.g., specificity and affinity). Such an expectation is due in part to the degeneracy of the genetic code, as well as to the evolutionary success of conservative amino acid sequence variations, which do not appreciably alter the nature of the encoded protein. Accordingly, in the context of nucleic acid sequences, “substantially the same” means at least 65% identity between two or more sequences. Preferably, the term refers to at least 70% identity between two or more sequences, more preferably at least 75% identity, more preferably at least 80% identity, more preferably at least 85% identity, more preferably at least 90% identity, more preferably at least 91% identity, more preferably at least 92% identity, more preferably at least 93% identity, more preferably at least 94% identity, more preferably at least 95% identity, more preferably at least 96% identity, more preferably at least 97% identity, more preferably at least 98% identity, and more preferably at least 99% or greater identity. The percent identity between two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology = # of identical positions / total # of positions x 100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The percent identity between two nucleotide or amino acid sequences may e.g. be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci 4, 11-17 (1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences may be determined using the Needleman and Wunsch, J. Mol. Biol. 48, 444-453 (1970) algorithm. The degree of variation that may occur within the amino acid sequence of a protein without having a substantial effect on protein function is much lower than that of a nucleic acid sequence, since the same degeneracy principles do not apply to amino acid sequences. Accordingly, in the context of an antibody or antigen-binding fragment, “substantially the same” means antibodies or antigen-binding fragments having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the antibodies or antigen-binding fragments described. Other embodiments include antibodies, or antigen-binding fragments, that have framework, scaffold, or other non-binding regions that do not share significant identity with the antibodies and antigen-binding fragments described herein, but do incorporate one or more CDRs or other sequences needed to confer binding that are 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such sequences described herein. A “clone” is a population of cells derived from a single cell or common ancestor by mitosis. A “cell line” is a clone of a primary cell that is capable of stable growth in vitro for many generations. In some examples provided herein, cells are transformed by transfecting the cells with DNA. The terms “express” and “produce” are used synonymously herein, and refer to the biosynthesis of a gene product. These terms encompass the transcription of a gene into RNA. These terms also encompass translation of RNA into one or more polypeptides, and further encompass all naturally occurring post-transcriptional and post-translational modifications. The expression or production of an antibody or antigen-binding fragment thereof may be within the cytoplasm of the cell, or into the extracellular milieu such as the growth medium of a cell culture. The terms “treating” or “treatment” refer to any success or indicia of success in the attenuation or amelioration of an injury, pathology or condition, including any objective or subjective parameter such as abatement, remission, diminishing of symptoms or making the condition more tolerable to the patient, slowing in the rate of degeneration or decline, making the final point of degeneration less debilitating, improving a subject’s physical or mental well-being, or prolonging the length of survival. The treatment may be assessed by objective or subjective parameters; including the results of a physical examination, neurological examination, or psychiatric evaluations. An "effective amount" or "therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount of a BCMA x GPRC5D x CD3 antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects. “Antibody” refers to all isotypes of immunoglobulins (IgG, IgA, IgE, IgM, IgD, and IgY) including various monomeric, polymeric and chimeric forms, unless otherwise specified. Specifically encompassed by the term “antibody” are polyclonal antibodies, monoclonal antibodies (mAbs), and antibody-like polypeptides, such as chimeric antibodies and humanized antibodies. The term “antigen-binding arm” refers to a portion of an antibody that includes an antigen-binding domain that binds to an antigen (e.g., BCMA, GPRC5D, or CD3), and optionally includes one or more other antibody regions (e.g., Fc domain). The term “antigen-binding fragment” refers to a fragment of the antigen-binding arm containing an antigen-binding domain. Antigen-binding fragments include those provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques. Some antigen-binding fragments are composed of portions of intact antibodies that retain antigen-binding specificity of the parent antibody molecule. For example, antigen-binding fragments may comprise at least one variable region (either a heavy chain or light chain variable region) or one or more CDRs of an antibody known to bind a particular antigen. Examples of suitable antigen-binding fragments include, without limitation diabodies and single-chain molecules as well as Fab, F(ab’)2, Fc, Fabc, and Fv molecules, single chain (Sc) antibodies, individual antibody light chains, individual antibody heavy chains, chimeric fusions between antibody chains or CDRs and other proteins, protein scaffolds, heavy chain monomers or dimers, light chain monomers or dimers, dimers consisting of one heavy and one light chain, a monovalent fragment consisting of the VL, VH, CL and CHI domains, or a monovalent antibody as described in WO2007059782, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region, a Fd fragment consisting essentially of the VH and CHI domains; a Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody, a dAb fragment (Ward et al., Nature 341, 544-546 (1989)), which consists essentially of a VH domain and also called domain antibodies (Holt et al; Trends Biotechnol. 2003 Nov.; 21(11):484-90); camelid or nanobodies (Revets et al; Expert Opin Biol Ther. 2005 Jan.; 5(1):111-24); an isolated complementarity determining region (CDR), and the like; and trispecific antibodies formed from antibody fragments. All antibody isotypes may be used to produce antigen-binding fragments. Additionally, antigen-binding fragments may include non-antibody proteinaceous frameworks that may successfully incorporate polypeptide segments in an orientation that confers affinity for a given antigen of interest, such as protein scaffolds. Antigen-binding fragments may be recombinantly produced or produced by enzymatic or chemical cleavage of intact antibodies. The phrase “an antibody or antigen-binding fragment thereof’ may be used to denote that a given antigen-binding fragment incorporates one or more amino acid segments of the antibody referred to in the phrase. The term “antigen-binding domain” refers to the proteinaceous structure of an antigen-binding arm that exhibits binding affinity for a particular antigen. This proteinaceous structure is mediated by the complementarity determining regions (CDRs) of the antigen-binding domain. The terms “CDR”, and its plural “CDRs”, refer to a complementarity determining region (CDR) of which three make up the binding character of a light chain variable region (CDRL1, CDRL2 and CDRL3) and three make up the binding character of a heavy chain variable region (CDRH1, CDRH2 and CDRH3). CDRs contribute to the functional activity of an antibody molecule and are separated by amino acid sequences that comprise scaffolding or framework regions. The exact definitional CDR boundaries and lengths are subject to different classification and numbering systems. CDRs may therefore be referred to herein by Kabat, Chothia, AbM, contact or any other boundary definitions. Despite differing boundaries, each of these systems has some degree of overlap in what constitutes the so called “hypervariable regions” within the variable sequences. CDR definitions according to these systems may therefore differ in length and boundary areas with respect to the adjacent framework region. See for example Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed. NIH Publication No. 91-3242 (1991); Chothia et al., “Canonical Structures For the Hypervariable Regions of Immunoglobulins,” J. Mol. Biol. 196:901 (1987); and MacCallum et al., “Antibody-Antigen Interactions: Contact Analysis and Binding Site Topography,” J. Mol. Biol. 262:732 (1996)), each of which is hereby incorporated by reference in its entirety. Typically, CDRs form a loop structure that can be classified as a canonical structure. The term “canonical structure” refers to the main chain conformation that is adopted by the antigen binding (CDR) loops. From comparative structural studies, it has been found that five of the six antigen binding loops have only a limited repertoire of available conformations. Each canonical structure can be characterized by the torsion angles of the polypeptide backbone. Correspondent loops between antibodies may, therefore, have very similar three dimensional structures, despite high amino acid sequence variability in most parts of the loops (Chothia et al., “Canonical Structures For the Hypervariable Regions of Immunoglobulins,” J. Mol. Biol. 196:901 (1987); Chothia et al., “Conformations of Immunoglobulin Hypervariable Regions,” I 342:877 (1989); Martin and Thornton, “Structural Families in Loops of Homologous Proteins: Automatic Classification, Modelling and Application to Antibodies,” J. Mol. Biol. 263:800 (1996), each of which is incorporated by reference in its entirety). Furthermore, there is a relationship between the adopted loop structure and the amino acid sequences surrounding it. The conformation of a particular canonical class is determined by the length of the loop and the amino acid residues residing at key positions within the loop, as well as within the conserved framework (i.e., outside of the loop). Assignment to a particular canonical class can therefore be made based on the presence of these key amino acid residues. The term "polypeptide" is used interchangeably with the term "protein" and in its broadest sense refers to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc. As used herein the term "amino acid" refers to either natural and / or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics. A peptide of three or more amino acids is commonly called an oligopeptide if the peptide chain is short. If the peptide chain is long, the peptide is commonly called a polypeptide or a protein. As used herein the term “Fc” refers to the fragment crystallizable domain of an antibody, which comprises two constant heavy chain (CH) regions, CH2 and CH3. Herein, the amino acid residues of the Fc region are typically numbered according to the EU numbering scheme (Edelman, G.M. et al., Proc. Natl. Acad. USA, 63, 78-85 (1969). PMID: 5257969). These residues can be readily assigned according to alternative numbering schemes such as IMGT and Kabat (Kabat, E.A. et al., Sequences of proteins of immunological interest. 5th Edition - US Department of Health and Human Services, NIH publication n° 91-3242, pp 662,680,689 (1991)) numbering as would be readily appreciated by one skilled in the art. For example, L234 according to EU numbering may also be represented as L247 according to Kabat. “Specifically binds” or “binds specifically” or derivatives thereof when used in the context of antibodies, or antibody fragments, represents binding via domains encoded by immunoglobulin genes or fragments of immunoglobulin genes to one or more epitopes of a protein of interest, without preferentially binding other molecules in a sample containing a mixed population of molecules. Typically, an antibody binds to a cognate antigen with a Ka of less than about IxlO'8 M, as measured by a surface plasmon resonance assay or a cell-binding assay. Phrases such as “[antigen]-specific” antibody (e.g., BCMA-specific antibody) are meant to convey that the recited antibody specifically binds the recited antigen. Wherever the term “binds” is used herein it is intended that this encompasses “specifically binds” and the terms may be interchanged as desired. As used herein, the term “chimeric” refers to an antibody, or antigen-binding fragment thereof, having at least some portion of at least one variable domain derived from the antibody amino acid sequence of a non-human mammal, a rodent, or a reptile, while the remaining portions of the antibody, or antigen-binding fragment thereof, are derived from a human. A “vector” is a replicon, such as plasmid, phage, cosmid, or virus in which another nucleic acid segment may be operably inserted so as to bring about the replication or expression of the segment. As used herein, the term "host cell" can be any type of cell, e.g., a primary cell, a cell in culture, or a cell from a cell line. In specific embodiments, the term "host cell" refers to a cell transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule, e.g., due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome. The terms “expression” and “production” are used synonymously herein, and refer to the biosynthesis of a gene product. These terms encompass the transcription of a gene into RNA. These terms also encompass translation of RNA into one or more polypeptides, and further encompass all naturally occurring post-transcriptional and post-translational modifications. The term “subject” refers to human and non-human animals, including all vertebrates, e.g., mammals and non-mammals, such as non-human primates, mice, rabbits, sheep, dogs, cats, horses, cows, chickens, amphibians, and reptiles. In many embodiments of the described methods, the subject is a human. The term “redirect” or “redirecting” as used herein refers to the ability of the BCMA x GPRC5D x CD3 antibody to traffic the activity of T cells effectively, from its inherent cognate specificity toward reactivity against GPRC5D and / or BCMA-expressing cells. The term “sample” as used herein refers to a collection of similar fluids, cells, or tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), isolated from a subject, as well as fluids, cells, or tissues present within a subject. In some embodiments the sample is a biological fluid. Biological fluids are typically liquids at physiological temperatures and may include naturally occurring fluids present in, withdrawn from, expressed or otherwise extracted from a subject or biological source. Certain biological fluids derive from particular tissues, organs or localized regions and certain other biological fluids may be more globally or systemically situated in a subject or biological source. Examples of biological fluids include blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sputum, mucosal secretions of the secretory tissues and organs, vaginal secretions, ascites fluids such as those associated with non-solid tumors, fluids of the pleural, pericardial, peritoneal, abdominal and other body cavities, fluids collected by bronchial lavage and the like. Biological fluids may also include liquid solutions contacted with a subject or biological source, for example, cell and organ culture medium including cell or organ conditioned medium, lavage fluids and the like. The term “sample,” as used herein, encompasses materials removed from a subject or materials present in a subject. The relevant aspects of the invention may be performed in vitro based on isolated samples as required. A “known standard” may be a solution having a known amount or concentration of GPRC5D and / or BCMA, where the solution may be a naturally occurring solution, such as a sample from a patient known to have early, moderate, late, progressive, or static cancer, or the solution may be a synthetic solution such as buffered water having a known amount of GPRC5D and / or BCMA diluted therein. The known standards, described herein may include GPRC5D and / or BCMA isolated from a subject, recombinant or purified GPRC5D and / or BCMA protein, or a value of GPRC5D and / or BCMA concentration associated with a disease condition. The terms “B-cell maturation antigen” and "BCMA" as used herein include human B cell maturation antigen, also known as BCMA, CD269, and TNFRSF17 (UniProt Q02223), which is a member of the tumor necrosis receptor superfamily that is preferentially expressed in differentiated plasma cells. The extracellular domain of human BCMA consists, according to UniProt of amino acids 1-54 (or 5-51). The term "antibody against BCMA, anti-BCMA antibody" as used herein relates to an antibody specifically binding to BCMA. The terms "G-protein coupled receptor family C group 5 member D" and "GPRC5D" specifically include the human GPRC5D protein, for example as described in GenBank Accession No. BC069341, NCBI Reference Sequence: NP_061124.1 and UniProtKB / Swiss-Prot Accession No. Q9NZD1 (see also Brauner-Osborne, H. et al. 2001, Biochim. Biophys. Acta 1518, 237-248). The terms “cluster determinant 3” and “CD3” include the human CD3 protein multi-subunit complex. The CD3 protein multi-subunit complex is composed to 6 distinctive polypeptide chains. These include a CD3y chain (SwissProt P09693), a CD36 chain (SwissProt P04234), two CD3s chains (SwissProt P07766), and one CD3 £ chain homodimer (SwissProt 20963), and which is associated with the T cell receptor a and P chain. The term “CD3” includes any CD3 variant, isoform and species homolog which is naturally expressed by cells (including T cells) or can be expressed on cells transfected with genes or cDNA encoding those polypeptides, unless noted. A “BCMA x GPRC5D x CD3 antibody” is a multispecific antibody, optionally a trispecific antibody, which comprises three different antigen-binding arms, one of which binds to the antigen BCMA, one of which binds to the antigen GPRC5D, and one of which binds to CD3. A "BCMA x CD3 antibody" is a multispecific antibody, optionally a bispecific antibody, which comprises two different antigen-binding arms, one of which binds to the antigen BCMA and one of which binds to CD3. A "GPRC5D x CD3 antibody" is a multispecific antibody, optionally a bispecific antibody, which comprises two different antigen-binding arms, one of which binds to the antigen GPRC5D and one of which binds to CD3. The term "multispecific antibody" is used herein in the broadest sense and specifically covers an antibody that has polyepitopic specificity. Multispecific antibodies include, but are not limited to, an antibody comprising a heavy chain variable domain (Vh) and a light chain variable domain (Vl), where the VhVl unit has polyepitopic specificity, antibodies having two or more Vl and Vh domains where each VhVl unit binds to a different epitope, antibodies having two or more single variable domains with each single variable domain binding to a different epitope, full length antibodies, and antibodies comprising one or more antibody fragments as well as antibodies comprising antibody fragments that have been linked covalently or non-covalently. A multispecific antibody can be a bispecific antibody, a trispecific antibody, diabody, or similar molecule (see for instance PNAS USA 90(14), 6444-8 (1993) for a description of diabodies). The bispecific antibodies, trispecific antibodies, diabodies, and the like, provided herein may bind any suitable target in addition to a portion of BCMA or GPRC5D. The term "bispecific antibody" is to be understood as an antibody having two different antigen-binding arms defined by different antibody sequences. The term “trispecific antibody” is to be understood as an antibody having three different antigenbinding arms defined by different antibody sequences. This can be understood as different target binding but includes as well binding to different epitopes in one target. A “reference sample” is a sample that may be compared against another sample, such as a test sample, to allow for characterization of the compared sample. The reference sample will have some characterized property that serves as the basis for comparison with the test sample. For instance, a reference sample may be used as a benchmark for GPRC5D or BCMA levels that are indicative of a subject having cancer. The reference sample does not necessarily have to be analyzed in parallel with the test sample, thus in some instances the reference sample may be a numerical value or range previously determined to characterize a given condition, such as GPRC5D or BCMA levels that are indicative of cancer in a subject. The term also includes samples used for comparative purposes that are known to be associated with a physiologic state or disease condition, such as GPRC5D- or BCMA-expressing cancer, but that have an unknown amount of GPRC5D or BCMA. “Relapsed” refers to the return of a disease or the signs and symptoms of a disease after a period of improvement after prior treatment with a therapeutic. “Refractory” refers to a disease that does not respond to a treatment. A refractory disease can be resistant to a treatment before or at the beginning of the treatment, or a refractory disease can become resistant during a treatment. The term “progression,” as used in the context of progression of GPRC5D and / or BCMA -expressing cancer, includes the change of a cancer from a less severe to a more severe state. This may include an increase in the number or severity of tumors, the degree of metastasis, the speed with which the cancer is growing or spreading, and the like. For example, “the progression of colon cancer” includes the progression of such a cancer from a less severe to a more severe state, such as the progression from stage I to stage II, from stage II to stage III, etc. The term “regression,” as used in the context of regression of GPRC5D and / or BCMA -expressing cancer, includes the change of a cancer from a more severe to a less severe state. This could include a decrease in the number or severity of tumors, the degree of metastasis, the speed with which the cancer is growing or spreading, and the like. For example, “the regression of colon cancer” includes the regression of such a cancer from a more severe to a less severe state, such as the progression from stage III to stage II, from stage II to stage I, etc. The term “stable” as used in the context of stable GPRC5D and / or BCMA-expressing cancer, is intended to describe a disease condition that is not, or has not, changed significantly enough over a clinically relevant period of time to be considered a progressing cancer or a regressing cancer. The embodiments described herein are not limited to particular methods, reagents, compounds, compositions or biological systems, which can, of course, vary. Multispecific Antibodies Multispecific antibodies that bind to BCMA, GPRC5D, and CD3, and trispecific binding fragments thereof are provided herein. Such antibodies or antibody fragments may allow for more specific targeting to particular subsets of cells as compared to antibodies targeting only one or two of these targets. This can be achieved by, for example, making a molecule which comprises a first antigen-binding arm binding to CD3, a second antigen-binding arm binding to GPRC5D and a third antigen-binding arm binding to the BCMA. The antigen-binding arms can take any form that allows specific recognition of the target, for example the binding arm may be or may include a heavy chain variable domain, an Fv (combination of a heavy chain variable domain and a light chain variable domain), an single-chain Fv (scFv), an Fab, a binding domain based on a fibronectin type III domain (such as from fibronectin, or based on a consensus of the type III domains from fibronectin, or from tenascin or based on a consensus of the type III domains from tenascin, such as the Centyrin molecules from Janssen Biotech, Inc., see e.g. WO2010 / 051274 and WO2010 / 093627). In certain embodiments, the trispecific antibody comprises three antigen-binding arms. In some embodiments, the trispecific antibody is comprised of an antibody (e.g. in IgG format) to which an additional antigen-binding arm, e.g. in the form of a single chain variable fragment, is fused, e.g. to the N or C-terminus of one of the heavy or one of the light chains of the antibody. Accordingly, trispecific molecules comprising three different antigen-binding arms which bind BCMA, GPRC5D, and CD3, respectively, are provided. In some embodiments, the BCMA x GPRC5D x CD3-multispecific antibody comprises (a) a first antigen-binding arm comprising a first heavy chain variable domain (VH1) and a first light chain variable domain (VL1); (b) a second antigen-binding arm comprising a second heavy chain variable domain (VH2) and a second light chain variable domain (VL2); and (c) a third antigen-binding arm comprising a third heavy chain variable domain (VH3) and a third light chain variable domain (VL3). In some embodiments, the first antigen-binding arm binds to an epitope on CD3, the second antigen-binding arm binds to an epitope on GPRC5D, and the third antigenbinding arm binds to an epitope on BCMA. In some embodiments, the first antigen-binding arm that binds CD3 comprises a HCDR 1, a HCDR2 and a HCDR3 of the VH1 of SEQ ID NO: 8. In some embodiments, the first antigen-binding arm that binds CD3 comprises a LCDR1, a LCDR2 and a LCDR3 of the VL1 of SEQ ID NO: 7. In some embodiments, the first antigen-binding arm that binds CD3 comprises a HCDR1 comprising the amino acid sequence of GDSVFNNNAAWS (SEQ ID NO: 4), a HCDR2 comprising the amino acid sequence of RTYYRSKWLYD (SEQ ID NO: 5), and a HCDR3 comprising the amino acid sequence of GYSSSFDY (SEQ ID NO: 6). In some embodiments, the first antigen-binding arm that binds CD3 comprises a LCDR1 comprising the amino acid sequence of TGTSSNIGTYKFVS (SEQ ID NO: 1), a LCDR2 comprising the amino acid sequence of EVSKRPS (SEQ ID NO: 2), and a LCDR3 comprising the amino acid sequence of VSYAGSGTLL (SEQ ID NO: 3). In some embodiments, the first antigen-binding arm that binds CD3 comprises the VH1 of SEQ ID NO: 8. In some embodiments, the first antigenbinding arm that binds CD3 comprises the VL1 of SEQ ID NO: 7. In some embodiments, the second antigen-binding arm that binds GPRC5D comprises a HCDR1, a HCDR2 and a HCDR3 of the VH2 of SEQ ID NO: 16. In some embodiments, the second antigen-binding arm that binds GPRC5D comprises a LCDR1, a LCDR2 and a LCDR3 of the VL2 of SEQ ID NO: 15. In some embodiments, the second antigen-binding arm that binds GPRC5D comprises a HCDR1 comprising the amino acid sequence of GFSLTNIRMSVS (SEQ ID NO: 12), HCDR2 comprising the amino acid sequence of HIFSNDEKS (SEQ ID NO: 13), and a HCDR3 comprising the amino acid sequence of MRLPYGMDV (SEQ ID NO: 14). In some embodiments, the second antigenbinding arm that binds GPRC5D comprises a LCDR1 comprising the amino acid sequence of RSSQSLVHSDGNTYLS (SEQ ID NO: 9), a LCDR2 comprising the amino acid sequence of KISNRFF (SEQ ID NO: 10), and a LCDR3 comprising the amino acid sequence of MQATQFPHT (SEQ ID NO: 11). In some embodiments, the second antigenbinding arm that binds GPRC5D comprises the VH1 of SEQ ID NO: 16. In some embodiments, the second antigen-binding arm that binds GPRC5D comprises the VL1 of SEQ ID NO: 15. In some embodiments, the third antigen-binding arm that binds BCMA comprises a HCDR1, a HCDR2 and a HCDR3 of the VH3 of SEQ ID NO: 24. In some embodiments, the third antigen-binding arm that binds BCMA comprises a LCDR1, a LCDR2 and a LCDR3 of the VL3 of SEQ ID NO: 23. In some embodiments, the third antigen-binding arm that binds BCMA comprises a HCDR1 comprising the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a HCDR2 comprising the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and a HCDR3 comprising the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22); and a LCDR1 comprising the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17). In some embodiments, the third antigenbinding arm that binds BCMA comprises a LCDR2 comprising the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a LCDR3 comprising the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19). In some embodiments, the third antigen-binding arm that binds BCMA comprises the VH1 of SEQ ID NO: 24. In some embodiments, the third antigen-binding arm that binds BCMA comprises the VL1 of SEQ ID NO: 23. In some embodiments, the VH1 and VL1 of the antigen-binding arm that binds to CD3 epitope are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody). In some embodiments, the VH2 and VL2 of the antigen-binding arm that binds to GPRC5D epitope are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody). In some embodiments, the VH3 and VL3 of the antigen-binding arm that binds to BCMA epitope are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody). In some embodiments, the first antigen-binding arm of the BCMA x GPRC5D x CD3 multispecific antibody comprises a first heavy chain portion (HC1) comprising the VH1 and a light chain portion (LC) comprising the VL1, wherein the VH1 and VL1 pair to form a first antigen-binding domain that binds a first antigen. In some embodiments, the HC1 comprises, from N to C-terminus, the VH1, a first heavy chain constant domain (CHI), and a first Fc domain. In some embodiments, the VH1 and CHI of the HC1 together with the LC form a fragment antigen binding (Fab) domain. In some embodiments, the VH1 of the first antigen-binding arm is coupled to the VH3 of the third antigen-binding arm via the first Fc domain. In some embodiments, the first Fc domain of the first antigen-binding arm is coupled, via a first linker (LI), to the third antigen-binding arm, thereby forming a coupled first and third antigen-binding arm. The coupled first and third antigen-binding arms may comprise, from N to C-terminus, the VH1, the CHI domain, and the Fc domain of the first antigen-binding arm, the first linker, and the third antigen-binding arm. In some embodiments, the third antigen-binding arm is a single-chain variable fragment (scFv) formed from the VH3 and VL3 of the third-antigen-binding arm. In some embodiments, the second antigen-binding arm of the BCMA x GPRC5D x CD3 multispecific antibody comprises a second heavy chain portion (HC2) comprising the second heavy chain variable domain (VH2) which forms a second antigen-binding domain that binds a second antigen. In some embodiments, the second binding arm comprises from N to C-terminus, a single-chain variable fragment (scFv) formed from the VH2 and VL2, and a second Fc domain. In some embodiments, the VH2 of the second antigen-binding arm is coupled to the VH3 of the third antigen-binding arm via the second Fc domain. In some embodiments, the second Fc domain of the second antigen-binding arm is coupled, via a linker, to the third antigen-binding arm, thereby forming a coupled second and third antigen-binding arm. The coupled second and third antigen-binding arms may comprise, from N to C-terminus, the second antigen-binding domain, the second Fc domain, the first linker, and the third antigen-binding arm. In some embodiments, the third antigen-binding arm is a single-chain variable fragment (scFv) formed from the VH3 and VL3 of the third-antigenbinding arm. In preferred embodiments, the BCMA x GPRC5D x CD3-multispecific antibody is a trispecific antibody comprising a CD3-specific arm comprising a first heavy chain portion (HC1) comprising the VH1 and a light chain portion (LC) comprising the VL1. The VH1 and VL1 domains pair to form a first antigen-binding domain that binds CD3. The second antigen-binding arm of the trispecific antibody comprises a second heavy chain portion (HC2) with the VH2 which forms the second antigen-binding domain that binds the second antigen. The HC1 of the CD3-specific binding arm or the HC2 of the second antigen-binding arm is coupled to the third antigen-binding arm comprising the VH3 domain, which forms the third antigen-binding domain that binds the third antigen. In some embodiments, the second antigen is BCMA, and the third antigen is GPRC5D. In some embodiments, the second antigen is GPRC5D, and the third antigen is BCMA. In one embodiment, the BCMA x GPRC5D x CD3-multispecific antibody is a trispecific antibody comprising a CD3-specific binding arm comprising the HC1 with the VH1 and the LC with the VL1. The VH1 and VL1 pair to form the first CD3-specific antigen-binding domain that binds CD3. The second antigen-binding arm comprises the VH2 and VL2 that form the second antigen-binding domain that binds GPRC5D. The third antigen-binding arm is coupled to the second antigen-binding arm and comprises the VH3 and VL3 that form the third antigen-binding domain that binds BCMA. In one embodiment, the BCMA x GPRC5D x CD3-multispecific antibody is a trispecific antibody comprising a CD3-specific binding arm comprising the HC1 with the VH1 and the LC with the VL1. The VH1 and VL1 pair to form the first CD3-specific antigen-binding domain that binds CD3. The second antigen-binding arm comprises the VH2 and VL2 that form the second antigen-binding domain that binds BCMA. The third antigen-binding arm is coupled to the second antigen-binding arm and comprises the VH3 and VL3 that form the third antigen-binding domain that binds GPRC5D. In one embodiment, the BCMA x GPRC5D x CD3-multispecific antibody is a trispecific antibody comprising a CD3-specific binding arm comprising the HC1 with the VH1 and the LC with the VL1. The VH1 and VL1 pair to form the first CD3-specific antigen-binding domain that binds CD3. The second antigen-binding arm comprises the VH2 and VL2 that form the second antigen-binding domain that binds GPRC5D. The third antigen-binding arm is coupled to the first CD3-specific antigen-binding arm and comprises the VH3 and VL3 that form the third antigen-binding domain that binds BCMA. In one embodiment, the BCMA x GPRC5D x CD3-multispecific antibody is a trispecific antibody comprising a CD3-specific binding arm comprising the HC1 with the VH1 and the LC with the VL1. The VH1 and VL1 pair to form the first CD3-specific antigen-binding domain that binds CD3. The second antigen-binding arm comprises the VH2 and VL2 that form the second antigen-binding domain that binds BCMA. The third antigen-binding arm is coupled to the first CD3-specific antigen-binding arm and comprises the VH3 and VL3 that form the third antigen-binding domain that binds GPRC5D. In some embodiments, the HC1 with the VH1 and LC with the VL1 domains of the first antigen-binding arm form an antigen-binding fragment (Fab) comprising the first antigen-binding domain. In some embodiments, the VH2 and VL2 of the second antigenbinding arm form a single-chain variable fragment (scFv) comprising the second antigenbinding domain. In some embodiments, the VH3 and VL3 of the third antigen-binding arm form a single-chain variable fragment (scFv) comprising the third antigen-binding domain. In one embodiment, the CD3-binding arm comprises an antigen-binding fragment (Fab), the BCMA-binding arm comprises a single-chain variable fragment (scFv), and the GPRC5D-binding arm comprises a single-chain variable fragment (scFv). In one embodiment, the CD3-binding arm comprises a single-chain variable fragment (scFv), the BCMA-binding arm comprises an antigen-binding fragment (Fab), and the GPRC5D-binding arm comprises a single-chain variable fragment (scFv). In one embodiment, the CD3-binding arm comprises a single-chain variable fragment (scFv), the BCMA-binding arm comprises a single-chain variable fragment (scFv), and the GPRC5D-binding arm comprises an antigen-binding fragment (Fab). In some embodiments, the CD3-binding arm of the trispecific antibody comprises the HC1 and the LC. The HC1 may comprise constant heavy chain regions (CHI, CH2, and CH3) and the VH1. The LC may comprise the VL1. The VH1 and VL1 combine to form the CD3 antigen binding domain. In some embodiments, GPRC5D-binding arm of the trispecific antibody comprises the HC2. The HC2 may comprise constant heavy chain regions (CH2 and CH3), and a singlechain variable fragment (scFv) attached at the N-terminus of the CH2 region, wherein the scFv comprises the GPRC5D antigen binding domain. In some embodiments, the trispecific antibody further comprises BCMA antigenbinding arm attached to the C-terminus of the CH3 region of the GPRC5D-binding arm to form a GPRC5D / BCMA binding arm. In some embodiments, the BCMA antigen-binding arm comprises a second single-chain variable fragment (scFv). In some embodiments, the GPRC5D / BCMA arm may have the structure: scFv containing the GPRC5D binding domain, CH2 and CH3 regions, scFv containing the BCMA binding domain. In some embodiments, the CD3-binding arm of the trispecific antibody comprises the HC1 and the LC. The HC1 may comprise constant heavy chain regions (CHI, CH2, and CH3) and the VH1. The LC may comprise the VL1. The VH1 and VL1 combine to form the CD3 antigen binding domain. In some embodiments, BCMA-binding arm of the trispecific antibody comprises the HC2. The HC2 may comprise constant heavy chain regions (CH2 and CH3), and a single chain variable fragment (scFv) attached at the N-terminus of the CH2 region, wherein the scFv comprises the BCMA antigen binding domain. In some embodiments, the trispecific antibody further comprises GPRC5D antigenbinding arm attached to the C-terminus of the CH3 region of the CD3-binding arm to form a CD3 / GPRC5D binding arm. In some embodiments, the BCMA antigen-binding arm comprises a second single-chain variable fragment (scFv). In some embodiments, the CD3 / GPRC5D arm may have the structure: Fab containing the CD3 binding domain, CH2 and CH3 regions, scFv containing the GPRC5D binding domain. In some embodiments, the multispecific antibodies of the invention include antibodies having a full length antibody structure. "Full length antibody" as used herein refers to an antibody having two full length antibody heavy chains and two full length antibody light chains. A full length antibody heavy chain (HC) includes heavy chain variable and constant domains VH, CHI, CH2, and CH3. A full length antibody light chain (LC) includes light chain variable and constant domains VL and CL. The full length antibody may be lacking the C-terminal lysine (K) in either one or both heavy chains. The term "Fab-arm" or "half molecule" refers to one heavy chain-light chain pair that binds an antigen. In some embodiments, one of the antigen-binding domains is a non-antibody based binding domain, e.g. a binding domain of based on a fibronectin type 3 domain, e.g. Centyrin. BCMA-binding arm The BCMA x GPRC5D x CD3-multispecific antibody described herein comprises an antigen-binding arm specific for BCMA. In some embodiments, the BCMA-binding arm binds human BCMA. In some embodiments, the BCMA-binding arm binds human BCMA and cynomolgus monkey BCMA. In some embodiments, the BCMA-binding arm binds human BCMA but not to cynomolgus monkey BCMA. In some embodiments, the BCMA-binding arm binds bind to an epitope including one or more residues from the BCMA extracellular domain (ECD). In some embodiments, the BCMA-binding arm binds to residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain. The BCMA-binding arms may bind to BCMA with an affinity of 5xlO'7M or less, such as 1x10'7M or less, 5xl0'8M or less, 1x10'8M or less, 5xl0'9M or less, 1x10'9M, or 5xlO'10 M or less. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about 1 xlO'loM to 1 xlO'7M. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about 1 xlO'loM, about 2 xlO'loM, about 3 xlO'loM, about 4 xlO'loM, about 5 xlO'loM, about 6 xlO'loM, about 7 xlO'loM, about 8 xlO'loM, about 9xlO'loM, about 1x10'9M, about 2 xlO'9M, about 3 xlO'9M, about 4 xlO'9M, about 5 xlO’ 9M, about 6 x10'9M, about 7 xlO'9M, about 8 xlO'9M, or about 9xlO'9M. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about IxlO'10 to 5xlO'loM, about IxlO'10 to 8xlO'loM, about 2xlO'10 to 9xlO'loM, about 3xlO'10 to 10xl0'10M, about 4x1 O'10 to 10xl0'10M, or about 5x1 O'10 to 10xl0'10M. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about 8.4 xlO'loM as determined by a surface plasmon resonance (SPR) assay. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about 2.1 xlO'loM as determined by a surface plasmon resonance (SPR) assay. Table 1 provides a summary of examples of some BCMA-specific antibodies described herein: Table 1. CDR sequences of exemplary mAbs generated against human BCMA ID HC-CDR1 HC-CDR2 HC-CDR3 LC-CDR1 LC-CDR2 LC-CDR3 BCMB519 GFTFSSYAMS (SEQ ID NO 20) AISGSGGSTY (SEQ ID NO 21) DEGYSSGHYYG MDV (SEQ ID NO 22) RASQSISSSFLT (SEQ ID NO 17) GASSRAT (SEQ ID NO 18) QHYGSSPMY T (SEQ ID NO 19) BCMB69 SGSYFWG (SEQ ID NO 32) SIYYSGITYYNPSLKS (SEQ ID NO 33) HDGAVAGLFDY (SEQ ID NO 34) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BCMB117 SGSYFWG (SEQ ID NO 32) SIYYSGITYYNPSLKS (SEQ ID NO 33) HDGAVAGLFDY (SEQ ID NO 34) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BOMB 123 SSSYFWG (SEQ ID NO 38) SIYYSGITYYNPSLKS (SEQ ID NO 33) HDGAVAGLFDY (SEQ ID NO 34) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BOMB 128 SGSYFWG (SEQ ID NO 32) SIYYSGITYYNPSLKS (SEQ ID NO 33) HDGATAGLFDY (SEQ ID NO 37) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BCMB129 SGSYFWG (SEQ ID NO 32) SIYYSGSTYYNPSLKS (SEQ ID NO 36) HDGAVAGLFDY (SEQ ID NO 34) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BCMB176 SSSYFWG (SEQ ID NO 38) SIYYSGITYYNPSLKS (SEQ ID NO 33) HDGATAGLFDY (SEQ ID NO 37) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) BCMB177 SSSYFWG (SEQ ID NO 38) SIYYSGRTYYNPSLK S (SEQ ID NO 164) HDGATAGLFDY (SEQ ID NO 37) GGNNIGSKSVH (SEQ ID NO 39) DDSDRPS (SEQ ID NO 40) QVWDSSSDH W (SEQ ID NO 41) Characteristics of some BCMA-specific antibodies or antigen-binding fragments may be found in e.g., United States Patent No. 10,072,088, the content of which is herein incorporated by reference in its entirety. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises a light chain variable region comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1 and a light chain variable region comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm competes for binding to BCMA with an antibody or antigen-binding comprising a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1 and a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1 and a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 1. In some embodiments, the BCMA-binding arm comprises heavy chain CDR1, CDR2, and CDR3 of clone BCMB519, BCMB69, BCMB117, BCMB123, BCMB128, BCMB129, BCMB176, or BCMB177. In some embodiments, the BCMA-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone BCMB519, BCMB69, BCMB117, BCMB123, BCMB128, BCMB129, BCMB176, or BCMB177. In one embodiment, the BCMA-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone BCMB519. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain derived from an antibody clone as described in Table 1. In some exemplary embodiments, the BCMA-binding arm comprises heavy chain variable domain and light chain variable domain derived from an antibody clone as described in Table 1. In some exemplary embodiments, the BCMA-binding arm comprises heavy chain variable domain and light chain variable domain of clone BCMB519, BCMB69, BCMB117, BCMB123, BCMB128, BCMB129, BCMB176, or BCMB177. In one embodiment, the BCMA-binding arm comprises heavy chain variable domain and light chain variable domain of clone BCMB519. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 20, a heavy chain CDR2 comprising SEQ ID NO: 21, and a heavy chain CDR3 comprising SEQ ID NO: 22. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 20, a heavy chain CDR2 comprising SEQ ID NO: 21, a heavy chain CDR3 comprising SEQ ID NO: 22, a light chain CDR1 comprising SEQ ID NO: 17, a light chain CDR2 comprising SEQ ID NO: 18, and a light chain CDR3 comprising SEQ ID NO: 19. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 24. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 24 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 23. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 33, and a heavy chain CDR3 comprising SEQ ID NO: 34. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 33, a heavy chain CDR3 comprising SEQ ID NO: 34, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 42. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 42 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 33, and a heavy chain CDR3 comprising SEQ ID NO: 34. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 33, a heavy chain CDR3 comprising SEQ ID NO: 34, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 43. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 43 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. In some embodiments, the BCMA-binding arm comprises comprise a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 33, and a heavy chain CDR3 comprising SEQ ID NO: 37. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 33, a heavy chain CDR3 comprising SEQ ID NO: 37, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 44. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 44 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 36, and a heavy chain CDR3 comprising SEQ ID NO: 34. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 32, a heavy chain CDR2 comprising SEQ ID NO: 36, a heavy chain CDR3 comprising SEQ ID NO: 34, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 45. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 45 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 33, and a heavy chain CDR3 comprising SEQ ID NO: 37. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 33, a heavy chain CDR3 comprising SEQ ID NO: 37, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 46. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 46 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 164, and a heavy chain CDR3 comprising SEQ ID NO: 37. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 38, a heavy chain CDR2 comprising SEQ ID NO: 164, a heavy chain CDR3 comprising SEQ ID NO: 37, a light chain CDR1 comprising SEQ ID NO: 39, a light chain CDR2 comprising SEQ ID NO: 40, and a light chain CDR3 comprising SEQ ID NO: 41. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 47. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 47 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 48. The BCMA-binding arm may be derived from any species by recombinant means. For example, the BCMA antigen-binding arm may be derived from mouse, rat, goat, horse, swine, bovine, chicken, rabbit, cam elid, donkey, human, or chimeric versions thereof. For use in administration to humans, non-human derived antigen-binding fragments may be genetically or structurally altered to be less antigenic upon administration to a human patient. In some embodiments, the BCMA-binding arm comprises antigen-binding fragments which is chimeric. In some embodiments, the BCMA-binding arm comprises humanized antigenbinding fragments. Humanized antigen-binding fragments may be derived from chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab’, F(ab’)2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies or antigen-binding fragments are human immunoglobulins (recipient antibody) or antigen-binding fragments in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In general, the humanized antibody antigen-binding fragments will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody antigen-binding fragments may include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. 5 GPRC5D-binding arm The BCMA x GPRC5D x CD3-multispecific antibody described herein comprises an antigen-binding arm specific for GPRC5D. In some embodiments, the GPRC5D-binding arm binds human GPRC5D. In some embodiments, GPRC5D-binding arm binds human GPRC5D and cynomolgus monkey GPRC5D, preferably the extracellular domain 10 thereof. In some embodiments, GPRC5D-binding arm binds human GPRC5D but not to cynomolgus monkey GPRC5D. In some embodiments, the GPRC5D-binding arm binds to one or more residues of a polypeptide having the amino acid sequence of SEQ ID NO: 116. Table 2 provides a summary of examples of some GPRC5D-specific antibodies 15 described herein: Table 2. CDR sequences of exemplary mAbs generated against human GPRC5D ID HC-CDR1 HC-CDR2 HC-CDR3 LC-CDR1 LC-CDR2 LC-CDR3 GC5B680 GFSLTNIRMSV S (SEQ ID NO: 12) HIFSNDEKS (SEQ ID NO: 13) MRLPYGMDV (SEQ ID NO: 14) RSSQSLVHSDG NTYLS (SEQ ID NO:9) KISNRFF (SEQ ID NO: 10) MQATQFPHT (SEQ ID NO: 11) GC5B81 SYAIS (SEQ ID NO 49) GIIPIFGTANYA QKFQG (SEQ ID NO 53) ESRWRGYKLD (SEQ ID NO 57) RASQSISSYLN (SEQ ID NO 61) AASSLQS (SEQ ID NO 64) QQSYSTPLT (SEQ ID NO 67) GC5B465 GC5B597 GC5B598 NYWMS (SEQ ID NO 50) GISYSGGSKYY ASSVKG (SEQ ID NO 54) AAFDFGRRAV RLD (SEQ ID NO 58) RASQSISSYLN (SEQ ID NO 61) AASSLQS (SEQ ID NO 64) QQSYSTPLT (SEQ ID NO 67) GC5B483 GC5B599 SYFIG (SEQ ID NO 51) IIYPGKSDTRYS PSFQG (SEQ ID NO 55) VYSFGGRHKA LFDY (SEQ ID NO 59) RASQSVSSYLA (SEQ ID NO 62) DASNRAT (SEQ ID NO 65) QQRSNWPLT (SEQ ID NO 68) GC5B596 GYTMN (SEQ ID NO 52) LINPYNSDTNY AQKLQG (SEQ ID NO 56) VALRVALDY (SEQ ID NO 60) KASQNVATHV G (SEQ ID NO 63) SASYRYS (SEQ ID NO 66) QQYNRYPYT (SEQ ID NO 69) GC5B382 DYGMH (SEQ ID NO 70) AIKYSGGSTYY ADSVKG (SEQ ID NO 77) RAESGPGLDY (SEQ ID NO 84) KSSQSVLYSSN NKNYLA (SEQ ID NO 91) WASTRES (SEQ ID NO 93) QQYYSTPLT (SEQ ID NO 95) GC5B379 NYWMS (SEQ ID NO 50) GISYSGGSKYY ADSVKG (SEQ ID NO 78) AAWDFGRRAV RLDY (SEQ ID NO 85) RASQSISSYLN (SEQ ID NO 61) AASSLQS (SEQ ID NO 64) QQSYSTPLT (SEQ ID NO 67) GC5B373 SYWIG (SEQ ID NO 71) IIYPGDSDTRYS PSFQG (SEQ ID NO 79) IGFYGRSFRIFD Y (SEQ ID NO 86) RASQSVSSYLA (SEQ ID NO 62) DASNRAT (SEQ ID NO 65) QQRSNWPLT (SEQ ID NO 68) GC5B376 SYWIG RASQSVSSYLA DASNRAT (SEQ ID NO 71) IIYPGDSDTRYS PSFQG (SEQ ID NO 79) VYSFGGRHKA LFDY (SEQ ID NO 59) (SEQ ID NO 62) (SEQ ID NO 65) QQRSNWPLT (SEQ ID NO 68) GC5B385 GYAMS (SEQ ID NO 72) AISGSGGSTYY ADSVKG (SEQ ID NO 80) VDRSFGRSRYT LDY (SEQ ID NO 87) RASQSVSSYLA (SEQ ID NO 62) DASNRAT (SEQ ID NO 65) QQRSNWPLT (SEQ ID NO 68) GC5B370 SYGIS (SEQ ID NO 73) GIIPIFGNINYA QKFQG (SEQ ID NO 81) VSRRFKRFAYY FDY (SEQ ID NO 88) KSSQSVLYSSN NKNYLA (SEQ ID NO 91) WASTRES (SEQ ID NO 93) QQYYSTPLT (SEQ ID NO 95) GC5B602 GYSFTGYTMN (SEQ ID NO 74) LINPYNGDTN (SEQ ID NO 82) VALRVALDY (SEQ ID NO 60) KASQNVATHV G (SEQ ID NO 63) SASYRYS (SEQ ID NO 66) QQYNRYPYT (SEQ ID NO 69) GC5B603 SYAMS (SEQ ID NO 75) AISGSGGSTYY ADSVKG (SEQ ID NO 80) SNFLPWFDY (SEQ ID NO 89) RASQSVRKSLA (SEQ ID NO 92) TASNRAT (SEQ ID NO 94) QQYFRAPIT (SEQ ID NO 96) GC5B601 GFSLTSYNVH (SEQ ID NO 76) VIWAGGSTNY NSALMS (SEQ ID NO 83) DGIRLRFAY (SEQ ID NO 90) KASQNVATHV G (SEQ ID NO 63) SASYRYS (SEQ ID NO 66) QQYNRYPYT (SEQ ID NO 69) Characteristics of some GPRC5D-specific antibodies or antigen-binding fragments may be found in e.g., United States Patent No. 10,562,968, United States Published Application US2020 / 0231686, the content of each of which is herein incorporated by reference in its entirety. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a light chain variable domain comprising a light chain CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2 and a light chain variable domain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm competes for binding to GPRC5D with an antibody or antigen-binding comprising a heavy chain comprising a heavy chain CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 2 and a light chain comprising a light chain CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2 and a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1, CDR2, and CDR3 derived from an antibody clone as described in Table 2. In some embodiments, the GPRC5D-binding arm comprises a light chain CDR1, CDR2, and CDR3 derived from an antibody clone as described in Table 2. In some embodiments, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 derived from an antibody clone as described in Table 2. In some embodiments, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 of clone GC5B680, GC5B81, GC5B465, GS5B483, GC5B596, GC5B382, GC5B379, GC5B373, GC5B376, GC5B385, GC5B370, GC5B602, GC5B603, GC5B599, GC5B601, GC5B598, or GC5B597. In some embodiments, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone GC5B680, GC5B81, GC5B465, GS5B483, GC5B596, GC5B382, GC5B379, GC5B373, GC5B376, GC5B385, GC5B370, GC5B602, GC5B603, GC5B599, GC5B601, GC5B598, or GC5B597. In one embodiment, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone GC5B680. In some exemplary embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain derived from an antibody clone as described in Table 2. In some exemplary embodiments, the GPRC5D-binding arm comprises heavy chain variable domain and light chain variable domain derived from an antibody clone as described in Table 2. In some exemplary embodiments, the GPRC5D-binding arm comprises heavy chain variable domain and light chain variable domain of clone GC5B680, GC5B81, GC5B465, GS5B483, GC5B596, GC5B382, GC5B379, GC5B373, GC5B376, GC5B385, GC5B370, GC5B602, GC5B603, GC5B599, GC5B601, GC5B598, or GC5B597. In one embodiment, the GPRC5D-binding arm comprises heavy chain variable domain and light chain variable domain of clone GC5B680. In some embodiments, the GPRC5D-specific antibody clone may induce ADCC in vitro with an ECso of 28 nM or less. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 12, a heavy chain CDR2 comprising SEQ ID NO: 13, and a heavy chain CDR3 comprising SEQ ID NO: 14. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 12, a heavy chain CDR2 comprising SEQ ID NO: 13, a heavy chain CDR3 comprising SEQ ID NO: 14, a light chain CDR1 comprising SEQ ID NO: 9, a light chain CDR2 comprising SEQ ID NO: 10, and a light chain CDR3 comprising SEQ ID NO: 11. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 16. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 16 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 15. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 49, a heavy chain CDR2 comprising SEQ ID NO: 53, and a heavy chain CDR3 comprising SEQ ID NO: 57. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 49, a heavy chain CDR2 comprising SEQ ID NO: 53, a heavy chain CDR3 comprising SEQ ID NO: 57, a light chain CDR1 comprising SEQ ID NO: 61, a light chain CDR2 comprising SEQ ID NO: 64, and a light chain CDR3 comprising SEQ ID NO: 67. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 97. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 97 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 101. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 50, a heavy chain CDR2 comprising SEQ ID NO: 54, and a heavy chain CDR3 comprising SEQ ID NO: 58. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 50, a heavy chain CDR2 comprising SEQ ID NO: 54, a heavy chain CDR3 comprising SEQ ID NO: 58, a light chain CDR1 comprising SEQ ID NO: 61, a light chain CDR2 comprising SEQ ID NO: 64, and a light chain CDR3 comprising SEQ ID NO: 67. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 98. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 98 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 101. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 51, a heavy chain CDR2 comprising SEQ ID NO: 55, and a heavy chain CDR3 comprising SEQ ID NO: 59. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 51, a heavy chain CDR2 comprising SEQ ID NO: 55, a heavy chain CDR3 comprising SEQ ID NO: 59, a light chain CDR1 comprising SEQ ID NO: 62, a light chain CDR2 comprising SEQ ID NO: 65, and a light chain CDR3 comprising SEQ ID NO: 68. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 99. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 99 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 102. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 52, a heavy chain CDR2 comprising SEQ ID NO: 56, and a heavy chain CDR3 comprising SEQ ID NO: 60. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 52, a heavy chain CDR2 comprising SEQ ID NO: 56, a heavy chain CDR3 comprising SEQ ID NO: 60, a light chain CDR1 comprising SEQ ID NO: 63, a light chain CDR2 comprising SEQ ID NO: 66, and a light chain CDR3 comprising SEQ ID NO: 69. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 100. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 100 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 103. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 70, a heavy chain CDR2 comprising SEQ ID NO: 77, and a heavy chain CDR3 comprising SEQ ID NO: 84. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 70, a heavy chain CDR2 comprising SEQ ID NO: 77, a heavy chain CDR3 comprising SEQ ID NO: 84, a light chain CDR1 comprising SEQ ID NO: 91, a light chain CDR2 comprising SEQ ID NO: 93, and a light chain CDR3 comprising SEQ ID NO: 95. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 104. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 104 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 113. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 50, a heavy chain CDR2 comprising SEQ ID NO: 78, and a heavy chain CDR3 comprising SEQ ID NO: 85. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 50, a heavy chain CDR2 comprising SEQ ID NO: 78, a heavy chain CDR3 comprising SEQ ID NO: 85, a light chain CDR1 comprising SEQ ID NO: 61, a light chain CDR2 comprising SEQ ID NO: 64, and a light chain CDR3 comprising SEQ ID NO: 67. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 105. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 105 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 101. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO: 79, and a heavy chain CDR3 comprising SEQ ID NO: 86. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO: 79, a heavy chain CDR3 comprising SEQ ID NO: 86, a light chain CDR1 comprising SEQ ID NO: 62, a light chain CDR2 comprising SEQ ID NO: 65, and a light chain CDR3 comprising SEQ ID NO: 68. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 106. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 106 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 102. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO: 79, and a heavy chain CDR3 comprising SEQ ID NO: 59. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO: 79, a heavy chain CDR3 comprising SEQ ID NO: 59, a light chain CDR1 comprising SEQ ID NO: 62, a light chain CDR2 comprising SEQ ID NO: 65, and a light chain CDR3 comprising SEQ ID NO: 68. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 107. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 107 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 102. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 72, a heavy chain CDR2 comprising SEQ ID NO: 80, and a heavy chain CDR3 comprising SEQ ID NO: 87. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 72, a heavy chain CDR2 comprising SEQ ID NO: 80, a heavy chain CDR3 comprising SEQ ID NO: 87, a light chain CDR1 comprising SEQ ID NO: 62, a light chain CDR2 comprising SEQ ID NO: 65, and a light chain CDR3 comprising SEQ ID NO: 68. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 108. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 108 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 102. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 73, a heavy chain CDR2 comprising SEQ ID NO: 81, and a heavy chain CDR3 comprising SEQ ID NO: 88. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 73, a heavy chain CDR2 comprising SEQ ID NO: 81, a heavy chain CDR3 comprising SEQ ID NO: 88, a light chain CDR1 comprising SEQ ID NO: 91, a light chain CDR2 comprising SEQ ID NO: 93, and a light chain CDR3 comprising SEQ ID NO: 95. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 109. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 109 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 113. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 74, a heavy chain CDR2 comprising SEQ ID NO: 82, and a heavy chain CDR3 comprising SEQ ID NO: 60. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 74, a heavy chain CDR2 comprising SEQ ID NO: 82, a heavy chain CDR3 comprising SEQ ID NO: 60, a light chain CDR1 comprising SEQ ID NO: 63, a light chain CDR2 comprising SEQ ID NO: 66, and a light chain CDR3 comprising SEQ ID NO: 69. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 110. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 110 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 103. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 75, a heavy chain CDR2 comprising SEQ ID NO: 80, and a heavy chain CDR3 comprising SEQ ID NO: 89. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 75, a heavy chain CDR2 comprising SEQ ID NO: 80, a heavy chain CDR3 comprising SEQ ID NO: 89, a light chain CDR1 comprising SEQ ID NO: 92, a light chain CDR2 comprising SEQ ID NO: 94, and a light chain CDR3 comprising SEQ ID NO: 96. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 111. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 111 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 114. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 76, a heavy chain CDR2 comprising SEQ ID NO: 83, and a heavy chain CDR3 comprising SEQ ID NO: 90. In some embodiments, the GPRC5D-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 76, a heavy chain CDR2 comprising SEQ ID NO: 83, a heavy chain CDR3 comprising SEQ ID NO: 90, a light chain CDR1 comprising SEQ ID NO: 63, a light chain CDR2 comprising SEQ ID NO: 66, and a light chain CDR3 comprising SEQ ID NO: 69. The GPRC5D-binding arm may comprise human framework sequences. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 112. In some embodiments, the GPRC5D-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 112 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 115. The GPRC5D-binding arm may be derived from any species by recombinant means. For example, the GPRC5D antigen-binding arm may be derived from mouse, rat, goat, horse, swine, bovine, chicken, rabbit, camelid, donkey, human, or chimeric versions thereof. For use in administration to humans, non-human derived antigen-binding fragments may be genetically or structurally altered to be less antigenic upon administration to a human patient. In some embodiments, the GPRC5D-binding arm comprises antigen-binding fragments which is chimeric. In some embodiments, the GPRC5D-binding arm comprises humanized antigenbinding fragments. Humanized antigen-binding fragments may be derived from chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab’, F(ab’)2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies or antigen-binding fragments are human immunoglobulins (recipient antibody) or antigen-binding fragments in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In general, the humanized antibody antigen-binding fragments will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody antigen-binding fragments may include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. CD3-binding arm The BCMA x GPRC5D x CD3-multispecific antibodies described herein comprise an antigen-binding arm that binds CD3. In some embodiments, the CD3-binding arm binds human CD3. In some preferred embodiments, the CD3-specific arm of the BCMA x GPRC5D x CD3 multispecific antibody is derived from a CD3-specific antibody that binds and activates human primary T cells and / or cynomolgus monkey primary T cells. In some embodiments, the CD3-binding arm binds to an epitope at the N-terminus of CD3s. In some embodiments, the CD3-binding arm binds to residues 22-35 (QDGNEEMGGITQTP (SEQ ID NO: 161)) of the CD3s chain. The CD3-binding arm may bind to CD3 with an affinity of 5xlO'7M or less, such as 1x10'7M or less, 5xl0'8M or less, 1x10'8M or less, 5xl0'9M or less, or 1x10'9M or less. In some embodiments, the CD3-binding arm binds to the CD3 with an affinity of about 1x10’ 8M, about 2 x10'8M, about 3 xlO'8M, about 4 xlO'8M, about 5 xlO'8M, about 6 xlO'8M, about 7 xlO'8M, about 8 xlO'8M, about 9xlO'8M, or about 1x10'8M. In some embodiments, the CD3-binding arm binds to the CD3 with an affinity of about 1 xlO'8M to about 3x10' 8M, about 2 x10'8M to about 4 xlO'8M, about 1 xlO'8M to about 5 xlO'8M, about 2 xlO'8M to about 6 x10'8M, or about 3 xlO'8M to about 8 xlO'8M. In one embodiment, the CD3-binding arm binds to the CD3 with an affinity of about 2.5 xlO'8M. In one embodiment, the CD3-binding arm binds to the CD3 with an affinity of about 3.1 xlO'8M. In some embodiments, the CD3-binding affinity is determined by a surface plasmon resonance (SPR) assay. Human CD3s is described under UniProt P07766 (CD3EHUMAN). An anti CD3s antibody described in the state of the art is SP34 (Yang SJ, The Journal of Immunology (1986) 137; 1097-1100). SP34 reacts with both primate and human CD3. SP34 is available from Pharmingen. A further anti CD3 antibody described in the state of the art is UCHT-1 (see WO2000041474). A further anti-CD3 antibody described in the state of the art is BC-3 (Fred Hutchinson Cancer Research Institute; used in Phase I / II trials of GvHD, Anasetti et al., Transplantation 54: 844 (1992)). SP34 differs from UCHT-1 and BC-3 in that SP-34 recognizes an epitope present on solely the a chain of CD3 (see Salmeron et al., (1991) J. Immunol. 147: 3047) whereas UCHT-1 and BC-3 recognize an epitope contributed by both the a and y chains. The sequence of an antibody with the same sequence as of antibody SP34 is mentioned in WO2008119565, WO2008119566, WO2008119567, WO2010037836, WO2010037837 and WO2010037838. A sequence which is 96% identical to VH of antibody SP34 is mentioned in US8236308 (WO2007042261). In some embodiments, the CD3-binding arm contacts an epitope including the six N-terminal amino acids of CD3e. In some embodiments, the CD3-specific binding arm of the multispecific antibody is derived from the mouse monoclonal antibody SP34, a mouse IgG3 / lambda isotype. In some embodiments, the CD3-binding arm comprises the CDRs of antibody SP34. Such CD3-binding arms may bind to CD3 with an affinity of 5xlO'7M or less, such as 1x10'7M or less, 5xl0'8M or less, 1x10'8M or less, 5xl0'9M or less, or 1x10'9M or less. The CD3-specific binding arm may be a humanized version of an arm of 5 mouse monoclonal antibody SP34. Human framework adaptation (HFA) may be used to humanize the anti-CD3 antibody from which the CD3-specific arm is derived. Table 3 provides a summary of examples of some CD3-specific antibodies described herein: Table 3. Heavy chains and light chains of exemplary CD3-specific antibodies and 10 antigen-binding fragments Heavy Chain Light Chain CD3B376 CDR 1: GDSVFNNNAAWS (SEQ ID NO: 4) CDR 1: TGTSSNIGTYKFVS (SEQ ID NO: 1) CDR 2: RTYYRSKWLYD (SEQ ID NO: 5) CDR 2: EVSKRPS (SEQ ID NO: 2) CDR 3: GYSSSFDY (SEQ ID NO: 6) CDR 3: VSYAGSGTLL (SEQ ID NO: 3) VH: QVQLQQSGPRLVRPSQTLSLTCAISGDSVFNNNA AWSWIRQSPSRGLEWLGRTYYRSKWLYDYAVS VKSRITVNPDTSRNQFTLQLNSVTPEDTALYYCA RGYSSSFDYWGQGTLVTVSS (SEQ ID NO: 8) VL: QSALTQPASVSGSPGQSITISCTGTSSNIGTYK FVSWYQQHPDKAPKVLLYEVSKRPSGVSSR FSGSKSGNTASLTISGLQAEDQADYHCVSYA GSGTLLFGGGTKLTVL (SEQ ID NO: 7) Heavy chain: QVQLQQSGPRLVRPSQTLSLTCAISGDSVFNNNA AWSWIRQSPSRGLEWLGRTYYRSKWLYDYAVS VKSRITVNPDTSRNQFTLQLNSVTPEDTALYYCA RGYS S SFD YWGQGTL VT VS S ASTKGPS VFPL APS SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVSV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL SCAVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEA LHNRFTQKSLSLSPGK (SEQ ID NO: 26) Light chain: QSALTQPASVSGSPGQSITISCTGTSSNIGTYK FVSWYQQHPDKAPKVLLYEVSKRPSGVSSR FSGSKSGNTASLTISGLQAEDQADYHCVSYA GSGTLLFGGGTKLTVL GQPKAAPSVTLFPPS SEELQANKATLVCLISDFYPGAVTVAWKAD S SP VK AG VETTTP SKQ SNNKY A AS S YL SLTP EQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 27) CD3B219 CDR 1: TYAMN (SEQ ID NO: 117) CDR 1: RSSTGAVTTSNYAN (SEQ ID NO: 122) CDR 2: RIRSKYNNYATYYAASVKG (SEQ ID NO: 118) CDR 2: GTNKRAP (SEQ ID NO: 123) CDR 3: HGNFGNSYVSWFAY (SEQ ID NO: 119) CDR 3: ALWYSNLWV (SEQ ID NO: 124) VH: EVQLVESGGGLVQPGGSLRLSCAASGFTFNTYA MNWVRQAPGKGLEWVARIRSKYNNYATYYAA VL: QTVVTQEPSLTVSPGGTVTLTCRSSTGAVTT SNYANWVQQKPGQAPRGLIGGTNKRAPGTP S VKGRFTISRDD SKNSL YLQMNSLKTEDT AVYY CARHGNFGNSYVSWFAYWGQGTLVTVSS (SEQ ID NO: 120) ARFSGSLLGGKAALTLSGVQPEDEAEYYCA LWYSNLWVFGGGTKLTVL (SEQ ID NO: 125) Heavy chain: EVQLVESGGGLVQPGGSLRLSCAASGFTFNTYA MNWVRQAPGKGLEWVARIRSKYNNYATYYAA S VKGRFTISRDD SKNSL YLQMNSLKTEDT AVYY CARHGNFGNSYVSWFAYWGQGTLVTVSSASTK GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTV SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS SSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPC PPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFLLYSKLTVDKSRWQEGNVFSCSV MHEALHNHYTQKSLSLSLGK (SEQ ID NO: 121) Light chain: QTVVTQEPSLTVSPGGTVTLTCRSSTGAVTT SNYANWVQQKPGQAPRGLIGGTNKRAPGTP ARFSGSLLGGKAALTLSGVQPEDEAEYYCA LWYSNLWVFGGGTKLTVL GQPKAAPSVTLF PPSSEELQANKATLVCLISDFYPGAVTVAWK ADSSPVKAGVEITTPSKQSNNKYAASSYLSL TPEQWKSHRSYSCQVTHEGSTVEKTVAPTE CS (SEQ ID NO: 126) Characteristics of some CD3-specific antibodies or antigen-binding fragments may be found in e.g., United States Patents No. 10,562,968 and 10,072,088, United States Published Application US2019 / 0382481, the content of each of which is herein incorporated by reference in its entirety. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a light chain variable domain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3 and a light chain variable domain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm competes for binding to CD3 with an antibody or antigen-binding comprising a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3 and a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a heavy chain comprising a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3 and a light chain comprising a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a heavy chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a light chain CDR1, CDR2, and CDR3 of any one of the antibodies described in Table 3. In some embodiments, the CD3-binding arm comprises a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 3 and a light chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 3. In some embodiments of the multispecific antibodies, the CD3-binding arm comprises a heavy chain and light chain pair selected from Table 3. In some embodiments, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone CD3B376. In some embodiments, the GPRC5D-binding arm comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of clone CD3B219. In some embodiments, the CD3-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 4, a heavy chain CDR2 comprising SEQ ID NO: 5, and a heavy chain CDR3 comprising SEQ ID NO: 6. In some embodiments, the CD3-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 4, a heavy chain CDR2 comprising SEQ ID NO: 5, a heavy chain CDR3 comprising SEQ ID NO: 6, a light chain CDR1 comprising SEQ ID NO: 1, a light chain CDR2 comprising SEQ ID NO: 2, and a light chain CDR3 comprising SEQ ID NO: 3. The CD3-binding arm may comprise human framework sequences. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 8. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 8 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 7. In some embodiments, the CD3-binding arm comprises a heavy chain substantially the same as, or identical to, SEQ ID NO: 26. In some embodiments, the CD3-binding arm comprises a heavy chain substantially the same as, or identical to, SEQ ID NO: 26 and a light chain substantially the same as, or identical to, SEQ ID NO: 27. In some embodiments, the CD3-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 117, a heavy chain CDR2 comprising SEQ ID NO: 118, and a heavy chain CDR3 comprising SEQ ID NO: 119. In some embodiments, the CD3-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 117, a heavy chain CDR2 comprising SEQ ID NO: 118, a heavy chain CDR3 comprising SEQ ID NO: 119, a light chain CDR1 comprising SEQ ID NO: 123, a light chain CDR2 comprising SEQ ID NO: 124, and a light chain CDR3 comprising SEQ ID NO: 125. The CD3-binding arm may comprise human framework sequences. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 120. In some embodiments, the CD3-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 120 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 125. In some embodiments, the CD3-binding arm comprises a heavy chain substantially the same as, or identical to, SEQ ID NO: 121. In some embodiments, the CD3-binding arm comprises a heavy chain substantially the same as, or identical to, SEQ ID NO: 121 and a light chain substantially the same as, or identical to, SEQ ID NO: 126. In some embodiments, the CDRs of the heavy chain and / or the light chain are derived from known anti-CD3 antibodies, such as, for example, muromonab-CD3 (OKT3), otelixizumab (TRX4), teplizumab (MGA031), visilizumab (Nuvion), TR-66 or X35-3, VIT3, BMA030 (BW264 / 56), CLB-T3 / 3, CRIS7, YTH12.5, Fl 11-409, CLB-T3.4.2, TR-66, WT32, SPv-T3b, 11D8, XIII-141, XIII-46, XIII-87, 12F6, T3 / RW2-8C8, T3 / RW2-4B6, OKT3D, M-T301, SMC2, F101.01, UCHT-1 and WT-31. In some embodiments, the CD3-binding arm is IgG, or a derivative thereof. In some embodiments, the CD3-binding arm is IgGl, IgG2, IgG3, or IgG4. In some embodiments where in the CD3-binding arm has an IgG4 isotype, it contains S228P, L234A, L235A, F405L, and R409K substitution(s) in its Fc region. In some embodiments, the antibodies or antigen-binding fragments bind CD3s on primary human T cells. In some embodiments, the antibodies or antigen-binding fragments bind CD3s on primary cynomolgus T cells. In some embodiments, the antibodies or antigen-binding fragments bind CD3s on primary human and cynomolgus T cells. In some embodiments, the antibodies or antigen-binding fragments activate primary human CD3+ T cells. In some embodiments, the antibodies or antigen-binding fragments activate primary cynomolgus CD4+ T cells. In some embodiments, the trispecific antibodies described herein may adopt any format which has been described in the art for trispecific antibodies. In some embodiments, the trispecific antibodies described herein is constructed based on a bispecific antibody format. This can be achieved by adding a third antigen-binding arm to a bispecific antibody. Different formats of bispecific antibodies have been described and were recently reviewed by Chames and Baty (2009) Curr Opin Drug Disc Dev 12: 276. In some embodiments, the trispecific antibody comprises a bispecific antibody which is a diabody, a cross-body, or a bispecific antibody obtained via a controlled Fab arm exchange as those described in the present disclosure. In some embodiments, the trispecific antibodies include IgG-like molecules with complementary CH3 domains to force heterodimerization; recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; IgG fusion molecules, wherein full length IgG antibodies are fused to an extra Fab fragment or parts of Fab fragment; Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; Fab fusion molecules, wherein different Fab-fragments are fused together; ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, nanobodies) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, nanobodies) are fused to each other or to another protein or carrier molecule. In some embodiments, IgG-like molecules with complementary CH3 domains molecules include the Triomab / Quadroma (Trion Pharma / Fresenius Biotech), the Knobs-into-Holes (Genentech), CrossMAbs (Roche) and the electrostatically-matched (Amgen), the LUZ-Y (Genentech), the Strand Exchange Engineered Domain body (SEEDbody) (EMD Serono), the Biclonic (Merus),the DuoBody (Genmab A / S), and other asymmetric mutations (e.g., Zymeworks). In some embodiments, recombinant IgG-like dual targeting molecules include Dual Targeting (DT)-Ig (GSK / Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star) and CovX-body (CovX / Pfizer). In some embodiments, IgG fusion molecules include Dual Variable Domain (DVD)-Ig (Abbott), IgG-like Bispecific (InnClone / Eli Lilly), Ts2Ab (Medlmmune / AZ) and BsAb (Zymogenetics), HERCULES (Biogen Idee) and TvAb (Roche). In some embodiments, Fc fusion molecules include to ScFv / Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions / Trubion, Zymogenetics / BMS), Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics) and Dual(ScFv).sub.2-Fab (National Research Center for Antibody Medicine—China). In some embodiments, Fab fusion bispecific antibodies include F(ab)2 (Medarex / AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech). ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE) (Micromet), Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting nanobodies (Ablynx), dual targeting heavy chain only domain antibodies. Full length trispecific antibodies of the present disclosure may be generated for example using Fab arm exchange (or half molecule exchange) between two mono specific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression. The Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy-chain disulfide bonds in the hinge regions of the parent mono specific antibodies are reduced. The resulting free cysteines of one of the parent monospecific antibodies form an inter heavy-chain disulfide bond with cysteine residues of a second parent mono specific antibody molecule and simultaneously CH3 domains of the parent antibodies release and reform by dissociation-association. The CH3 domains of the Fab arms may be engineered to favor heterodimerization over homodimerization. The resulting product is a bispecific antibody having two Fab arms or half molecules which each bind a distinct epitope, e.g., an epitope on BCMA (or GPRC5D) and an epitope on CD3. A third antigen-binding arm can be then introduced to the bispecific antibody, for example, to the C-terminus of the first heavy chain or second heavy chain, which can bind to a third epitope, e.g., GPRC5D (or BCMA). "Homodimerization" as used herein refers to an interaction of two heavy chains having identical CH3 amino acid sequences. "Homodimer" as used herein refers to an antibody having two heavy chains with identical CH3 amino acid sequences. "Heterodimerization" as used herein refers to an interaction of two heavy chains having non-identical CH3 amino acid sequences. "Heterodimer" as used herein refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences. The "knob-in-hole" strategy (see, e.g., PCT Inti. Publ. No. WO 2006 / 028936) may be used to generate full length trispecific antibodies. Briefly, selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation. An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody binding a second antigen. After co-expression of the two antibodies, a heterodimer is formed as a result of the preferential interaction of the heavy chain with a "hole" with the heavy chain with a "knob". Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain / modified position in the second CH3 domain of the second heavy chain): T366Y / F405A, T366W / F405W, F405W / Y407A, T394W / Y407T, T394S / Y407A, T366W / T394S, F405W / T394S and T366W / T366S_L368A_Y407V. In some embodiments of the trispecific antibody or trispecific binding fragment described herein, one of the Fc domains comprise mutations T366S, L368A and Y407V and the other Fc domain comprises mutation T366W. In some embodiments, the Fc domain of the first heavy chain portion (HC1) of the first antigen binding arm (e.g., CD3 binding arm) comprises mutations T366S, L368A and Y407V, and the Fc domain of the second heavy chain portion (HC2) of the second antigen binding arm and / or third antigenbinding arm (e.g., the GPRC5D / BCMA binding arm, or BCMA binding arm) comprises mutation T366W. In some embodiments, the Fc domain of the HC2 of the second antigenbinding arm and / or third antigen-binding arm (e.g., the GPRC5D / BCMA binding arm, or BCMA binding arm) comprises mutations T366S, L368A and Y407V, and the Fc domain of the HC1 of the first antigen-binding arm (e.g., CD3 binding arm) comprises mutation T366W. Other strategies such as promoting heavy chain heterodimerization using electrostatic interactions by substituting positively charged residues at one CH3 surface and negatively charged residues at a second CH3 surface may be used, as described in US Pat. Publ. No. US2010 / 0015133; US Pat. Publ. No. US2009 / 0182127; US Pat. Publ. No. US2010 / 028637 or US Pat. Publ. No. US2011 / 0123532. In other strategies, heterodimerization may be promoted by the following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain / modified position in the second CH3 domain of the second heavy chain): L351Y_F405AY407V / T394W, T3 66I K3 92M T394W / F405A_Y407V, T3 66L_K3 92M_T3 94W / F405A_Y407V, L351Y_Y407A / T366A_K409F, L351Y_Y407A / T366V K409F Y407A / T366A_K409F, or T350V_L351Y_F405A Y407V / T350V_T366L_K392L_T394W as described in U.S. Pat. Publ. No. US2012 / 0149876 or U.S. Pat. Publ. No. US2013 / 0195849 (Zymeworks). In addition to methods described above, trispecific antibodies of the invention may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two mono specific homodimeric antibodies and forming the trispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Inti. Pat. Publ. No. W02011 / 131746. In the methods, the first monospecific bivalent antibody (e.g., anti- GPRC5D antibody) and the second monospecific bivalent antibody (e.g., anti-CD3 antibody) are engineered to have certain substitutions at the CH3 domain that promotes heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the trispecific antibody by Fab arm exchange. The incubation conditions may optimally be restored to non-reducing conditions. Exemplary reducing agents that may be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), di thioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol, preferably a reducing agent selected from the group consisting of 2-mercaptoethylamine, dithiothreitol and tris (2-carboxyethyl) phosphine. For example, incubation for at least 90 min at a temperature of at least 20° C in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used. In some embodiments, the trispecific antibodies or antigen-binding fragments are IgG, or derivatives thereof. The IgG class is divided in four isotypes: IgGl, IgG2, IgG3 and IgG4 in humans. They share more than 95% homology in the amino acid sequences of the Fc regions but show major differences in the amino acid composition and structure of the hinge region. The Fc region mediates effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the Fc region of an antibody binds to Fc receptors (FcyRs) on the surface of immune effector cells such as natural killers and macrophages, leading to the phagocytosis or lysis of the targeted cells. In CDC, the antibodies kill the targeted cells by triggering the complement cascade at the cell surface. The antibodies described herein include antibodies with the described features of the variable domains in combination with any of the IgG isotypes, including modified versions in which the Fc sequence has been modified to effect different effector functions. For many applications of therapeutic antibodies, Fc-mediated effector functions are not part of the mechanism of action. These Fc-mediated effector functions can be detrimental and potentially pose a safety risk by causing off-mechanism toxicity. Modifying effector functions can be achieved by engineering the Fc regions to reduce their binding to FcyRs or the complement factors. The binding of IgG to the activating (FcyRI, FcyRIIa, FcyRIIIa and FcyRIIIb) and inhibitory (FcyRIIb) FcyRs or the first component of complement (Clq) depends on residues located in the hinge region and the CH2 domain. Mutations have been introduced in IgGl, IgG2 and IgG4 to reduce or silence Fc functionalities. The antibodies described herein may include these modifications. In one embodiment, the antibody comprises an Fc region with one or more of the following properties: (a) reduced effector function when compared to the parent Fc; (b) reduced affinity to FcyRI, FcyRIIa, FcyRIIb, FcyRIIIb and / or FcyRIIIa, (c) reduced affinity to FcyRI (d) reduced affinity to FcyRIIa (e) reduced affinity to FcyRIIb, (f) reduced affinity to FcyRIIIb or (g) reduced affinity to FcyRIIIa. In some embodiments, the antibodies or antigen-binding fragments are IgG, or derivatives thereof, e.g., IgGl, IgG2, IgG3, and IgG4 isotypes. In some embodiments wherein the antibody has an IgGl isotype, the antibody contains L234A, L235A, D265S and / or K409R substitution(s) in its Fc region. In some embodiments wherein the antibody has an IgG4 isotype, the antibody contains S228P, L234A, and L235A substitutions in its Fc region. The antibodies described herein may include these modifications. In some embodiments, the Fc domains of a multispecific antibody described herein each comprise one or more mutations selected from L234A, L235A, and D265S. In some embodiments, the Fc domains of HC1 and HC2 each comprise mutations L234A, L235A, and D265S. In some embodiments, the Fc domain of one of the heavy chain portions of a multispecific antibody described herein further comprise one or more mutations which reduce Fc binding to protein A. In some embodiments, the Fc domains of one of the heavy chain portions comprises mutations H435R and / or Y436F. In some embodiments, the Fc domain of the HC2 of the second antigen-binding arm and / or third antigen-binding arm (e.g., GPRC5D / BCMA binding arm, or BCMA binding arm) comprises mutations H435R and / or Y436F. In various embodiments, the third antigen-binding arm is operatively linked to Fc domains of the first antigen-binding arm or second antigen-binding arm via a linker. In some embodiments, the linker is a peptide linker and may include any naturally occurring amino acid. Exemplary amino acids that may be included into the linker are Gly, Ser Pro, Thr, Glu, Lys, Arg, He, Leu, His and The. The linker should have a length that is adequate to link the third antigen-binding arm and the first antigen-binding arm or the second antigenbinding arm in such a way that they form the correct conformation relative to one another so that they retain the desired activity, such as binding to a third antigen (e.g., BCMA or GPRC5D). In some embodiments of a trispecific antibody described herein, the HC1 comprises, from the N- to C-terminus, the VH1 of the first antigen-binding arm, a CHI domain, the Fc domain, a linker, and the third antigen-binding arm. In some embodiments of a trispecific antibody described herein, the HC2 comprises, from the N-to C-terminus, the second antigen-binding arm, the Fc domain, a linker, and the third antigen-binding arm. In various embodiments, the scFvs used in multispecific antibodies described herein comprise, from the N- to C-terminus, a VH, a linker and a VL (VH-L-VL) or the VL, the linker and the VH (VL-L-VH). In some embodiments, the scFv comprises, from the N- to C-terminus, the VL, the linker and the VH (VL-L-VH). In some embodiments, the scFv comprises, from the N- to C-terminus, the VH, the linker, and the VL (VH-L-VL). The linker may be about 5-50 amino acids long. In some embodiments, the linker is about 10-40 amino acids long. In some embodiments, the linker is about 10-35 amino acids long. In some embodiments, the linker is about 10-30 amino acids long. In some embodiments, the linker is about 10-25 amino acids long. In some embodiments, the linker is about 10-20 amino acids long. In some embodiments, the linker is about 15-20 amino acids long. In some embodiments, the linker is 6 amino acids long. In some embodiments, the linker is 7 amino acids long. In some embodiments, the linker is 8 amino acids long. In some embodiments, the linker is 9 amino acids long. In some embodiments, the linker is 10 amino acids long. In some embodiments, the linker is 11 amino acids long. In some embodiments, the linker is 12 amino acids long. In some embodiments, the linker is 13 amino acids long. In some embodiments, the linker is 14 amino acids long. In some embodiments, the linker is 15 amino acids long. In some embodiments, the linker is 16 amino acids long. In some embodiments, the linker is 17 amino acids long. In some embodiments, the linker is 18 amino acids long. In some embodiments, the linker is 19 amino acids long. In some embodiments, the linker is 20 amino acids long. In some embodiments, the linker is 21 amino acids long. In some embodiments, the linker is 22 amino acids long. In some embodiments, the linker is 23 amino acids long. In some embodiments, the linker is 24 amino acids long. In some embodiments, the linker is 25 amino acids long. In some embodiments, the linker is 26 amino acids long. In some embodiments, the linker is 27 amino acids long. In some embodiments, the linker is 28 amino acids long. In some embodiments, the linker is 29 amino acids long . In some embodiments, the linker is 30 amino acids long. In some embodiments, the linker is 31 amino acids long. In some embodiments, the linker is 32 amino acids long. In some embodiments, the linker is 33 amino acids long. In some embodiments, the linker is 34 amino acids long. In some embodiments, the linker is 35 amino acids long. In some embodiments, the linker is 36 amino acids long. In some embodiments, the linker is 37 amino acids long. In some embodiments, the linker is 38 amino acids long. In some embodiments, the linker is 39 amino acids long. In some embodiments, the linker is 40 amino acids long. Exemplary linkers that may be used are Gly rich linkers, Gly and Ser containing linkers, Gly and Ala containing linkers, Ala and Ser containing linkers, and other flexible linkers. Other linker sequences may include portions of immunoglobulin hinge area, CL or CHI derived from any immunoglobulin heavy or light chain isotype. Exemplary linkers that may be used are shown in Table 4. Additional linkers are described for example in Int. Pat. Publ. No. WO2019 / 060695. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 25. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 163. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 127. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 128. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 129. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 130. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 131. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 132. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 133. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 134. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 135. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 136. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 137. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 138. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 139. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 140. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 141. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 142. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 143. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 144. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 145. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 146. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 147. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 148. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 149. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 150. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 151. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 152. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 153. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 154. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 155. In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 156. 5         In some embodiments, the linker comprises the amino acid sequence of SEQ ID NO: 157. Table 4. Exemplary linker sequences Linker name Amino acid sequence SEQ ID NO: Linker 1 GGSEGKSSGSGSESKSTGGS 25 Linker 2 GGGSGGGS 127 Linker 3 GGGSGGGSGGGS 128 Linker 4 GGGSGGGSGGGSGGGS 129 Linker 5 GGGSGGGSGGGSGGGSGGGS 130 Linker 6 GGGGSGGGGSGGGGS 131 Linker 7 GGGGSGGGGSGGGGSGGGGS 163 Linker 8 GGGGSGGGGSGGGGSGGGGSGGGGS 132 Linker 9 GSTSGSGKPGSGEGSTKG 133 Linker 10 IRPRAIGGSKPRVA 134 Linker 11 GKGGSGKGGSGKGGS 135 Linker 12 GGKGSGGKGSGGKGS 136 Linker 13 GGGKSGGGKSGGGKS 137 Linker 14 GKGKSGKGKSGKGKS 138 Linker 15 GGGKSGGKGSGKGGS 139 Linker 16 GKPGSGKPGSGKPGS 140 Linker 17 GKPGSGKPGSGKPGSGKPGS 141 Linker 18 GKGKSGKGKSGKGKSGKGKS 142 Linker 19 STAGDTHLGGEDFD 143 Linker 20 GEGGSGEGGSGEGGS 144 Linker 21 GGEGSGGEGSGGEGS 145 Linker 22 GEGESGEGESGEGES 146 Linker 23 GGGESGGEGSGEGGS 147 Linker 24 GEGESGEGESGEGESGEGES 148 Linker 25 GSTSGSGKPGSGEGSTKG 149 Linker 26 PRGASKSGSASQTGSAPGS 150 Linker 27 GTAAAGAGAAGGAAAGAAG 151 Linker 28 GTSGSSGSGSGGSGSGGGG 152 Linker 29 GKPGSGKPGSGKPGSGKPGS 153 Linker 30 GSGS 154 Linker 31 APAPAPAPAP 155 Linker 32 APAPAPAPAPAPAPAPAPAP 156 Linker 33 AEAAAKEAAAKEAAAAKEAAAAKEAAAAKAAA 157 In one embodiment, the HC1 of a BCMA x GPRC5D x CD3 trispecific antibody comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 26. In one embodiment, the LC of a BCMA x GPRC5D x CD3 trispecific antibody comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 27. In one embodiment, the GPRC5D / BCMA binding arm of a BCMA x GPRC5D x CD3 trispecific antibody comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 28. In one embodiment, a CD3 / GPRC5D coupled HC1 of a BCMA x GPRC5D x CD3 trispecific antibody comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29. In one embodiment, the LC of a BCMA x GPRC5D x CD3 trispecific antibody comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 30. In one embodiment, the BCMA binding arm comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 31. In one embodiment, provided herein is an isolated trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a CD3 binding arm comprising a heavy chain (HC1) and a light chain (LC); and b) a GPRC5D / BCMA binding arm, wherein HC1 comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 26, LC comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 27, and the GPRC5D / BCMA binding arm comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 28. In one embodiment, provided herein is an isolated trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a CD3 binding arm comprising a heavy chain (HC1) and a light chain (LC); and b) a GPRC5D / BCMA binding arm, wherein HC1 comprises the amino acid sequence of SEQ ID NO: 26, LC comprises the amino acid sequence of SEQ ID NO: 27, and the GPRC5D / BCMA binding arm comprises the amino acid sequence of SEQ ID NO: 28. In one embodiment, provided herein is an isolated trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a CD3 binding arm comprising a heavy chain (HC1) and a light chain (LC), wherein the HC1 further comprises the GPRC5D binding arm; and b) a BCMA binding arm, wherein HC1 comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29, LC comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 30, and the BCMA binding arm comprises an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 31. In one embodiment, provided herein is an isolated trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a CD3 binding arm comprising a heavy chain (HC1) and a light chain (LC), wherein the HC1 further comprises the GPRC5D binding arm; and b) a BCMA binding arm, wherein HC1 comprises the amino acid sequence of SEQ ID NO: 29, LC comprises the amino acid sequence of SEQ ID NO: 30, and the BCMA binding arm comprises the amino acid sequence of SEQ ID NO: 31. In one embodiment, the BCMA x GPRC5D x CD3 trispecific antibody is BGCB463. In one embodiment, the BCMA x GPRC5D x CD3 trispecific antibody is BGCB491. In addition to the described BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments, also provided are polynucleotide sequences capable of encoding the described BCMA x GPRC5D x CD3-multispecific antibodies or antigenbinding fragments. Vectors comprising the described polynucleotides are also provided, as are cells expressing the BCMA x GPRC5D x CD3-multispecific antibodies or antigenbinding fragments provided herein. Also described are cells capable of expressing the disclosed vectors. These cells may be mammalian cells (such as 293F cells, CHO cells), insect cells (such as Sf7 cells), yeast cells, plant cells, or bacteria cells (such as E. coli). The described antibodies may also be produced by hybridoma cells. The described antibodies may also be recombinantly produced. Polynucleotides encoding recombinant antigen-binding proteins also are within the scope of the disclosure. In some embodiments, the polynucleotides described (and the peptides they encode) include a leader sequence. Any leader sequence known in the art may be employed. The leader sequence may include, but is not limited to, a restriction site or a translation start site. The BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments described herein include variants having single or multiple amino acid substitutions, deletions, or additions that retain the biological properties (e.g., binding affinity or immune effector activity) of the described BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments. In the context of the present invention the following notations are, unless otherwise indicated, used to describe a mutation; i) substitution of an amino acid in a given position is written as e.g. K409R which means a substitution of a Lysine in position 409 with an Arginine; and ii) for specific variants the specific three or one letter codes are used, including the codes Xaa and X to indicate any amino acid residue. Thus, the substitution of Arginine for Lysine in position 409 is designated as: K409R, or the substitution of any amino acid residue for Lysine in position 409 is designated as K409X. In case of deletion of Lysine in position 409 it is indicated by K409*. The skilled person may produce variants having single or multiple amino acid substitutions, deletions, or additions. These variants may include: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like. Antibodies or antigen-binding fragments described herein may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In other embodiments, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues. The techniques for obtaining these variants, including genetic (deletions, mutations, etc.), chemical, and enzymatic techniques, are known to persons having ordinary skill in the art. The BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments described herein may embody several antibody isotypes, such as IgM, IgD, IgG, IgA and IgE. In some embodiments the antibody isotype is IgGl, IgG2, IgG3, or IgG4 isotype, preferably IgGl or IgG4 isotype. Antibody or antigen-binding fragment thereof specificity is largely determined by the amino acid sequence, and arrangement, of the CDRs. Therefore, the CDRs of one isotype may be transferred to another isotype without altering antigen specificity. Alternatively, techniques have been established to cause hybridomas to switch from producing one antibody isotype to another (isotype switching) without altering antigen specificity. Accordingly, such antibody isotypes are within the scope of the described antibodies or antigen-binding fragments. The BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments described herein may have ICso values of at least 5.9 nM for APRIL binding. The ICso of the described BCMA x GPRC5D x CD3-multispecific antibodies, or antigenbinding fragments, may be determined by a variety of methods known in the art, such as ELISA-based methods or flow cytometry (FACS). Assays for measuring IC50 by ELISA have plate-bound BCMA in the presence and absence of a BCMA x GPRC5D x CD3-multispecific antibody, or antigen-binding fragment, and varying concentrations of the APRIL are used. A BCMA x GPRC5D x CD3-multispecific antibody, or antigen-binding fragment, that blocks the binding of APRIL to BCMA is to “block APRIL as measured by ELISA” Also provided are vectors comprising the polynucleotides described herein. The vectors can be expression vectors. Recombinant expression vectors containing a sequence encoding a polypeptide of interest are thus contemplated as within the scope of this disclosure. The expression vector may contain one or more additional sequences such as but not limited to regulatory sequences (e.g., promoter, enhancer), a selection marker, and a polyadenylation signal. Vectors for transforming a wide variety of host cells are well known and include, but are not limited to, plasmids, phagemids, cosmids, baculoviruses, bacmids, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), as well as other bacterial, yeast and viral vectors. Recombinant expression vectors within the scope of the description include synthetic, genomic, or cDNA-derived nucleic acid fragments that encode at least one recombinant protein which may be operably linked to suitable regulatory elements. Such regulatory elements may include a transcriptional promoter, sequences encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. Expression vectors, especially mammalian expression vectors, may also include one or more nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, other 5' or 3' flanking nontranscribed sequences, 5' or 3' nontranslated sequences (such as necessary ribosome binding sites), a polyadenylation site, splice donor and acceptor sites, or transcriptional termination sequences. An origin of replication that confers the ability to replicate in a host may also be incorporated. The transcriptional and translational control sequences in expression vectors to be used in transforming vertebrate cells may be provided by viral sources. Exemplary vectors may be constructed as described by Okayama and Berg, 3 Mol. Cell. Biol. 280 (1983). In some embodiments, the multispecific antibody- or antigen-binding fragmentcoding sequence is placed under control of a powerful constitutive promoter, such as the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin, human myosin, human hemoglobin, human muscle creatine, and others. In addition, many viral promoters function constitutively in eukaryotic cells and are suitable for use with the described embodiments. Such viral promoters include without limitation, Cytomegalovirus (CMV) immediate early promoter, the early and late promoters of SV40, the Mouse Mammary Tumor Virus (MMTV) promoter, the long terminal repeats (LTRs) of Maloney leukemia virus, Human Immunodeficiency Virus (HIV), Epstein Barr Virus (EBV), Rous Sarcoma Virus (RSV), and other retroviruses, and the thymidine kinase promoter of Herpes Simplex Virus. In one embodiment, the BCMA x GPRC5D x CD3-multispecific antibody or antigen-binding fragment thereof coding sequence is placed under control of an inducible promoter such as the metallothionein promoter, tetracycline-inducible promoter, doxycycline-inducible promoter, promoters that contain one or more interferon-stimulated response elements (ISRE) such as protein kinase R 2',5'-oligoadenylate synthetases, Mx genes, AD ARI, and the like. Vectors described herein may contain one or more Internal Ribosome Entry Site(s) (IRES). Inclusion of an IRES sequence into fusion vectors may be beneficial for enhancing expression of some proteins. In some embodiments the vector system will include one or more polyadenylation sites (e.g., SV40), which may be upstream or downstream of any of the aforementioned nucleic acid sequences. Vector components may be contiguously linked, or arranged in a manner that provides optimal spacing for expressing the gene products (i.e., by the introduction of “spacer” nucleotides between the ORFs), or positioned in another way. Regulatory elements, such as the IRES motif, may also be arranged to provide optimal spacing for expression. The vectors may comprise selection markers, which are well known in the art. Selection markers include positive and negative selection markers, for example, antibiotic resistance genes (e.g., neomycin resistance gene, a hygromycin resistance gene, a kanamycin resistance gene, a tetracycline resistance gene, a penicillin resistance gene, a puromycin resistance gene, a blasticidin resistance gene), glutamate synthase genes, HSV-TK, HSV-TK derivatives for ganciclovir selection, or bacterial purine nucleoside phosphorylase gene for 6-methylpurine selection (Gadi et al., 7 Gene Ther. 1738-1743 (2000)). A nucleic acid sequence encoding a selection marker or the cloning site may be upstream or downstream of a nucleic acid sequence encoding a polypeptide of interest or cloning site. The vectors described herein may be used to transform various cells with the genes encoding the described antibodies or antigen-binding fragments. For example, the vectors may be used to generate BCMA x GPRC5D x CD3-multispecific antibody or antigenbinding fragment-producing cells. Thus, another aspect features host cells transformed with vectors comprising a nucleic acid sequence encoding an antibody or antigen-binding fragment thereof that binds BCMA, GPRC5D, and CD3, such as the antibodies or antigenbinding fragments described and exemplified herein. Numerous techniques are known in the art for the introduction of foreign genes into cells and may be used to construct the recombinant cells for purposes of carrying out the described methods, in accordance with the various embodiments described and exemplified herein. The technique used should provide for the stable transfer of the heterologous gene sequence to the host cell, such that the heterologous gene sequence is heritable and expressible by the cell progeny, and so that the necessary development and physiological functions of the recipient cells are not disrupted. Techniques which may be used include but are not limited to chromosome transfer (e.g., cell fusion, chromosome mediated gene transfer, micro cell mediated gene transfer), physical methods (e.g., transfection, spheroplast fusion, microinjection, electroporation, liposome carrier), viral vector transfer (e.g., recombinant DNA viruses, recombinant RNA viruses) and the like (described in Cline, 29 Pharmac. Ther. 69-92 (1985)). Calcium phosphate precipitation and polyethylene glycol (PEG)-induced fusion of bacterial protoplasts with mammalian cells may also be used to transform cells. Cells suitable for use in the expression of the BCMA x GPRC5D x CD3-multispecific antibodies or antigen-binding fragments described herein are preferably eukaryotic cells, more preferably cells of plant, rodent, or human origin, for example but not limited to NSO, CHO, CHOK1, perC.6, Tk-tsl3, BHK, HEK293 cells, COS-7, T98G, CV-l / EBNA, L cells, C127, 3T3, HeLa, NS1, Sp2 / 0 myeloma cells, and BHK cell lines, among others. In addition, expression of antibodies may be accomplished using hybridoma cells. Methods for producing hybridomas are well established in the art. Cells transformed with expression vectors described herein may be selected or screened for recombinant expression of the antibodies or antigen-binding fragments described herein. Recombinant-positive cells are expanded and screened for subclones exhibiting a desired phenotype, such as high level expression, enhanced growth properties, or the ability to yield proteins with desired biochemical characteristics, for example, due to protein modification or altered post-translational modifications. These phenotypes may be due to inherent properties of a given subclone or to mutation. Mutations may be effected through the use of chemicals, UV-wavelength light, radiation, viruses, insertional mutagens, inhibition of DNA mismatch repair, or a combination of such methods. Therapeutic composition and methods of treatment using multispecific antibodies and multispecific antigen-binding fragments thereof The multispecific antibodies discussed above, for example the BCMA x GPRC5D x CD3 trispecific antibodies discussed above, are useful in therapy. In particular, the multispecific antibodies are useful in treating cancer. Also provided herein are therapeutic compositions for the treatment of a hyperproliferative disorder in a mammal which comprises a therapeutically effective amount of a multispecific antibody or multispecific antigen-binding fragment described herein and a pharmaceutically acceptable carrier. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. In one embodiment said pharmaceutical composition is for the treatment of a GPRC5D and / or BCMA-expressing cancer, including (but not limited to) the following: GPRC5D and / or BCMA-expressing B cell cancers, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM); and other cancers yet to be determined in which GPRC5D and / or BCMA is expressed. In some embodiments, the GPRC5D and / or BCMA -expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. Particular trispecific antibodies that may be used to treat cancer, such as hematological cancer, including the specific cancers discussed above, include antibodies BGCB463, and BGCB491. In some embodiments, the BCMA x GPRC5D x CD3 trispecific antibody or binding fragment thereof is utilized for the treatment of R / R multiple myeloma. In some embodiments, the subject receiving the BCMA x GPRC5D x CD3 trispecific antibody or binding fragment thereof has received a prior treatment. For example, the subject may have received one or more therapeutics, such as proteasome inhibitors (Pls) (e.g., Marizomib (salinosporamide A), Carfilzomib, Ixazomib), immunomodulatory drugs (IMiDs), bispecific agents, CAR-T therapies, and / or anti-CD38 antibodies, for treating multiple myeloma. The pharmaceutical compositions provided herein comprise: a) an effective amount of a multispecific antibody or antibody fragment of the present invention, and b) a pharmaceutically acceptable carrier, which may be inert or physiologically active. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. As used herein, the term "pharmaceutically acceptable carriers" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, and the like that are physiologically compatible. Examples of suitable carriers, diluents and / or excipients include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like, as well as any combination thereof. In many cases, it will be preferable to include isotonic agents, such as sugars, polyalcohols, or sodium chloride in the composition. In particular, relevant examples of suitable carrier include: (1) Dulbecco's phosphate buffered saline, pH.about.7.4, containing or not containing about 1 mg / mL to 25 mg / mL human serum albumin, (2) 0.9% saline (0.9% w / v sodium chloride (NaCl)), and (3) 5% (w / v) dextrose; and may also contain an antioxidant such as tryptamine and a stabilizing agent such as Tween 20®. The compositions herein may also contain a further therapeutic agent, as necessary for the particular disorder being treated. Preferably, the multispecific antibody or antibody fragment and the supplementary active compound will have complementary activities that do not adversely affect each other. In some embodiments, the further therapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2. In some embodiments, the further therapeutic agent is a chemotherapeutic agent, an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof. In some embodiments, the further therapeutic agent is an anti-CD38 agent, such as an anti-CD38 antibody (e.g., daratumumab). In some embodiments, the further therapeutic agent is an immunomodulatory imide drug (IMiD), such as lenalidomide, and pomalidomide. In some embodiments, the further therapeutic agent is an immune checkpoint inhibitor such as anti-PD-1 and anti T cell immunoreceptor with Ig and ITIM domains (TIGIT). In some embodiments, the further therapeutic agent is an immune co-stimulating agent, such as agents targeting CD 137 (e.g., CD 137 costimulatory bispecific antibody). In some embodiments, the further therapeutic agent is a T-cell enhancer, such as IL-2 addition. The compositions of the invention may be in a variety of forms. These include for example liquid, semi-solid, and solid dosage forms, but the preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions. The preferred mode of administration is parenteral (e.g. intravenous, intramuscular, intraperitoneal, subcutaneous). In a preferred embodiment, the compositions of the invention are administered intravenously as a bolus or by continuous infusion over a period of time. In another preferred embodiment, they are injected by intramuscular, subcutaneous, intraarticular, intrasynovial, intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. Sterile compositions for parenteral administration can be prepared by incorporating the antibody, antibody fragment or antibody conjugate of the present invention in the required amount in the appropriate solvent, followed by sterilization by microfiltration. As solvent or vehicle, there may be used water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like, as well as combination thereof. In many cases, it will be preferable to include isotonic agents, such as sugars, polyalcohol’s, or sodium chloride in the composition. These compositions may also contain adjuvants, in particular wetting, isotonizing, emulsifying, dispersing and stabilizing agents. Sterile compositions for parenteral administration may also be prepared in the form of sterile solid compositions which may be dissolved at the time of use in sterile water or any other injectable sterile medium. The multispecific antibody or antibody fragment may also be orally administered. As solid compositions for oral administration, tablets, pills, powders (gelatin capsules, sachets) or granules may be used. In these compositions, the active ingredient according to the invention is mixed with one or more inert diluents, such as starch, cellulose, sucrose, lactose or silica, under an argon stream. These compositions may also comprise substances other than diluents, for example one or more lubricants such as magnesium stearate or talc, a coloring, a coating (sugar-coated tablet) or a glaze. As liquid compositions for oral administration, there may be used pharmaceutically acceptable solutions, suspensions, emulsions, syrups and elixirs containing inert diluents such as water, ethanol, glycerol, vegetable oils or paraffin oil. These compositions may comprise substances other than diluents, for example wetting, sweetening, thickening, flavoring or stabilizing products. The doses depend on the desired effect, the duration of the treatment and the route of administration used; they are generally between 5 mg and 1000 mg per day orally for an adult with unit doses ranging from 1 mg to 250 mg of active substance. In general, the doctor will determine the appropriate dosage depending on the age, weight and any other factors specific to the subject to be treated. Also provided herein are methods for killing a GPRC5D and / or BCMA + cell by administering to a patient in need thereof a multispecific antibody which binds said GPRC5D and / or BCMA and is able to recruit T cells to kill said GPRC5D and / or BCMA + cell (i.e., T cell redirection). Any of the multispecific antibodies or antibody fragments of the invention may be used therapeutically. For example, in one embodiment the BCMA x GPRC5D x CD3-multispecific antibody may be used therapeutically to treat cancer in a subject. In a preferred embodiment, multispecific antibodies or antibody fragments of the invention are used for the treatment of a hyperproliferative disorder in a mammal. In a more preferred embodiment, one of the pharmaceutical compositions disclosed above, and which contains a multispecific antibody or antibody fragment of the invention, is used for the treatment of a hyperproliferative disorder in a mammal. In one embodiment, the disorder is a cancer. In particular, the cancer is a GPRC5D and / or BCMA-expressing cancer, including (but not limited to) the following: GPRC5D and / or BCMA-expressing B-cell cancers, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM); and other cancers yet to be determined in which GPRC5D and / or BCMA is expressed. In some embodiments, the GPRC5D and / or BCMA -expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigenbinding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-triispecific antigen-binding fragment thereof. Accordingly, the pharmaceutical compositions of the invention are useful in the treatment or prevention of a variety of cancers or disorders, including (but not limited to) the following: a GPRC5D and / or BCMA -expressing cancer, including (but not limited to) the following: GPRC5D and / or BCMA -expressing B / Plasma cell cancers, such as acute multiple myeloma (MM) or premalignant myelomas such as MGUS (Monoclonal Gammopathy of Undetermined Significance) and SMM (Smoldering Multiple myeloma) and plasmacytoma; and other cancers yet to be determined in which GPRC5D and / or BCMA is expressed, or other plasma cell disorders such as amyloidosis and lupus. In some embodiments, the GPRC5D and / or BCMA -expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. Similarly, further provided herein is a method for inhibiting the growth of selected cell populations comprising contacting GPRC5D and / or BCMA-expressing target cells, or tissue containing such target cells, with an effective amount of a multispecific antibody or antibody fragment of the present invention, either alone or in combination with other cytotoxic or therapeutic agents, in the presence of a peripheral blood mononuclear cell (PBMC). A BCMAxGPRC5DxCD3 antibody that blocks the binding of ligands (APIL, BAFF and others) to BCMA and GPRC5D may block BCMA- and GPRC5D- mediated signaling and lead to inhibition or cell death of the target cells. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. In some embodiments, the methods described herein involving the administration of a multispecific antibody or pharmaceutical composition comprising the same, further involve administering another therapeutic agent. Suitable other therapeutic agents include, without limitation, an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer (e.g., IL-2 addition), tocilizumab, or any combination thereof. In some embodiments, the further therapeutic agent is an anti-CD38 agent, such as an anti-CD38 antibody (e.g., daratumumab). In some embodiments, the further therapeutic agent is an immunomodulatory imide drug (IMiD), such as lenalidomide, and pomalidomide. In some embodiments, the further therapeutic agent is an immune checkpoint inhibitor such as anti-PD-1 and anti-T cell immunoreceptor with Ig and ITIM domains (TIGIT). In some embodiments, the further therapeutic agent is an immune co-stimulating agent, such as agents targeting CD137 (e.g., CD137 costimulatory bispecific antibody). The use of a low-affinity CD137 binder with conditional agonism in the presence of a T cell-redirecting antibody like the BCMA x GPRC5D x CD3 trispecific antibody described herein could enhance antitumor activity and potentially improve T cell persistence. In some embodiments, the further therapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2. In some embodiments, the further therapeutic agent is a chemotherapeutic agent. The method for inhibiting the growth of selected cell populations can be practiced in vitro, in vivo, or ex vivo. Examples of in vitro uses include treatments of autologous bone marrow prior to their transplant into the same patient in order to kill diseased or malignant cells; and prevent graft-versus-host-disease (GVHD); treatments of cell cultures in order to kill all cells except for desired variants that do not express the target antigen; or to kill variants that express undesired antigen. The conditions of non-clinical in vitro use are readily determined by one of ordinary skill in the art. Examples of clinical ex vivo use are to remove tumor cells from bone marrow prior to autologous transplantation in cancer treatment. Treatment can be carried out as follows. Bone marrow is harvested from the patient or other individual and then incubated in medium containing serum to which is added the cytotoxic agent of the invention. Concentrations range from about 10 pM to 1 pM, for about 30 min to about 48 hr at about 37 °C. The exact conditions of concentration and time of incubation, i.e., the dose, are readily determined by one of ordinary skill in the art. After incubation the bone marrow cells are washed with medium containing serum and returned to the patient by i.v. infusion according to known methods. In circumstances where the patient receives other treatment such as a course of ablative chemotherapy or total-body irradiation between the time of harvest of the marrow and reinfusion of the treated cells, the treated marrow cells are stored frozen in liquid nitrogen using standard medical equipment. For clinical in vivo use, a therapeutically effective amount of the multispecific antibody or antigen-binding fragment is administered to a subject in need thereof. For example, the BCMA x GPRC5D x CD3-multispecific antibodies and multispecific antigen-binding fragments thereof may be useful in the treatment of a GPRC5D and / or BCMA-expressing cancer in a subject in need thereof. In some embodiments, the GPRC5D and / or BCMA-expressing cancer is a B-cell cancer, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM). In some embodiments, the GPRC5D and / or BCMA -expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. In some embodiments, the subject is a mammal, preferably a human. In some embodiments, the multispecific antibody or antigen-binding fragment will be administered as a solution that has been tested for sterility. Dosage regimens in the above methods of treatment and uses are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage. The efficient dosages and the dosage regimens for the multispecific antibodies and fragments depend on the disease or condition to be treated and may be determined by one skilled in the art. An exemplary, non-limiting range for a therapeutically effective amount of a compound of the present invention is about 0.001-10 mg / kg, such as about 0.001-5 mg / kg, for example about 0.001-2 mg / kg, such as about 0.001-1 mg / kg, for instance about 0.001, about 0.01, about 0.1, about 1 or about 10 mg / kg. A physician, pharmacist or veterinarian having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the multispecific antibody or fragment employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable daily dose of a multispecific antibody of the present invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect. Administration may e.g. be parenteral, such as intravenous, intramuscular, intratumoral (e.g., bone marrow) or subcutaneous. In one embodiment, the multispecific antibody or fragment may be administered by infusion in a weekly dosage of calculated by mg / m2. Such dosages can, for example, be based on the mg / kg dosages provided above according to the following: dose (mg / kg)x body weight (e.g., 50 - 100 kg). Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times. The administration may be performed by continuous infusion over a period of from 2 to 24 hr, such as of from 2 to 12 hr. In one embodiment, the multispecific antibody or fragment may be administered by slow continuous infusion over a long period, such as more than 24 hours, in order to reduce toxic side effects. In one embodiment, the multispecific antibody or fragment may be administered in a weekly dosage of calculated as a fixed dose for up to eight times, such as from four to six times when given once a week. Such regimen may be repeated one or more times as necessary, for example, after six months or twelve months. Such fixed dosages can, for example, be based on the mg / kg dosages provided above, with a body weight estimate of 50- 100 kg. The dosage may be determined or adjusted by measuring the amount of multispecific antibody of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the GPRC5D and / or BCMA antigen binding arms of the multispecific antibodies of the present invention. In one embodiment, the multispecific antibody or fragment may be administered by maintenance therapy, such as, e.g., once a week for a period of six months or more. A multispecific antibody or fragment may also be administered prophylactically in order to reduce the risk of developing cancer, delay the onset of the occurrence of an event in cancer progression, and / or reduce the risk of recurrence when a cancer is in remission. The multispecific antibodies and fragments thereof as described herein may also be administered in combination therapy, i.e., combined with other therapeutic agents relevant for the disease or condition to be treated. Accordingly, in one embodiment, the antibodycontaining medicament is for combination with one or more further therapeutic agent, such as a chemotherapeutic agent an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer (e.g., IL-2 addition), or any combination thereof. In some embodiments, the further therapeutic agent is an anti-CD38 agent, such as an anti-CD38 antibody (e.g., daratumumab). In some embodiments, the further therapeutic agent is an immunomodulatory imide drug (IMiD), such as lenalidomide, and pomalidomide. In some embodiments, the further therapeutic agent is an immune checkpoint inhibitor such as anti-PD-1 and anti-T cell immunoreceptor with Ig and ITIM domains (TIGIT). In some embodiments, the further therapeutic agent is an immune co-stimulating agent, such as agents targeting CD137 (e.g., CD137 costimulatory bispecific antibody). In some embodiments, the other therapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2. Such combined administration may be simultaneous, separate or sequential, in any order. For simultaneous administration the agents may be administered as one composition or as separate compositions, as appropriate. In one embodiment, a method for treating a disorder involving cells expressing GPRC5D and / or BCMA in a subject, which method comprises administration of a therapeutically effective amount of a multispecific antibody or fragment, such as a BCMA x GPRC5D x CD3 multispecific antibody described herein, and radiotherapy to a subject in need thereof is provided. In one embodiment is provided a method for treating or preventing cancer, which method comprises administration of a therapeutically effective amount of a multispecific antibody or fragment, such as a BCMA x GPRC5D x CD3 antibody described herein, and radiotherapy to a subject in need thereof. Radiotherapy may comprise radiation or associated administration of radiopharmaceuticals to a patient is provided. The source of radiation may be either external or internal to the patient being treated (radiation treatment may, for example, be in the form of external beam radiation therapy (EBRT) or brachytherapy (BT)). Radioactive elements that may be used in practicing such methods include, e.g., radium, cesium-137, iridium-192, americium-241, gold-198, cobalt-57, copper-67, technetium-99, iodide-123, iodide-131, actinium-225, and indium-111. Kits Also provided herein are includes kits, e.g., comprising a described multispecific antibody or antigen-binding fragment thereof and instructions for the use of the antibody or fragments for killing of particular cell types. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. The instructions may include directions for using the multispecific antibody or antigen-binding fragment thereof in vitro, in vivo or ex vivo. Typically, the kit will have a compartment containing the multispecific antibody or antigen-binding fragment thereof. The multispecific antibody or antigen-binding fragment thereof may be in a lyophilized form, liquid form, or other form amendable to being included in a kit. The kit may also contain additional elements needed to practice the method described on the instructions in the kit, such a sterilized solution for reconstituting a lyophilized powder, additional agents for combining with the multispecific antibody or antigen-binding fragment thereof prior to administering to a patient, and tools that aid in administering the multispecific antibody or antigen-binding fragment thereof to a patient. Diagnostic Uses The multispecific antibodies and fragments described herein may also be used for diagnostic purposes. Thus, also provided are diagnostic compositions comprising a multispecific antibody or fragments as defined herein, and to its use. In preferred embodiments, the multispecific antibody is a BCMA x GPRC5D x CD3-multispecific antibody as described herein, or a multispecific antigen-binding fragment thereof, and more preferably a BCMA x GPRC5D x CD3-trispecific antibody as described herein, or a BCMA x GPRC5D x CD3-trispecific antigen-binding fragment thereof. In one embodiment, the present invention provides a kit for diagnosis of cancer comprising a container comprising a BCMA x GPRC5D x CD3 trispecific antibody, and one or more reagents for detecting binding of the antibody to GPRC5D and / or BCMA. Reagents may include, for example, fluorescent tags, enzymatic tags, or other detectable tags. The reagents may also include secondary or tertiary antibodies or reagents for enzymatic reactions, wherein the enzymatic reactions produce a product that may be visualized. For example, the multispecific antibodies described herein, or antigen-binding fragments thereof, may be labeled with a radiolabel, a fluorescent label, an epitope tag, biotin, a chromophore label, an ECL label, an enzyme, ruthenium, inIn-DOTA, niIn-diethylenetriaminepentaacetic acid (DTPA), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, or poly-histidine or similar such labels known in the art. BCMA-Specific Antibodies Described herein are isolated antibodies and antigen-binding fragments specific for BCMA. In some embodiments, the BCMA-specific antibodies and antigen-binding fragments bind human BCMA. The general structure of an BCMA-specific antibody molecule may comprise an antigen binding domain, which includes heavy and light chains, and the Fc domain, which serves a variety of functions, including complement fixation and binding antibody receptors. In some embodiments are provided a BCMA-specific antibody, or an antigenbinding fragment thereof, comprising a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 1 (e.g., BCMB519). In some embodiments are provided a BCMA-specific antibody, or an antigen-binding fragment thereof, comprising a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 1 (e.g., BCMB519) and a light chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 1 (e.g., BCMB519). In some embodiments, the BCMA-specific antibody, or an antigen-binding fragment thereof, comprises a heavy chain CDR1 comprising SEQ ID NO: 20, a heavy chain CDR2 comprising SEQ ID NO: 21, and a heavy chain CDR3 comprising SEQ ID NO: 22. In some embodiments, the BCMA-binding arm comprises a heavy chain CDR1 comprising SEQ ID NO: 20, a heavy chain CDR2 comprising SEQ ID NO: 21, a heavy chain CDR3 comprising SEQ ID NO: 22, a light chain CDR1 comprising SEQ ID NO: 17, a light chain CDR2 comprising SEQ ID NO: 18, and a light chain CDR3 comprising SEQ ID NO: 19. The BCMA-binding arm may comprise human framework sequences. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 24. In some embodiments, the BCMA-binding arm comprises a heavy chain variable domain substantially the same as, or identical to, SEQ ID NO: 24 and a light chain variable domain substantially the same as, or identical to, SEQ ID NO: 23. The heavy chain variable domain and light chain variable domain of antibodies discussed in this paragraph are suitable for inclusion in multispecific (e.g., bispecific or trispecific) constructs in which one arm is an anti-BCMA arm. Exemplary trispecific constructs comprising the BCMA-specific antibody, or an antigenbinding fragment thereof, discussed in this paragraph are provided herein. In some embodiments, the BCMA-specific antibodies and antigen-binding fragments bind human BCMA and cynomolgus monkey BCMA. In some embodiments, the BCMA-specific antibodies and antigen-binding fragments bind human BCMA but not to cynomolgus monkey BCMA. In some embodiments, the BCMA-specific antibodies and antigen-binding fragments bind to an epitope including one or more residues from the BCMA extracellular domain (ECD). In some embodiments, the BCMA-specific antibody or antigen-binding fragment binds to residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain. Such BCMA-specific antibody or antigen-binding fragment may bind to BCMA with an affinity of 5xlO'7M or less, such as 1x10'7M or less, 5xl0'8M or less, 1x10'8M or less, 5xl0'9M or less, 1x10'9M, or 5xlO'10 M or less. In one embodiment, the BCMA-specific antibody or antigen-binding fragment binds to BCMA with an affinity of about 1 xlO'loM to 1 xlO'9M. In one embodiment, the BCMA-binding arm binds to the BCMA with an affinity of about 1 xlO'loM, about 2 xlO'loM, about 3x10' 10M, about 4 xlO'loM, about 5 xlO'loM, about 6 xlO'loM, about 7 xlO'loM, about 8x10' 10M, about 9xlO'loM or about 1x10'9M. In one embodiment, the BCMA-specific antibody or antigen-binding fragment binds to BCMA with an affinity of about 8.4 xlO'loM as determined by a surface plasmon resonance (SPR) assay. In one embodiment, the BCMA-specific antibody pr antigen-binding fragment binds to BCMA with an affinity of about 2.1 xlO'loM as determined by a surface plasmon resonance (SPR) assay. The IgG class is divided in four isotypes: IgGl, IgG2, IgG3 and IgG4 in humans. They share more than 95% homology in the amino acid sequences of the Fc regions but show major differences in the amino acid composition and structure of the hinge region. The Fc region mediates effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the Fc region of an antibody binds to Fc receptors (FcyRs) on the surface of immune effector cells such as natural killers and macrophages, leading to the phagocytosis or lysis of the targeted cells. In CDC, the antibodies kill the targeted cells by triggering the complement cascade at the cell surface. The antibodies described herein include antibodies with the described features of the variable domains in combination with any of the IgG isotypes, including modified versions in which the Fc sequence has been modified to effect different effector functions. For many applications of therapeutic antibodies, Fc-mediated effector functions are not part of the mechanism of action. These Fc-mediated effector functions can be detrimental and potentially pose a safety risk by causing off-mechanism toxicity. Modifying effector functions can be achieved by engineering the Fc regions to reduce their binding to FcyRs or the complement factors. The binding of IgG to the activating (FcyRI, FcyRIIa, FcyRIIIa and FcyRIIIb) and inhibitory (FcyRIIb) FcyRs or the first component of complement (Clq) depends on residues located in the hinge region and the CH2 domain. Mutations have been introduced in IgGl, IgG2 and IgG4 to reduce or silence Fc functionalities. The antibodies described herein may include these modifications. In one embodiment, the antibody comprises an Fc region with one or more of the following properties: (a) reduced effector function when compared to the parent Fc; (b) reduced affinity to FcyRI, FcyRIIa, FcyRIIb, FcyRIIIb and / or FcyRIIIa, (c) reduced affinity to FcyRI (d) reduced affinity to FcyRIIa (e) reduced affinity to FcyRIIb, (f) reduced affinity to FcyRIIIb or (g) reduced affinity to FcyRIIIa. In some embodiments, the antibodies or antigen-binding fragments are IgG, or derivatives thereof, e.g., IgGl, IgG2, IgG3, and IgG4 isotypes. In some embodiments wherein the antibody has an IgGl isotype, the antibody contains L234A, L235A, D265S and / or K409R substitutions in its Fc region. In some embodiments wherein the antibody has an IgG4 isotype, the antibody contains K409R, S228P, L234A, and L235A substitutions in its Fc region. The antibodies described herein may include these modifications. In some embodiments the described antibodies may be capable of inhibiting APRIL binding with a ICso of low nanomolar as measured by ELISA. In some embodiments the described antibodies may be capable of inhibiting BAFF binding with a ICso of low micromolar as measured by ELISA. In some embodiments the described antibodies bind to BCMA-positive multiple myeloma cell lines. In addition to the described BCMA-specific antibodies and antigen-binding fragments, also provided are polynucleotide sequences capable of encoding the described antibodies and antigen-binding fragments. Vectors comprising the described polynucleotides are also provided, as are cells expressing the BCMA-specific antibodies or antigen-binding fragments provided herein. Also described are cells capable of expressing the disclosed vectors. These cells may be mammalian cells (such as 293 cells, 293F cells, CHO cells), insect cells (such as Sf7 cells), yeast cells, plant cells, or bacteria cells (such as E. coli). The described antibodies may also be produced by hybridoma cells. The described BCMA-specific antibodies or antigen-binding fragments include all isotypes, IgA, IgD, IgE, IgG and IgM, and synthetic multimers of the four-chain immunoglobulin structure. The described antibodies or antigen-binding fragments also include the IgY isotype generally found in hen or turkey serum and hen or turkey egg yolk. The BCMA-specific antibodies and antigen-binding fragments may be derived from any species by recombinant means. For example, the antibodies or antigen-binding fragments may be mouse, rat, goat, horse, swine, bovine, chicken, rabbit, camelid, donkey, llama, human , or chimeric versions thereof. For use in administration to humans, nonhuman derived antibodies or antigen-binding fragments may be genetically or structurally altered to be less antigenic upon administration to a human patient. In some embodiments, the antibodies or antigen-binding fragments are chimeric. As used herein, the term “chimeric” refers to an antibody, or antigen-binding fragment thereof, having at least some portion of at least one variable domain derived from the antibody amino acid sequence of a non-human mammal, a rodent, or a reptile, while the remaining portions of the antibody, or antigen-binding fragment thereof, are derived from a human. In some embodiments, the antibodies are humanized antibodies. Humanized antibodies may be chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab’, F(ab’)2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody may include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. The antibodies or antigen-binding fragments described herein can occur in a variety of forms, but will include one or more of the antibody CDRs shown in Table 1 (e.g., BCMB519). Described herein are recombinant antibodies and antigen-binding fragments that bind to BCMA. In some embodiments, the BCMA-specific antibodies or antigen-binding fragments are human IgG, or derivatives thereof. While the BCMA-specific antibodies or antigen-binding fragments exemplified herein are human, the antibodies or antigen-binding fragments exemplified may be chimerized. In some embodiments, the antibodies or antigen-binding fragments are IgG, or derivatives thereof, e.g., IgGl, IgG2, IgG3, and IgG4 isotypes. In some embodiments wherein the antibody is of IgGl isotype, the antibody comprises an IgGl Fc region (SEQ ID NO: 158). SEQ ID NO: 158 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK In some embodiments wherein the antibody is of IgGl isotype, the antibody comprises L234A, L235A, and D265S substitutions (underlined) in its Fc region (SEQ ID NO: 159). SEQ ID NO: 159 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC papeaaggpsvflfppkpkdtlmisrtpevtcvvvsvshedpevkfnwyvdgvev HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK In some embodiments wherein the antibody is of IgG4 isotype, the antibody comprises S228P, L234A, and L235A substitutions (underlined) in its Fc region (SEQ ID NO: 160). SEQ ID NO: 160 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAP EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK The BCMA specific antibodies defined by CDR and / or variable domain sequence discussed in the above paragraphs may include these IgG Fc regions. Also disclosed are isolated synthetic polynucleotides that encode the antibodies or antigen-binding fragments that bind to BCMA. The isolated polynucleotides capable of encoding the variable domain segments provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments. Polynucleotides encoding recombinant antigen-binding proteins also are within the scope of the disclosure. In some embodiments, the polynucleotides described (and the peptides they encode) include a leader sequence. Any leader sequence known in the art may be employed. The leader sequence may include, but is not limited to, a restriction site or a translation start site. The BCMA-specific antibodies or antigen-binding fragments described herein include variants having single or multiple amino acid substitutions, deletions, or additions that retain the biological properties (e.g., binding affinity or immune effector activity) of the described BCMA-specific antibodies or antigen-binding fragments. In the context of the present invention the following notations are, unless otherwise indicated, used to describe a mutation; i) substitution of an amino acid in a given position is written as e.g. K409R which means a substitution of a Lysine in position 409 with an Arginine; and ii) for specific variants the specific three or one letter codes are used, including the codes Xaa and X to indicate any amino acid residue. Thus, the substitution of Arginine for Lysine in position 409 is designated as: K409R, or the substitution of any amino acid residue for Lysine in position 409 is designated as K409X. In case of deletion of Lysine in position 409 it is indicated by K409*. The skilled person may produce variants having single or multiple amino acid substitutions, deletions, or additions. These variants may include: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like. Antibodies or antigen-binding fragments described herein may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In other embodiments, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues. The techniques for obtaining these variants, including genetic (deletions, mutations, etc.), chemical, and enzymatic techniques, are known to persons having ordinary skill in the art. The BCMA-specific antibodies or antigen-binding fragments described herein may embody several antibody isotypes, such as IgM, IgD, IgG, IgA and IgE. In some embodiments the antibody isotype is IgGl, IgG2, IgG3, or IgG4 isotype, preferably IgGl or IgG4 isotype. Antibody or antigen-binding fragment thereof specificity is largely determined by the amino acid sequence, and arrangement, of the CDRs. Therefore, the CDRs of one isotype may be transferred to another isotype without altering antigen specificity. Alternatively, techniques have been established to cause hybridomas to switch from producing one antibody isotype to another (isotype switching) without altering antigen specificity. Accordingly, such antibody isotypes are within the scope of the described antibodies or antigen-binding fragments. The BCMA-specific antibodies or antigen-binding fragments described herein may have ICso values of low nanomolar for APRIL binding. The IC50 of the described BCMA-specific antibodies, or antigen-binding fragments, may be determined by a variety of methods known in the art, such as ELISA-based methods or flow cytometry (FACS). Assays for measuring IC50 by ELISA have plate-bound BCMA in the presence and absence of a BCMA specific antibody and varying concentrations of the APRIL are used. A BCMA antibody that blocks the binding of APRIL to BCMA is to “block APRIL as measured by ELISA.” Also provided are vectors comprising the polynucleotides described herein. The vectors can be expression vectors. Recombinant expression vectors containing a sequence encoding a polypeptide of interest are thus contemplated as within the scope of this disclosure. The expression vector may contain one or more additional sequences such as but not limited to regulatory sequences (e.g., promoter, enhancer), a selection marker, and a polyadenylation signal. Vectors for transforming a wide variety of host cells are well known and include, but are not limited to, plasmids, phagemids, cosmids, baculoviruses, bacmids, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), as well as other bacterial, yeast and viral vectors. Recombinant expression vectors within the scope of the description include synthetic, genomic, or cDNA-derived nucleic acid fragments that encode at least one recombinant protein which may be operably linked to suitable regulatory elements. Such regulatory elements may include a transcriptional promoter, sequences encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. Expression vectors, especially mammalian expression vectors, may also include one or more nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, other 5' or 3' flanking nontranscribed sequences, 5' or 3' nontranslated sequences (such as necessary ribosome binding sites), a polyadenylation site, splice donor and acceptor sites, or transcriptional termination sequences. An origin of replication that confers the ability to replicate in a host may also be incorporated. The transcriptional and translational control sequences in expression vectors to be used in transforming vertebrate cells may be provided by viral sources. Exemplary vectors may be constructed as described by Okayama and Berg, 3 Mol. Cell. Biol. 280 (1983). In some embodiments, the antibody- or antigen-binding fragment-coding sequence is placed under control of a powerful constitutive promoter, such as the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin, human myosin, human hemoglobin, human muscle creatine, and others. In addition, many viral promoters function constitutively in eukaryotic cells and are suitable for use with the described embodiments. Such viral promoters include without limitation, Cytomegalovirus (CMV) immediate early promoter, the early and late promoters of SV40, the Mouse Mammary Tumor Virus (MMTV) promoter, the long terminal repeats (LTRs) of Maloney leukemia virus, Human Immunodeficiency Virus (HIV), Epstein Barr Virus (EBV), Rous Sarcoma Virus (RSV), and other retroviruses, and the thymidine kinase promoter of Herpes Simplex Virus. In one embodiment, the BCMA-specific antibody or antigen-binding fragment thereof coding sequence is placed under control of an inducible promoter such as the metallothionein promoter, tetracyclineinducible promoter, doxycycline-inducible promoter, promoters that contain one or more interferon-stimulated response elements (ISRE) such as protein kinase R 2',5'-oligoadenylate synthetases, Mx genes, AD ARI, and the like. Vectors described herein may contain one or more Internal Ribosome Entry Site(s) (IRES). Inclusion of an IRES sequence into fusion vectors may be beneficial for enhancing expression of some proteins. In some embodiments the vector system will include one or more polyadenylation sites (e.g., SV40), which may be upstream or downstream of any of the aforementioned nucleic acid sequences. Vector components may be contiguously linked, or arranged in a manner that provides optimal spacing for expressing the gene products (i.e., by the introduction of “spacer” nucleotides between the ORFs), or positioned in another way. Regulatory elements, such as the IRES motif, may also be arranged to provide optimal spacing for expression. The vectors may comprise selection markers, which are well known in the art. Selection markers include positive and negative selection markers, for example, antibiotic resistance genes (e.g., neomycin resistance gene, a hygromycin resistance gene, a kanamycin resistance gene, a tetracycline resistance gene, a penicillin resistance gene, a puromycin resistance gene, a blasticidin resistance gene), glutamate synthase genes, HSV-TK, HSV-TK derivatives for ganciclovir selection, or bacterial purine nucleoside phosphorylase gene for 6-methylpurine selection (Gadi et al., 7 Gene Ther. 1738-1743 (2000)). A nucleic acid sequence encoding a selection marker or the cloning site may be upstream or downstream of a nucleic acid sequence encoding a polypeptide of interest or cloning site. The vectors described herein may be used to transform various cells with the genes encoding the described antibodies or antigen-binding fragments. For example, the vectors may be used to generate BCMA-specific antibody or antigen-binding fragment-producing cells. Thus, another aspect features host cells transformed with vectors comprising a nucleic acid sequence encoding an antibody or antigen-binding fragment thereof that binds BCMA, such as the antibodies or antigen-binding fragments described and exemplified herein. Numerous techniques are known in the art for the introduction of foreign genes into cells and may be used to construct the recombinant cells for purposes of carrying out the described methods, in accordance with the various embodiments described and exemplified herein. The technique used should provide for the stable transfer of the heterologous gene sequence to the host cell, such that the heterologous gene sequence is heritable and expressible by the cell progeny, and so that the necessary development and physiological functions of the recipient cells are not disrupted. Techniques which may be used include but are not limited to chromosome transfer (e.g., cell fusion, chromosome mediated gene transfer, micro cell mediated gene transfer), physical methods (e.g., transfection, spheroplast fusion, microinjection, electroporation, liposome carrier), viral vector transfer (e.g., recombinant DNA viruses, recombinant RNA viruses) and the like (described in Cline, 29 Pharmac. Ther. 69-92 (1985)). Calcium phosphate precipitation and polyethylene glycol (PEG)-induced fusion of bacterial protoplasts with mammalian cells may also be used to transform cells. Cells suitable for use in the expression of the BCMA-specific antibodies or antigen-binding fragments described herein are preferably eukaryotic cells, more preferably cells of plant, rodent, or human origin, for example but not limited to NSO, CHO, CHOK1, perC.6, Tk-tsl3, BHK, HEK293 cells, COS-7, T98G, CV-l / EBNA, L cells, C127, 3T3, HeLa, NS1, Sp2 / 0 myeloma cells, and BHK cell lines, among others. In addition, expression of antibodies may be accomplished using hybridoma cells. Methods for producing hybridomas are well established in the art. Cells transformed with expression vectors described herein may be selected or screened for recombinant expression of the antibodies or antigen-binding fragments described herein. Recombinant-positive cells are expanded and screened for subclones exhibiting a desired phenotype, such as high level expression, enhanced growth properties, or the ability to yield proteins with desired biochemical characteristics, for example, due to protein modification or altered post-translational modifications. These phenotypes may be due to inherent properties of a given subclone or to mutation. Mutations may be effected through the use of chemicals, UV-wavelength light, radiation, viruses, insertional mutagens, inhibition of DNA mismatch repair, or a combination of such methods. Methods of using BCMA-specific antibodies for treatment Provided herein are BCMA-specific antibodies or antigen-binding fragments thereof for use in therapy. In particular, these antibodies or antigen-binding fragments may be useful in treating cancer, such as BCMA-expressing cancer, or other BCMA-expressing disorders. Accordingly, the invention provides a method of treating cancer comprising administering an antibody as described herein, such as BCMA-specific antibodies or antigen-binding fragments. For example, the use may be by interfering with BCMA-receptor interactions or where the antibody is conjugated to a toxin, so targeting the toxin to the BCMA-expressing cancer. In some embodiments BCMA-expressing cancer or disorder includes lymphoma, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM), or amyloidosis, plasma cell leukemia and lupus. In some embodiments, the BCMA-expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. The antibodies for use in these methods include those described herein above, for example a BCMA-specific antibody or antigen-binding fragment with the features set out in Table 1 (e.g., BCMB519), for example the CDRs or variable domain sequences, and in the further discussion of these antibodies. In some embodiments described herein, immune effector properties of the BCMA-specific antibodies may be enhanced or silenced through Fc modifications by techniques known to those skilled in the art and described herein. For example, Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc. may be provided and / or controlled by modifying residues in the Fc responsible for these activities. "Antibody-dependent cell-mediated cytotoxicity" or "ADCC" refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. The ability of monoclonal antibodies to induce ADCC can be enhanced by engineering their oligosaccharide component. Human IgGl or IgG3 are N-glycosylated at Asn297 with the majority of the glycans in the well-known biantennary GO, GOF, Gl, GIF, G2 or G2F forms. Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex-type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved FcyRIIIa binding without altering antigen binding or CDC activity. Such mAbs can be achieved using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality (Konno et al., Cytotechnology 64:249-65, 2012), application of a variant CHO line Lecl3 as the host cell line (Shields et al., J Biol Chern 277:26733-26740, 2002), application of a variant CHO line EB66 as the host cell line (Olivier et al., MAbs; 2(4), 2010; Epub ahead of print; PMID:20562582), application of a rat hybridoma cell line YB2 / 0 as the host cell line (Shinkawa et al., J Biol Chern 278:3466-3473, 2003), introduction of small interfering RNA specifically against the .alpha. 1,6-fucosyltrasferase (FUT8) gene (Mori et al., Biotechnol Bioeng 88:901-908, 2004), or coexpression of P-l,4-N-acetylglucosaminyltransferase III and golgi a-mannosidase II or a potent alpha-mannosidase I inhibitor, kifunensine (Ferrara et al., J Biol Chem 281:5032-5036, 2006, Ferrara et al., Biotechnol Bioeng 93:851-861, 2006; Xhou et al., Biotechnol Bioeng 99:652-65, 2008). In some embodiments described herein, ADCC elicited by the BCMA antibodies may also be enhanced by certain substitutions in the antibody Fc. Exemplary substitutions are for example substitutions at amino acid positions 256, 290, 298, 312, 356, 330, 333, 334, 360, 378 or 430 (residue numbering according to the EU index) as described in U.S. Pat. No. 6,737,056. Methods of detecting BCMA Provided herein are methods for detecting BCMA in a biological sample by contacting the sample with an antibody, or antigen-binding fragment thereof, described herein. As described herein, the sample may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments the described methods include detecting BCMA in a biological sample by contacting the sample with any of the BCMA-specific antibodies or antigen-binding fragments thereof described herein. In some embodiments the sample may be contacted with more than one of the BCMA-specific antibodies or antigen-binding fragments described herein. For example, a sample may be contacted with a first BCMA-specific antibody, or antigen-binding fragment thereof, and then contacted with a second BCMA-specific antibody, or antigenbinding fragment thereof, wherein the first antibody or antigen-binding fragment and the second antibody or antigen-binding fragment are not the same antibody or antigen-binding fragment. In some embodiments, the first antibody, or antigen-binding fragment thereof, may be affixed to a surface, such as a multiwell plate, chip, or similar substrate prior to contacting the sample. In other embodiments the first antibody, or antigen-binding fragment thereof, may not be affixed, or attached, to anything at all prior to contacting the sample. The described BCMA-specific antibodies and antigen-binding fragments may be detectably labeled. In some embodiments labeled antibodies and antigen-binding fragments may facilitate the detection BCMA via the methods described herein. Many such labels are readily known to those skilled in the art. For example, suitable labels include, but should not be considered limited to, radiolabels, fluorescent labels, epitope tags, biotin, chromophore labels, ECL labels, or enzymes. More specifically, the described labels include ruthenium, luIn-DOTA, U1ln- diethylenetriaminepentaacetic acid (DTPA), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, poly-histidine (HIS tag), acridine dyes, cyanine dyes, fluorone dyes, oxazin dyes, phenanthridine dyes, rhodamine dyes, Alexafluor® dyes, and the like. The described BCMA-specific antibodies and antigen-binding fragments may be used in a variety of assays to detect BCMA in a biological sample. Some suitable assays include, but should not be considered limited to, western blot analysis, radioimmunoassay, surface plasmon resonance, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay. In some embodiments described herein detection of BCMA-expressing cancer cells in a subject may be used to determine that the subject may be treated with a therapeutic agent directed against BCMA. BCMA is present at detectable levels in blood and serum samples. Thus, provided herein are methods for detecting BCMA in a sample derived from blood, such as a serum sample, by contacting the sample with an antibody, or antigen-binding fragment thereof, that binds BCMA. The blood sample, or a derivative thereof, may be diluted, fractionated, or otherwise processed to yield a sample upon which the described method may be performed. In some embodiments, BCMA may be detected in a blood sample, or a derivative thereof, by any number of assays known in the art, such as, but not limited to, western blot analysis, radioimmunoassay, surface plasmon resonance, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay. In some embodiments, the methods are in vitro methods. Methods for Diagnosing Cancer or Disorder Provided herein are methods for diagnosing BCMA-expressing cancer or disorder in a subject. In some embodiments BCMA-expressing cancer or disorder include lymphomas, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM), or amyloidosis, plasma cell leukemia, and lupus. In some embodiments, as described above, detecting BCMA in a biological sample, such as a blood sample or a serum sample, provides the ability to diagnose cancer in the subject from whom the sample was obtained. Alternatively, in some embodiments other samples such as a histological sample, a fine needle aspirate sample, resected tumor tissue, circulating cells, circulating tumor cells, and the like, may also be used to assess whether the subject from whom the sample was obtained has cancer. In some embodiments, it may already be known that the subject from whom the sample was obtained has cancer, but the type of cancer afflicting the subject may not yet have been diagnosed or a preliminary diagnosis may be unclear, thus detecting BCMA in a biological sample obtained from the subject can allow for, or clarify, diagnosis of the cancer. For example, a subject may be known to have cancer, but it may not be known, or may be unclear, whether the subject’s cancer is BCMA-expressing. In some embodiments the described methods involve assessing whether a subject is afflicted with BCMA-expressing cancer or disorder by determining the amount of BCMA that is present in a biological sample derived from the subject; and comparing the observed amount of BCMA with the amount of BCMA in a control, or reference, sample, wherein a difference between the amount of BCMA in the sample derived from the subject and the amount of BCMA in the control, or reference, sample is an indication that the subject is afflicted with a BCMA-expressing cancer or disorder. In another embodiment the amount of BCMA observed in a biological sample obtained from a subject may be compared to levels of BCMA known to be associated with certain forms or stages of cancer, to determine the form or stage of the subject’s cancer. In some embodiments the amount of BCMA in the sample derived from the subject is assessed by contacting the sample with an antibody, or an antigen-binding fragment thereof, that binds BCMA, such as the BCMA-specific antibodies described herein. The sample assessed for the presence of BCMA may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments BCMA-expressing cancer or disorder includes hematological cancer, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM), or amyloidosis, plasma cell leukemia and lupus. In some embodiments, the BCMA -expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. In some embodiments the subject is a human. In some embodiments the method of diagnosing a BCMA-expressing cancer or disorder will involve: contacting a biological sample of a subject with a BCMA-specific antibody, or an antigen-binding fragment thereof (such as those derivable from the antibodies and fragments provided in Table 1 (e.g., BCMB519)), quantifying the amount of BCMA present in the sample that is bound by the antibody or antigen-binding fragment thereof, comparing the amount of BCMA present in the sample to a known standard or reference sample; and determining whether the subject’s BCMA levels fall within the levels of BCMA associated with cancer or disorder. In an additional embodiment, the diagnostic method can be followed with an additional step of administering or prescribing a BCMA specific treatment. In another embodiment, the diagnostic method can be followed with an additional step of transmitting the results of the determination to facilitate treatment of the cancer or disorder. In some embodiments the BCMA specific treatment may be directed against BCMA-expressing cancers or disorders, such as the BCMA x CD3 multispecific antibodies described herein. In some embodiments the described methods involve assessing whether a subject is afflicted with BCMA-expressing cancer or disorder by determining the amount of BCMA present in a blood or serum sample obtained from the subject; and comparing the observed amount of BCMA with the amount of BCMA in a control, or reference, sample, wherein a difference between the amount of BCMA in the sample derived from the subject and the amount of BCMA in the control, or reference, sample is an indication that the subject is afflicted with a BCMA-expressing cancer or disorder. In some embodiments the control, or reference, sample may be derived from a subject that is not afflicted with BCMA-expressing cancer or disorder. In some embodiments the control, or reference, sample may be derived from a subject that is afflicted with BCMA-expressing cancer or disorder. In some embodiments where the control, or reference, sample is derived from a subject that is not afflicted with BCMA-expressing cancer or disorder, an observed increase in the amount of BCMA present in the test sample, relative to that observed for the control or reference sample, is an indication that the subject being assessed is afflicted with BCMA-expressing cancer or disorder. In some embodiments where the control sample is derived from a subject that is not afflicted with BCMA-expressing cancer or disorder, an observed decrease or similarity in the amount of BCMA present in the test sample, relative to that observed for the control or reference sample, is an indication that the subject being assessed is not afflicted with BCMA-expressing cancer or disorder. In some embodiments where the control or reference sample is derived from a subject that is afflicted with BCMA-expressing cancer or disorder, an observed similarity in the amount of BCMA present in the test sample, relative to that observed for the control or reference sample, is an indication that the subject being assessed is afflicted with BCMA-expressing cancer or disorder. In some embodiments where the control or reference sample is derived from a subject that is afflicted with BCMA-expressing cancer or disorder, an observed decrease in the amount of BCMA present in the test sample, relative to that observed for the control or reference sample, is an indication that the subject being assessed is not afflicted with BCMA-expressing cancer or disorder. In some embodiments the amount of BCMA in the sample derived from the subject is assessed by contacting the sample with an antibody, or an antigen-binding fragment thereof, that binds BCMA, such as the antibodies described herein. The sample assessed for the presence of BCMA may be derived from a blood sample, a serum sample, circulating cells, circulating tumor cells, cells that are not tissue associated (z.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In various aspects, the amount of BCMA is determined by contacting the sample with an antibody, or antigen-binding fragment thereof, that binds BCMA. In some embodiments, the sample may be contacted by more than one type of antibody, or antigenbinding fragment thereof, that binds BCMA. In some embodiments, the sample may be contacted by a first antibody, or antigen-binding fragment thereof, that binds BCMA and then contacted by a second antibody, or antigen-binding fragment thereof, that binds BCMA. BCMA-specific antibodies or antigen-binding fragments such as those described herein may be used in this capacity. Various combinations of the BCMA-specific antibodies and antigen-binding fragments can be used to provide a “first” and “second” antibody or antigen-binding fragment to carry out the described diagnostic methods. In some embodiments BCMA-expressing cancer or disorder includes lymphomas, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM). In some embodiments, the BCMA-expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. In certain embodiments, the amount of BCMA is determined by western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay. In various embodiments of the described diagnostic methods a control or reference sample is used. This sample may be a positive or negative assay control that ensures the assay used is working properly; for example, an assay control of this nature might be commonly used for immunohistochemistry assays. Alternatively, the sample may be a standardized reference for the amount of BCMA in a biological sample from a healthy subject. In some embodiments, the observed BCMA levels of the tested subject may be compared with BCMA levels observed in samples from subjects known to have BCMA-expressing cancer or disorder. In some embodiments, the control subject may be afflicted with a particular cancer or disorder of interest. In some embodiments, the control subject is known to have early stage cancer, which may or may not be BCMA-expressing cancer. In some embodiments, the control subject is known to have intermediate stage cancer, which may or may not be BCMA-expressing cancer. In some embodiments, the control subject is known to have late stage, which may or may not be BCMA-expressing cancer. In some embodiments, the methods for diagnosing cancer or a disorder are in vitro methods. Methods for Monitoring Cancer or Disorder Provided herein are methods for monitoring BCMA-expressing cancer or disorder in a subject. In some embodiments BCMA-expressing cancer or disorder includes lymphomas, such as multiple myeloma (MM) including smoldering multiple myeloma (SMM), or amyloidosis, plasma cell leukemia and lupus. In some embodiments, the BCMA-expressing cancer is a relapsed or refractory form of a lymphoma, such as a relapsed or refractory form of multiple myeloma. In some embodiments the described methods involve assessing whether BCMA-expressing cancer or disorder is progressing, regressing, or remaining stable by determining the amount of BCMA that is present in a test sample derived from the subject; and comparing the observed amount of BCMA with the amount of BCMA in a biological sample obtained, in a similar manner, from the subject at an earlier point in time, wherein a difference between the amount of BCMA in the test sample and the earlier sample provides an indication of whether the cancer is progressing, regressing, or remaining stable. In this regard, a test sample with an increased amount of BCMA, relative to the amount observed for the earlier sample, may indicate progression of a BCMA-expressing cancer or disorder. Conversely, a test sample with a decreased amount of BCMA, relative to the amount observed for the earlier sample, may indicate regression of a BCMA-expressing cancer or disorder. Accordingly, a test sample with an insignificant difference in the amount of BCMA, relative to the amount observed for the earlier sample, may indicate a state of stable disease for a BCMA-expressing cancer or disorder. In some embodiments the amount of BCMA in a biological sample derived from the subject is assessed by contacting the sample with an antibody, or an antibody fragment thereof, that binds BCMA, such as the antibodies described herein. The sample assessed for the presence of BCMA may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments the subject is a human. In some embodiments the methods of monitoring a BCMA-expressing cancer or disorder will involve: contacting a biological sample of a subject with a BCMA-specific antibody, or antigen-binding fragment thereof (such as those derivable from the antibodies and fragments provided in Table 1 (e.g., BCMB519)), quantifying the amount of BCMA present in the sample, comparing the amount of BCMA present in the sample to the amount of BCMA determined to be in a biological sample obtained, in a similar manner, from the same subject at an earlier point in time; and determining whether the subject’s BCMA level has changed over time. A test sample with an increased amount of BCMA, relative to the amount observed for the earlier sample, may indicate progression of cancer. Conversely, a test sample with a decreased amount of BCMA, relative to the amount observed for the earlier sample, may indicate regression of a BCMA-expressing cancer or disorder. Accordingly, a test sample with an insignificant difference in the amount of BCMA, relative to the amount observed for the earlier sample, may indicate a state of stable disease for a BCMA-expressing cancer or disorder. In some embodiments, the BCMA levels of the sample may be compared to a known standard or a reference sample, alone or in addition to the BCMA levels observed for a sample assessed at an earlier point in time. In an additional embodiment, the diagnostic method can be followed with an additional step of administering a BCMA-specific treatment. In some embodiments the BCMA-specific treatment may be directed against BCMA-expressing cancers or disorders, such as the BCMA x CD3 multispecific antibodies described herein. In various aspects, the amount of BCMA is determined by contacting the sample with an antibody, or antigen-binding fragment thereof, that binds BCMA. In some embodiments, the sample may be contacted by more than one type of antibody, or antigenbinding fragment thereof, that binds BCMA. In some embodiments, the sample may be contacted by a first antibody, or antigen-binding fragment thereof, that binds BCMA and then contacted by a second antibody, or antigen-binding fragment thereof, that binds BCMA. Antibodies such as those described herein may be used in this capacity. Various combinations of the antibodies and antigen-binding fragments described in Table 1 can be used to provide a “first” and “second” antibody or antigen-binding fragment to carry out the described monitoring methods. In some embodiments BCMA-expressing cancer or disorder includes a hematological cancer, such as acute myeloid leukemia (AML) or lymphomas (e.g., multiple myeloma (MM), smoldering multiple myeloma (SMM)), or amyloidosis, plasma cell leukemia, and lupus. In certain embodiments, the amount of BCMA is determined by western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay. In some embodiments, the methods are in vitro methods. Kits for Detecting BCMA Provided herein are kits for detecting BCMA in a biological sample. These kits include one or more of the BCMA-specific antibodies described herein, or an antigenbinding fragment thereof, and instructions for use of the kit. The provided BCMA-specific antibody, or antigen-binding fragment, may be in solution; lyophilized; affixed to a substrate, carrier, or plate; or detectably labeled. The described kits may also include additional components useful for performing the methods described herein. By way of example, the kits may comprise means for obtaining a sample from a subject, a control or reference sample, e.g., a sample from a subject having slowly progressing cancer and / or a subject not having cancer, one or more sample compartments, and / or instructional material which describes performance of a method of the invention and tissue specific controls or standards. The means for determining the level of BCMA can further include, for example, buffers or other reagents for use in an assay for determining the level of BCMA. The instructions can be, for example, printed instructions for performing the assay and / or instructions for evaluating the level of expression of BCMA. The described kits may also include means for isolating a sample from a subject. These means can comprise one or more items of equipment or reagents that can be used to obtain a fluid or tissue from a subject. The means for obtaining a sample from a subject may also comprise means for isolating blood components, such as serum, from a blood sample. Preferably, the kit is designed for use with a human subject. EMBODIMENTS The disclosure provided herein also provides the following non-limiting embodiments. Embodiment 1. A trispecific antibody, or a trispecific binding fragment thereof, comprising: (a) a first antigen-binding arm comprising a first heavy chain variable domain (VH1) and a first light chain variable domain (VL1); (b) a second antigen-binding arm comprising a second heavy chain variable domain (VH2) and a second light chain variable domain (VL2); (c) a third antigen-binding arm comprising a third heavy chain variable domain (VH3) and a third light chain variable domain (VL3), wherein the first antigen-binding arm binds to an epitope on cluster of differentiation 3 (CD3), the second antigen-binding arm binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen-binding arm binds to an epitope on B cell maturation antigen (BCMA). Embodiment 2. The trispecific antibody or trispecific binding fragment of embodiment 1, wherein the VH1 and VL1 of first antigen-binding arm are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a Fab. Embodiment 3. The trispecific antibody or trispecific binding fragment of embodiment 1 or 2, wherein the VH2 and VL2 of the second antigen-binding arm are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a scFv. Embodiment 4. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-3, wherein the VH3 and VL3 of the third antigen-binding arm are present in an antibody fragment, a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a scFv. Embodiment 5. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-4, wherein the first antigen-binding arm that binds CD3 comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH1) of SEQ ID NO: 8 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL1) of SEQ ID NO: 7. Embodiment 6. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-5, wherein the first antigen-binding arm that binds CD3 comprises a HCDR1 comprising the amino acid sequence of GDSVFNNNAAWS (SEQ ID NO: 4), a HCDR2 comprising the amino acid sequence of RTYYRSKWLYD (SEQ ID NO: 5), and a HCDR3 comprising the amino acid sequence of GYSSSFDY (SEQ ID NO: 6); and a LCDR1 comprising the amino acid sequence of TGTSSNIGTYKFVS (SEQ ID NO: 1), a LCDR2 comprising the amino acid sequence of EVSKRPS (SEQ ID NO: 2), and a LCDR3 comprising the amino acid sequence of VSYAGSGTLL (SEQ ID NO: 3). Embodiment 7. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-6, wherein the first antigen-binding arm that binds CD3 comprises the VH1 of SEQ ID NO: 8 and the VL1 of SEQ ID NO: 7. Embodiment 8. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-7, wherein the second antigen-binding arm that binds GPRC5D comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH2) of SEQ ID NO: 16 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL2) of SEQ ID NO: 15. Embodiment 9. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-8, wherein the second antigen-binding arm that binds GPRC5D comprises a HCDR1 comprising the amino acid sequence of GFSLTNIRMSVS (SEQ ID NO: 12), HCDR2 comprising the amino acid sequence of HIFSNDEKS (SEQ ID NO: 13), and a HCDR3 comprising the amino acid sequence of MRLPYGMDV (SEQ ID NO: 14); and a LCDR1 comprising the amino acid sequence of RSSQSLVHSDGNTYLS (SEQ ID NO: 9), a LCDR2 comprising the amino acid sequence of KISNRFF (SEQ ID NO: 10), and a LCDR3 comprising the amino acid sequence of MQATQFPHT (SEQ ID NO: 11). Embodiment 10. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-9, wherein the second antigen-binding arm that binds GPRC5D comprises the VH2 of SEQ ID NO: 16 and the VL2 of SEQ ID NO: 15. Embodiment 11. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-10, wherein the third antigen-binding arm that binds BCMA comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH3) of SEQ ID NO: 24 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL3) of SEQ ID NO: 23. Embodiment 12. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-11, wherein the third antigen-binding arm that binds BCMA comprises a HCDR1 comprising the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a HCDR2 comprising the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and a HCDR3 comprising the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22); and a LCDR1 comprising the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17), a LCDR2 comprising the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a LCDR3 comprising the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19). Embodiment 13. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-12, wherein the third antigen-binding arm that binds BCMA comprises the VH3 of SEQ ID NO: 24 and the VL3 of SEQ ID NO: 23. Embodiment 14. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-4, wherein the first antigen-binding arm that binds CD3 comprises the HCDR1, the HCDR2 and the HCDR3 of the VH1 of SEQ ID NO: 8 and the LCDR1, the LCDR2 and the LCDR3 of the VL1 of SEQ ID NO: 7; the second antigen-binding arm that binds GPRC5D comprises the HCDR1, the HCDR2 and the HCDR3 of the VH2 of SEQ ID NO: 16 and the LCDR1, the LCDR2 and the LCDR3 of the VL2 of SEQ ID NO: 15; and the third antigen-binding arm that binds BCMA comprises the HCDR1, the HCDR2 and the HCDR3 of the VH3 of SEQ ID NO: 24 and the LCDR1, the LCDR2 and the LCDR3 of the VL3 of SEQ ID NO: 23. Embodiment 15. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-4 and 14, wherein the first antigen-binding arm that binds CD3 comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 4, 5, 6, 1, 2, 3, respectively; the second antigen-binding arm that binds GPRC5D comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 12, 13, 14, 9, 10 and 11, respectively; and the third antigen-binding arm that binds BCMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 20, 21, 22, 17, 18 and 19, respectively. Embodiment 16. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-4, 14 and 15, wherein the first antigen-binding arm that binds CD3 comprises the VH1 of SEQ ID NO: 8 and the VL1 of SEQ ID NO: 7; the second antigen-binding arm that binds GPRC5D comprises the VH2 of SEQ ID NO: 16 and the VL2 of SEQ ID NO: 15; and the third antigen-binding arm that binds BCMA comprises the VH3 of SEQ ID NO: 24 and the VL3 of SEQ ID NO: 23. Embodiment 17. The trispecific antibody or trispecific binding fragment thereof of any one of embodiments 1-16, the first antigen-binding arm comprises a Fragment crystallizable (Fc) domain, and the second antigen-binding arm or the third antigenbinding arm comprises a Fc domain. Embodiment 18. The trispecific antibody or trispecific binding fragment thereof of embodiment 17, wherein the Fc domains comprise one or more mutations which promote heterodimerization of the Fc domains. Embodiment 19. The trispecific antibody or trispecific binding fragment of embodiment 18, wherein the mutations are selected from T366S, L368A, T366W and Y407V (EU numbering). Embodiment 20. The trispecific antibody or trispecific binding fragment of any one of embodiments 17-19, wherein the Fc domains further comprise one or more mutations which reduce Fc binding to a Fey receptor. Embodiment 21. The trispecific antibody or trispecific binding fragment of embodiment 20, wherein the Fey receptor is FcyRI, FcyRIIA, FcyRIIB, FcyRIIIA, and / or FcyRIIIB. Embodiment 22. The trispecific antibody or trispecific binding fragment of embodiment 20 or 21, wherein the Fc domains comprise one or more mutations selected from L234A, L235A, and D265S (EU numbering). Embodiment 23. The trispecific antibody or trispecific binding fragment of any one of embodiments 17-22, wherein the Fc domains further comprise one or more mutations which reduce Fc binding to protein A. Embodiment 24. The trispecific antibody or trispecific binding fragment of embodiment 23, wherein the Fc domain comprises mutations H435R and / or Y436F (EU numbering). Embodiment 25. The trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 24, wherein the first antigen-binding arm that specifically binds to residues 22-35 (QDGNEEMGGITQTP (SEQ ID NO: 161)) of the CD3s chain. Embodiment 26. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-25, wherein the first antigen-binding arm that specifically binds to CD3 with an affinity of about 1 xlO'8 to 1 xlO'7 M. Embodiment 27. The trispecific antibody or trispecific binding fragment of embodiment 26, wherein the first antigen-binding arm that specifically binds to CD3 with an affinity of about 2 xlO'8 to 4 x 10'8 M. Embodiment 28. The trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 27, wherein the third antigen-binding arm specifically binds residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain. Embodiment 29. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-28, wherein the third antigen-binding arm specifically binds to BCMA with an affinity of about 1 xlO'10 to 1 x 10'7 M. Embodiment 30. The trispecific antibody or trispecific binding fragment of embodiment 29, wherein the third antigen-binding arm specifically binds to BCMA with an affinity of about 2 xlO'10 to 9 xlO'10 M. Embodiment 31.     A trispecific antibody, or a trispecific binding fragment, comprising a first antigen-binding arm that binds to an epitope on cluster of differentiation 3 (CD3), a second antigen-binding arm that binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen-binding arm that binds to an epitope on B cell maturation antigen (BCMA), wherein the first antigen-binding arm comprises a heavy chain (HC1) polypeptide and a light chain (LC) polypeptide; and wherein the trispecific antibody, or a trispecific binding fragment thereof, comprises a single polypeptide comprising the second antigen-binding arm and the third antigen-binding arm. Embodiment 32. The trispecific antibody or trispecific binding fragment of embodiment 31, wherein the HC1 of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 26. Embodiment 33.     The trispecific antibody or trispecific binding fragment of embodiment 32, wherein the LC of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 27. Embodiment 34. The trispecific antibody or trispecific binding fragment of embodiment 32 or 33, wherein the polypeptide comprising the second antigen-binding arm and the third antigen-binding arm comprises an amino acid sequence of SEQ ID NO: 28. Embodiment 35. The trispecific antibody or trispecific binding fragment of embodiment 31, wherein the first antigen-binding arm comprises an HC1 comprising the amino acid sequence of SEQ ID NO: 26, and a LC comprising the amino acid sequence of SEQ ID NO: 27, and the polypeptide comprising the second antigen-binding arm and the third antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 28. Embodiment 36. A trispecific antibody, or a trispecific binding fragment, comprising a first antigen-binding arm that binds to an epitope on cluster of differentiation 3 (CD3), a second antigen-binding arm that binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen-binding arm that binds to an epitope on B cell maturation antigen (BCMA), wherein the first antigen-binding arm comprises a heavy chain (HC1) polypeptide and a light chain (LC) polypeptide, wherein the heavy chain (HC1) polypeptide further comprises the second antigen-binding arm, wherein the trispecific antibody, or a trispecific binding fragment thereof, further comprises a single polypeptide comprising the third antigen-binding arm. Embodiment 37. The trispecific antibody or trispecific binding fragment of embodiment 36, wherein the HC1 of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 29. Embodiment 38. The trispecific antibody or trispecific binding fragment of embodiment 36 or 37, wherein the LC of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 30. Embodiment 39. The trispecific antibody or trispecific binding fragment of any one of embodiments 36-38, wherein the single polypeptide comprising the third antigenbinding arm comprises an amino acid sequence of SEQ ID NO: 31. Embodiment 40. The trispecific antibody or trispecific binding fragment of embodiment 36, wherein the first antigen-binding arm comprises an HC1 comprising the amino acid sequence of SEQ ID NO: 29, and a LC comprising the amino acid sequence of SEQ ID NO: 30, and the single polypeptide comprising the third antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 31. Embodiment 41. The trispecific antibody or trispecific binding fragment of any one of embodiments 1-40, wherein the antibody or antigen-binding fragment thereof is an IgGl, IgG2, IgG3, or IgG4 isotype. Embodiment 42. The trispecific antibody or trispecific binding fragment of any of embodiments 1-41, wherein the antibody or antigen-binding fragment thereof is an IgGl isotype. Embodiment 43. A synthetic polynucleotide encoding the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42. Embodiment 44. A pharmaceutical composition comprising the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42 and a pharmaceutically acceptable carrier. Embodiment 45. The pharmaceutical composition of embodiment 44, wherein the pharmaceutical composition further comprises a second therapeutic agent. Embodiment 46. The pharmaceutical composition of embodiment 45, wherein the second therapeutic agent comprises an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof Embodiment 47. A cell expressing the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42. Embodiment 48.     The cell of embodiment 47 wherein the cell is a hybridoma. Embodiment 49.     The cell of embodiment 47 wherein the trispecific antibody is recombinantly produced. Embodiment 50. A method for treating cancer in a subject in need thereof, said method comprising administering to the subject a therapeutically effective amount of the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42 or the pharmaceutical composition of any one of embodiments 43-46. Embodiment 51. The method of embodiment 50, wherein the trispecific antibody or trispecific binding fragment or the pharmaceutical composition is administered for a time sufficient to treat the cancer. Embodiment 52. A method for inhibiting growth or proliferation of a cancer cell, said method comprising administering to said cell an effective amount of the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42 or the pharmaceutical composition of any one of embodiments 43-46, wherein said effective amount is sufficient to inhibit the growth or proliferation of said cancer cell. Embodiment 53. The method of embodiment 52, wherein said cancer cell is in a subject and the trispecific antibody or trispecific binding fragment or the pharmaceutical composition is administered to the subject. Embodiment 54. The method of embodiment 52, wherein said administration is conducted ex vivo. Embodiment 55. A method of redirecting a T cell to BCMA and / or GPRC5D-expressing cancer cells in a subject in need thereof, said method comprising administering to said subject a therapeutically effective amount of the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42 or the pharmaceutical composition of any one of embodiments 43-46. Embodiment 56. The method of embodiment 55, wherein the said therapeutically effective amount is sufficient to direct said T cell response to said cancer cells. Embodiment 57. The method of any one of embodiments 50-56, wherein the cancer is a hematological cancer. Embodiment 58. The method of embodiment 57 wherein the hematological cancer is a BCMA and / or GPRC5D -expressing B cell cancer. Embodiment 59. The method of embodiment 58 wherein the BCMA and / or GPRC5D -expressing B cell cancer is multiple myeloma. Embodiment 60. The method of embodiment 59 wherein the BCMA and / or GPRC5D -expressing B cell cancer is smoldering multiple myeloma (SMM). Embodiment 61. The method of any one of embodiments 50-60, wherein the cancer is relapsed, refractory, or malignant cancer, or any combination thereof. Embodiment 62. The method of any one of embodiments 50-51, 53, and 55-61, wherein the subject has received a prior treatment. Embodiment 63. The method of embodiment 62, the prior treatment comprises a proteasome inhibitor, an immunomodulatory drug, a CD38 antibody, a bispecific agent, a CAR-T therapy, or a combination thereof. Embodiment 64. The method of any one of embodiments 50-63 further comprising administering a second therapeutic agent. Embodiment 65. The method of embodiment 64 wherein the second therapeutic agent is a chemotherapeutic agent or a targeted anti-cancer therapy. Embodiment 66. The method of embodiment 65 wherein the chemotherapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2 (IL-2). Embodiment 67. The method of embodiment 64 wherein the second therapeutic agent is an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof. Embodiment 68. The method of any one of embodiments 50-51, 53, and 55-67, wherein the trispecific antibody or trispecific binding fragment, or the pharmaceutical composition is administered intravenously, intramuscularly, intraperitoneally, and / or subcutaneously to the subject. Embodiment 69. The method of any one of embodiments 50-51, 53, and 55-68, wherein the trispecific antibody or trispecific binding fragment, or the pharmaceutical composition is administered subcutaneously to the subject. Embodiment 70. A method for generating the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42, wherein said method comprises culturing the cell of any one of embodiments 47 to 49 and isolating said trispecific antibody or trispecific binding fragment. Embodiment 71. A kit comprising (i) the trispecific antibody or trispecific binding fragment of any one of embodiments 1 to 42 and / or a polynucleotide of embodiment 43 and (ii) packaging for the same. Embodiment 72. An antibody, or an antigen-binding fragment thereof, that binds to BCMA, comprising: a heavy chain complementarity determining region 1 (CDR1) having the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a heavy chain CDR2 having the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and a heavy chain CDR3 having the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22). Embodiment 73. The antibody or antigen-binding fragment of embodiment 72, further comprising: a light chain complementarity determining region 1 (CDR1) having the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17), a light chain CDR2 having the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a light chain CDR3 having the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19). Embodiment 74. The antibody or antigen-binding fragment of embodiment 72 or 73, comprising a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 24. Embodiment 75. The antibody or antigen-binding fragment of any one of embodiments 72-74, comprising a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 23. Embodiment 76. The antibody or antigen-binding fragment of any one of embodiments 72-75, wherein the antibody or antigen-binding fragment specifically binds residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain. Embodiment 77. The antibody or antigen-binding fragment of any one of embodiments 72-76, wherein the antibody or antigen-binding fragment specifically binds to BCMA with an affinity of about 1 xlO'10 to 1 x 10'7 M. Embodiment 78. The antibody or antigen-binding fragment of embodiment 77, wherein the antibody or antigen-binding fragment specifically binds to BCMA with an affinity of about 2 xlO'10 to 9 xlO'10 M. Embodiment 79. The antibody or antigen-binding fragment of any one of embodiments 72-78 wherein the antibody or antigen-binding fragment is a human antibody or antigen-binding fragment. Embodiment 80. The antibody or antigen-binding fragment of any one of embodiments 72-79 wherein the antibody or antigen-binding fragment is recombinant. Embodiment 81. The antigen binding fragment of any one of embodiments 72 to 80 wherein the antigen binding fragment is a Fab fragment, a Fab2 fragment, or a single chain antibody. Embodiment 82. The antibody or antigen-binding fragment of any one of embodiments 72-81 wherein the antibody or antigen-binding fragment thereof is an IgGl, IgG2, IgG3, or IgG4 isotype. Embodiment 83. The antibody or antigen-binding fragment of any of embodiments 72-82, wherein the antibody or antigen-binding fragment thereof is an IgGl or an IgG4 isotype. Embodiment 84. A pharmaceutical composition comprising the antibody or antigenbinding fragment of any one of embodiments 72-83 and a pharmaceutically acceptable carrier. Embodiment 85. The pharmaceutical composition of embodiment 84, wherein the pharmaceutical composition further comprises a second therapeutic agent. Embodiment 86. The pharmaceutical composition of embodiment 85, wherein the second therapeutic agent comprises an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof. Embodiment 87. A cell expressing the antibody or antigen-binding fragment of any one of embodiments 72-83. Embodiment 88. Embodiment 89. produced. Embodiment 90. The cell of embodiment 87 wherein the cell is a hybridoma. The cell of embodiment 87 wherein the antibody is recombinantly A method for treating cancer in a subject in need thereof, said method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment of any one of embodiments 72-83 or the pharmaceutical composition of any one of embodiments 84-86. Embodiment 91. The method of embodiment 90, wherein the antibody or antigenbinding fragment or the pharmaceutical composition is administered for a time sufficient to treat the cancer. Embodiment 92. A method for inhibiting growth or proliferation of a cancer cell, said method comprising administering to said cell an effective amount of the antibody or antigen-binding fragment of any one of embodiments 72-83 or the pharmaceutical composition of any one of embodiments 84-86, wherein said effective amount is sufficient to inhibit the growth or proliferation of said cancer cell. Embodiment 93. The method of embodiment 92, wherein said cancer cell is in a subject and the antibody or antigen-binding fragment or the pharmaceutical composition is administered to the subject. Embodiment 94. The method of embodiment 92, wherein said administration is conducted ex vivo. Embodiment 95. The method of any one of embodiments 90-94 wherein the cancer is a hematological cancer. Embodiment 96. The method of embodiment 95 wherein the hematological cancer is a BCMA-expressing B cell cancer. Embodiment 97. The method of embodiment 96 wherein the BCMA-expressing B cell cancer is multiple myeloma. Embodiment 98. The method of embodiment 97 wherein the BCMA-expressing B cell cancer is smoldering multiple myeloma (SMM). Embodiment 99. The method of any one of embodiments 90-98, wherein the cancer is relapsed, refractory, or malignant cancer, or any combination thereof. Embodiment 100. The method of any one of embodiments 90-91, 93, and 95-99, wherein the subject has received a prior treatment. Embodiment 101. The method of embodiment 100, the prior treatment comprises a proteasome inhibitor, an immunomodulatory drug, a CD38 antibody, a bispecific agent, a CAR-T therapy, or a combination thereof. Embodiment 102. The method of any one of embodiments 90-101 further comprising administering a second therapeutic agent. Embodiment 103. The method of embodiment 102 wherein the second therapeutic agent is a chemotherapeutic agent or a targeted anti-cancer therapy. Embodiment 104. The method of embodiment 103 wherein the chemotherapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2 (IL-2). Embodiment 105. The method of embodiment 104 wherein the second therapeutic agent is an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof. Embodiment 106. The method of any one of embodiments 90-91, 93, and 95-105, wherein the antibody or antigen-binding fragment or the pharmaceutical composition is administered intravenously, intramuscularly, intraperitoneally, and / or subcutaneously to the subject. Embodiment 107. The method of any one of embodiments 90-91, 93, and 95-106, wherein the antibody or antigen-binding fragment, or the pharmaceutical composition is administered subcutaneously to the subject. Embodiment 108. A method for generating the antibody or antigen-binding fragment of any one of embodiments 72-83, wherein said method comprises culturing the cell of any one of embodiments 87 to 89 and isolating said antibody or antigen-binding fragment. Embodiment 109. A synthetic polynucleotide encoding the antibody or antigenbinding fragment of any one of embodiments 72-83. Embodiment 110. A kit comprising (i) the antibody or antigen-binding fragment of any one of embodiments 72-83 and / or a polynucleotide of embodiment 109 and (ii) packaging for the same. Embodiment 111. A trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a first heavy chain portion (HC1) comprising a first heavy chain variable domain (VH); b) a light chain portion (LC) comprising a light chain variable domain (VL); and c) a second heavy chain portion (HC2) comprising a second VH domain, wherein (i) the HC1 VH and the LC VL domains form a first antigen-binding site that binds a first antigen, (ii) the HC2 VH domain forms a second antigen-binding site that binds a second antigen, (iii) the HC1 or the HC2 further comprise a third VH domain forming a third antigen-binding site that binds a third antigen, (iv) the HC1 and HC2 each optionally comprise a Fragment crystallizable (Fc) domain comprising a CH2-CH3 domain; and wherein the first antigen is cluster of differentiation 3 (CD3), and (v) the second antigen is B cell maturation antigen (BCMA), and the third antigen is G-protein coupled receptor family C group 5 member D (GPRC5D); or (vi) the second antigen is G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen is B cell maturation antigen (BCMA). Embodiment 112. The trispecific antibody or trispecific binding fragment of embodiment 111, wherein the HC2 comprises the third VH domain forming the third antigen-binding site that binds the third antigen. Embodiment 113. The trispecific antibody or trispecific binding fragment of embodiment 112, wherein the HC2 comprises, from N to C-terminus, the second VH domain forming the second antigen-binding site, the Fc domain, a first linker (LI), and the third VH domain forming the third antigen-binding site. Embodiment 114. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-113, wherein the HC2 comprises the second VH domain forming the second antigen-binding site that binds GPRC5D, and the HC2 further comprises the third VH domain forming the third antigen-binding site that binds BCMA. Embodiment 115. The trispecific antibody or trispecific binding fragment of embodiment 111, wherein the HC1 comprises the third VH domain forming the third antigen-binding site that binds the third antigen. Embodiment 116. The trispecific antibody or trispecific binding fragment of embodiment 115, wherein the HC1 comprises, from N to C-terminus, a the first VH forming the first antigen-binding site, a CHI domain, the Fc domain, a first linker (LI), and the third VH domain forming the third antigen-binding site. Embodiment 117. The trispecific antibody or trispecific binding fragment of any one of embodiments 111, 115, and 116, wherein the HC2 comprises the second VH domain forming the second antigen-binding site that binds BCMA, and the HC1 further comprises the third VH domain forming the third antigen-binding site that binds GPRC5D. Embodiment 118. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-117, wherein the HC1 VH and LC VL form the first antigen-binding site comprises an antigen-binding fragment (Fab) comprising the first antigen-binding site. Embodiment 119. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-118, wherein the HC2 VH forms a single-chain variable fragment (scFv) comprising the second antigen-binding site. Embodiment 120. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-119, wherein the third VH forms a single-chain variable fragment (scFv) comprising the third antigen-binding site. Embodiment 121. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-120, wherein the Fc domains of HC1 and HC2 comprise one or more different mutations which promote heterodimerization. Embodiment 122. The trispecific antibody or trispecific binding fragment of embodiment 121, wherein the Fc domain of the HC1 comprise mutations T366S, L368A and Y407V (EU numbering) and the Fc domain of the HC2 comprises mutation T366W (EU numbering). Embodiment 123. The trispecific antibody or trispecific binding fragment of embodiment 121, wherein the Fc domain of the HC2 comprise mutations T366S, L368A and Y407V (EU numbering) and the Fc domain of the HC1 comprises mutation T366W (EU numbering). Embodiment 124. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-123, wherein the Fc domains of HC1 and / or HC2 further comprise one or more mutations which reduce Fc binding to a Fey receptor. Embodiment 125. The trispecific antibody or trispecific binding fragment of embodiment 124, wherein the Fey receptor is FcyRI, FcyRIIA, FcyRIIB, FcyRIIIA, and / or FcyRIIIB. Embodiment 126. The trispecific antibody or trispecific binding fragment of embodiment 124 or 125, wherein the Fc domains of HC1 and / or HC2 each comprise one or more mutations selected from L234A, L235A, and D265S (EU numbering). Embodiment 127. The trispecific antibody or trispecific binding fragment of embodiment 126, wherein the Fc domains of HC1 and HC2 each comprise mutations L234A, L235A, and D265S (EU numbering). Embodiment 128. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-127, wherein the Fc domains of HC1 or HC2 further comprise one or more mutations which reduce Fc binding to protein A. Embodiment 129. The trispecific antibody or trispecific binding fragment of embodiment 128, wherein the Fc domains of HC1 or HC2 comprises mutations H435R and / or Y436F (EU numbering). Embodiment 130. The trispecific antibody or trispecific binding fragment of embodiment 129, wherein the Fc domain of HC1 comprises mutations H435R and Y436F (EU numbering). Embodiment 131. The trispecific antibody or trispecific binding fragment of any one of embodiments 113-114 and 116-130, wherein the first linker (LI) comprises any one of the amino acid sequences of SEQ ID NOs: 25, 127-157, and 163. Embodiment 132. The trispecific antibody or trispecific binding fragment of any one of embodiments 131, wherein the first linker (LI) comprises the amino acid sequence of GGSEGKSSGSGSESKSTGGS (SEQ ID NO: 25) or GGGGSGGGGSGGGGSGGGGS ((G4S)4, SEQ ID NO: 163). Embodiment 133. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-132, wherein the first antigen-binding site that binds CD3 comprises: a heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of GDSVFNNNAAWS (SEQ ID NO: 4), a heavy chain CDR2 comprising the amino acid sequence of RTYYRSKWLYD (SEQ ID NO: 5), and a heavy chain CDR3 comprising the amino acid sequence of GYSSSFDY (SEQ ID NO: 6). Embodiment 134. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-133, wherein the first antigen-binding site that binds CD3 comprises: a light chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of TGTSSNIGTYKFVS (SEQ ID NO: 1), a light chain CDR2 comprising the amino acid sequence of EVSKRPS (SEQ ID NO: 2), and a light chain CDR3 comprising the amino acid sequence of VSYAGSGTLL (SEQ ID NO: 3). Embodiment 135. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-134, wherein the first antigen-binding site that binds CD3 comprises a heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO: 8. Embodiment 136. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-135, wherein the first antigen-binding site that binds CD3 comprises a light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO: 7. Embodiment 137. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-136, wherein the second or third antigen-binding site that binds GPRC5D comprises: a heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of GFSLTNIRMSVS (SEQ ID NO: 12), a heavy chain CDR2 comprising the amino acid sequence of HIFSNDEKS (SEQ ID NO: 13), and a heavy chain CDR3 comprising the amino acid sequence of MRLPYGMDV (SEQ ID NO: 14). Embodiment 138. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-137, wherein the second or third antigen-binding site that binds GPRC5D comprises: a light chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of RSSQSLVHSDGNTYLS (SEQ ID NO: 9), a light chain CDR2 comprising the amino acid sequence of KISNRFF (SEQ ID NO: 10), and a light chain CDR3 comprising the amino acid sequence of MQATQFPHT (SEQ ID NO: 11). Embodiment 139. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-138, wherein the second or third antigen-binding site that binds GPRC5D comprises a heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO: 16. Embodiment 140. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-139, wherein the second or third antigen-binding site that binds GPRC5D comprises a light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO: 15. Embodiment 141. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-140, wherein the second or third antigen-binding site that binds BCMA comprises: a heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a heavy chain CDR2 comprising the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and a heavy chain CDR3 comprising the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22). Embodiment 142. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-141, wherein the second or third antigen-binding site that binds BCMA comprises: a light chain complementarity determining region 1 (CDR1) comprising the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17), a light chain CDR2 comprising the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a light chain CDR3 comprising the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19). Embodiment 143. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-142, wherein the second or third antigen-binding site that binds BCMA comprises a heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO: 24. Embodiment 144. The trispecific antibody or trispecific binding fragment of any one of embodiments 111-143, wherein the second or third antigen-binding site that binds BCMA comprises a light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO: 23. Embodiment 145. The trispecific antibody or trispecific binding fragment of any one of embodiments 119-144, wherein the scFv comprises, from the N- to C-terminus, a VH, a second linker (L2) and a VL (VH-L2-VL); or the VL, the L2 and the VH (VL-L2-VH). Embodiment 146. The trispecific antibody or trispecific binding fragment of any one of embodiments 119-145, wherein the scFv comprises, from the N- to C-terminus, the VL, the L2 and the VH (VL-L2-VH). Embodiment 147. The trispecific antibody or trispecific binding fragment of embodiment 145 or 146, wherein the second linker (L2) comprises any one of the amino acid sequences of SEQ ID NOs: 25, 127-157, and 163. Embodiment 148. The trispecific antibody or trispecific binding fragment of any one of embodiments 145-147, wherein the L2 comprises an amino acid sequence of GGSEGKSSGSGSESKSTGGS (SEQ ID NO: 25). Embodiment 149. The antibody or antigen-binding fragment of any one of embodiments 111 to 148, wherein the first antigen-binding site that specifically binds to residues 22-35 (QDGNEEMGGITQTP (SEQ ID NO: 161)) of the CD3s chain. Embodiment 150. The antibody or antigen-binding fragment of any one of embodiments 111-149, wherein the first antigen-binding site that specifically binds to CD3 with an affinity of about 1 xlO'8 to 1 xlO'7 M. Embodiment 151. The antibody or antigen-binding fragment of embodiment 150, wherein the first antigen-binding site that specifically binds to CD3 with an affinity of about 2xl0'8 to 4 x IO'8 M. Embodiment 152. The antibody or antigen-binding fragment of any one of embodiments 111 to 151, wherein the second or third antigen-binding site specifically binds residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain. Embodiment 153. The antibody or antigen-binding fragment of embodiment 152, wherein the second or third antigen-binding site specifically binds to BCMA with an affinity of about 1 xlO'10 to 1 x 10'7 M. Embodiment 154. The antibody or antigen-binding fragment of embodiment 153, wherein the second or third antigen-binding site specifically binds to BCMA with an affinity of about 2 xlO'10to 9 xlO'10 M. Embodiment 155. The antibody or antigen-binding fragment of any one of embodiments 111 to 154, wherein the antibody or antigen-binding fragment thereof is an IgGl, IgG2, IgG3, or IgG4 isotype. Embodiment 156. The antibody or antigen-binding fragment of any of embodiments 111 to 155 wherein the antibody or antigen-binding fragment thereof is an IgGl isotype. Embodiment 157. The trispecific antibody or trispecific binding fragment of embodiment 111, wherein the HC1 comprises the amino acid sequence of SEQ ID NO: 26. Embodiment 158. The trispecific antibody or trispecific binding fragment of embodiment 111 or 157, wherein the LC comprises the amino acid sequence of SEQ ID NO: 27. Embodiment 159. The trispecific antibody or trispecific binding fragment of embodiment 111, 157 or 158, wherein the HC2 comprises the amino acid sequence of SEQ ID NO: 28. Embodiment 160.     The   trispecific antibody or trispecific binding fragment of embodiment 111, wherein the HC1 comprises the amino acid sequence of SEQ ID NO: 29. Embodiment 161.     The   trispecific antibody or trispecific binding fragment of embodiment 111 or 160, wherein the LC comprises the amino acid sequence of SEQ ID NO: 30. Embodiment 162. The trispecific antibody or trispecific binding fragment of embodiment 111, 160 or 161, wherein the HC2 comprises the amino acid sequence of SEQ ID NO: 31. The invention can also be defined by the following numbered clauses. Clause 1. A trispecific antibody, or a trispecific binding fragment thereof, comprising: a) a first heavy chain (HC1); b) a light chain (LC); and c) a second heavy chain (HC2), wherein (i) the HC1 and the LC form a first antigen-binding site that specifically binds a first antigen, (ii) the HC2 comprises a second antigen-binding site that specifically binds a second antigen, (iii) the HC1 or the HC2 further comprises a third antigen-binding site that specifically binds a third antigen, (iv) the HC1 and HC2 each comprise a Fragment crystallizable (Fc) domain comprising a CH2-CH3 domain; and wherein the first antigen is cluster of differentiation 3 (CD3), and (v) the second antigen is B cell maturation antigen (BCMA), and the third antigen is G-protein coupled receptor family C group 5 member D (GPRC5D); or (vi) the second antigen is G-protein coupl...

Claims

1. A trispecific antibody, or a trispecific binding fragment thereof, comprising:(a) a first antigen-binding arm comprising a first heavy chain variable domain (VH1) and a first light chain variable domain (VL1);(b) a second antigen-binding arm comprising a second heavy chain variable domain (VH2) and a second light chain variable domain (VL2);(c) a third antigen-binding arm comprising a third heavy chain variable domain (VH3) and a third light chain variable domain (VL3),wherein the first antigen-binding arm binds to an epitope on cluster of differentiation 3 (CD3), the second antigen-binding arm binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and the third antigen-binding arm binds to an epitope on B cell maturation antigen (BCMA).

2. The trispecific antibody or trispecific binding fragment of claim 1, wherein the VH1 and VL1 of first antigen-binding arm are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a Fab.

3. The trispecific antibody or trispecific binding fragment of claim 1 or 2, wherein the VH2 and VL2 of the second antigen-binding arm are present in a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a scFv.

4. The trispecific antibody or trispecific binding fragment of any one of claims 1-3, wherein the VH3 and VL3 of the third antigen-binding arm are present in an antibody fragment, a diabody, a Fab, Fab’, a F(ab’)2, a Fv, a scFv, a Fd, a disulfide stabilized Fv fragment (dsFv), or a disulfide stabilized diabody (ds diabody), optionally a scFv.

5. The trispecific antibody or trispecific binding fragment of any one of claims 1-4, wherein the first antigen-binding arm that binds CD3 comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH1) of SEQ ID NO: 8 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL1) of SEQ ID NO: 7.

6. The trispecific antibody or trispecific binding fragment of any one of claims 1-5, wherein the first antigen-binding arm that binds CD3 comprises a HCDR1 comprising the amino acid sequence of GDSVFNNNAAWS (SEQ ID NO: 4), a HCDR2 comprising the amino acid sequence of RTYYRSKWLYD (SEQ ID NO: 5), and a HCDR3 comprising the amino acid sequence of GYSSSFDY (SEQ ID NO: 6); and a LCDR1 comprising the amino acid sequence of TGTSSNIGTYKFVS (SEQ ID NO: 1), a LCDR2 comprising the amino acid sequence of EVSKRPS (SEQ ID NO: 2), and a LCDR3 comprising the amino acid sequence of VSYAGSGTLL (SEQ ID NO: 3).

7. The trispecific antibody or trispecific binding fragment of any one of claims 1-6,wherein the first antigen-binding arm that binds CD3 comprises the VH1 of SEQ ID NO: 8 and the VL1 of SEQ ID NO: 7.

8. The trispecific antibody or trispecific binding fragment of any one of claims 1-7, wherein the second antigen-binding arm that binds GPRC5D comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH2) of SEQ ID NO: 16 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL2) of SEQ ID NO: 15.

9. The trispecific antibody or trispecific binding fragment of any one of claims 1-8, wherein the second antigen-binding arm that binds GPRC5D comprises a HCDR1comprising the amino acid sequence of GFSLTNIRMSVS (SEQ ID NO: 12), HCDR2 comprising the amino acid sequence of HIFSNDEKS (SEQ ID NO: 13), and a HCDR3 comprising the amino acid sequence of MRLPYGMDV (SEQ ID NO: 14); and a LCDR1 comprising the amino acid sequence of RSSQSLVHSDGNTYLS (SEQ ID NO: 9), a LCDR2 comprising the amino acid sequence of KISNRFF (SEQ ID NO: 10), and a LCDR3 comprising the amino acid sequence of MQATQFPHT (SEQ ID NO: 11).

10. The trispecific antibody or trispecific binding fragment of any one of claims 1-9, wherein the second antigen-binding arm that binds GPRC5D comprises the VH2 of SEQ ID NO: 16 and the VL2 of SEQ ID NO: 15.

11. The trispecific antibody or trispecific binding fragment of any one of claims 1-10, wherein the third antigen-binding arm that binds BCMA comprises a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of the heavy chain variable domain (VH3) of SEQ ID NO: 24 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of the light chain variable domain (VL3) of SEQ ID NO: 23.

12. The trispecific antibody or trispecific binding fragment of any one of claims 1-11, wherein the third antigen-binding arm that binds BCMA comprises a HCDR1 comprising the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a HCDR2 comprising the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and a HCDR3 comprising the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22); and a LCDR1 comprising the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17), a LCDR2 comprising the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a LCDR3 comprising the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19).

13. The trispecific antibody or trispecific binding fragment of any one of claims 1-12, wherein the third antigen-binding arm that binds BCMA comprises the VH3 of SEQ ID NO: 24 and the VL3 of SEQ ID NO: 23.

14. The trispecific antibody or trispecific binding fragment of any one of claims 1-4, wherein the first antigen-binding arm that binds CD3 comprises the HCDR1, the HCDR2 and the HCDR3 of the VH1 of SEQ ID NO: 8 and the LCDR1, the LCDR2 and the LCDR3 of the VL1 of SEQ ID NO: 7;the second antigen-binding arm that binds GPRC5D comprises the HCDR1, the HCDR2 and the HCDR3 of the VH2 of SEQ ID NO: 16 and the LCDR1, the LCDR2 and the LCDR3 of the VL2 of SEQ ID NO: 15; andthe third antigen-binding arm that binds BCMA comprises the HCDR1, the HCDR2 and the HCDR3 of the VH3 of SEQ ID NO: 24 and the LCDR1, the LCDR2 and the LCDR3 of the VL3 of SEQ ID NO: 23.

15. The trispecific antibody or trispecific binding fragment of any one of claims 1-4 and 14, wherein the first antigen-binding arm that binds CD3 comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 4, 5, 6, 1, 2, 3, respectively;the second antigen-binding arm that binds GPRC5D comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 12, 13, 14, 9, 10 and 11, respectively; andthe third antigen-binding arm that binds BCMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 20, 21, 22, 17, 18 and 19, respectively.

16. The trispecific antibody or trispecific binding fragment of any one of claims 1-4, 14 and 15, wherein the first antigen-binding arm that binds CD3 comprises the VH1 of SEQ ID NO: 8 and the VL1 of SEQ ID NO: 7;the second antigen-binding arm that binds GPRC5D comprises the VH2 of SEQ ID NO: 16 and the VL2 of SEQ ID NO: 15; andthe third antigen-binding arm that binds BCMA comprises the VH3 of SEQ ID NO: 24 and the VL3 of SEQ ID NO: 23.

17. The trispecific antibody or trispecific binding fragment thereof of any one of claims 1-16, wherein the first antigen-binding arm comprises a Fragment crystallizable (Fc) domain, and the second antigen-binding arm or the third antigen-binding arm comprises a Fc domain.

18. The trispecific antibody or trispecific binding fragment thereof of claim 17, wherein the Fc domains comprise one or more mutations which promote heterodimerization of the Fc domains.

19. The trispecific antibody or trispecific binding fragment of claim 18, wherein the mutations are selected from T366S, L368A, T366W and Y407V (EU numbering).

20. The trispecific antibody or trispecific binding fragment of any one of claims 17-19, wherein the Fc domains further comprise one or more mutations which reduce Fc binding to a Fey receptor.

21. The trispecific antibody or trispecific binding fragment of claim 20, wherein the Fey receptor is Fey RI, FcyRIIA, Fey RUB, FcyRIIIA, and / or FcyRIIIB.

22. The trispecific antibody or trispecific binding fragment of claim 20 or 21, wherein the Fc domains comprise one or more mutations selected from L234A, L235A, and D265S (EU numbering).

23. The trispecific antibody or trispecific binding fragment of any one of claims 17-22, wherein the Fc domains further comprise one or more mutations which reduce Fc binding to protein A.

24. The trispecific antibody or trispecific binding fragment of claim 23, wherein the Fc domain comprises mutations H435R and / or Y436F (EU numbering).

25. The trispecific antibody or trispecific binding fragment of any one of claims 1 to 24, wherein the first antigen-binding arm specifically binds to residues 22-35 (QDGNEEMGGITQTP (SEQ ID NO: 161)) of the CD3s chain.

26. The trispecific antibody or trispecific binding fragment of any one of claims 1-25, wherein the first antigen-binding arm specifically binds to CD3 with an affinity of about 1 xlO'8 to 1 xlO'7 M.

27. The trispecific antibody or trispecific binding fragment of claim 26, wherein the first antigen-binding arm specifically binds to CD3 with an affinity of about 2 xlO'8 to 4 x 10'8 M.

28. The trispecific antibody or trispecific binding fragment of any one of claims 1 to 27, wherein the third antigen-binding arm specifically binds residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain.

29. The trispecific antibody or trispecific binding fragment of any one of claims 1-28, wherein the third antigen-binding arm specifically binds to BCMA with an affinity of about 1 xlO'10 to 1 x 10'7M.

30. The trispecific antibody or trispecific binding fragment of claim 29, wherein the third antigen-binding arm specifically binds to BCMA with an affinity of about 2 xlO'10to 9 xlO'10 M.

31. A trispecific antibody, or a trispecific binding fragment thereof, comprising a first antigen-binding arm that binds to an epitope on cluster of differentiation 3 (CD3), a second antigen-binding arm that binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and a third antigen-binding arm that binds to an epitope on B cell maturation antigen (BCMA), wherein the first antigen-binding arm comprises a heavy chain (HC1) polypeptide and a light chain (LC) polypeptide; andwherein the trispecific antibody, or a trispecific binding fragment thereof, comprises a single polypeptide comprising the second antigen-binding arm and the third antigen-binding arm.

32. The trispecific antibody or trispecific binding fragment of claim 31, wherein the HC1 of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 26.

33. The trispecific antibody or trispecific binding fragment of claim 32 or 33, wherein the LC of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 27.

34. The trispecific antibody or trispecific binding fragment of any one of claims 31-33, wherein the polypeptide comprising the second antigen-binding arm and the third antigen-binding arm comprises an amino acid sequence of SEQ ID NO: 28.

35. The trispecific antibody or trispecific binding fragment of claim 31, wherein the first antigen-binding arm comprises an HC1 comprising the amino acid sequence of SEQ ID NO: 26, and a LC comprising the amino acid sequence of SEQ ID NO: 27, and the polypeptide comprising the second antigen-binding arm and the third antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 28.

36. A trispecific antibody, or a trispecific binding fragment thereof, comprising a first antigen-binding arm that binds to an epitope on cluster of differentiation 3 (CD3), a second antigen-binding arm that binds to an epitope on G-protein coupled receptor family C group 5 member D (GPRC5D), and a third antigen-binding arm that binds to an epitope on B cell maturation antigen (BCMA), wherein the first antigen-binding arm comprises a heavy chain (HC1) polypeptide and a light chain (LC) polypeptide, wherein the heavy chain (HC1) polypeptide further comprises the second antigen-binding arm, wherein the trispecific antibody, or the trispecific binding fragment thereof, further comprises a single polypeptide comprising the third antigen-binding arm.

37. The trispecific antibody or trispecific binding fragment of claim 36, wherein the HC1 of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 29.

38. The trispecific antibody or trispecific binding fragment of claim 36 or 37, wherein the LC of the first antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 30.

39. The trispecific antibody or trispecific binding fragment of any one of claims 36-38, wherein the single polypeptide comprising the third antigen-binding arm comprises an amino acid sequence of SEQ ID NO: 31.

40. The trispecific antibody or trispecific binding fragment of claim 36, wherein the first antigen-binding arm comprises an HC1 comprising the amino acid sequence of SEQ ID NO: 29, and a LC comprising the amino acid sequence of SEQ ID NO: 30, and the single polypeptide comprising the third antigen-binding arm comprises the amino acid sequence of SEQ ID NO: 31.

41. The trispecific antibody or trispecific binding fragment of any one of claims 1-40, wherein the antibody or antigen-binding fragment thereof is an IgGl, IgG2, IgG3, or IgG4 (human) isotype.

42. The trispecific antibody or trispecific binding fragment of any of claims 1-41, wherein the antibody or antigen-binding fragment thereof is an (human) IgGl isotype.

43. A synthetic polynucleotide encoding the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42.

44. A pharmaceutical composition comprising the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42 and a pharmaceutically acceptable carrier.

45. The pharmaceutical composition of claim 44, wherein the pharmaceutical composition further comprises a second therapeutic agent.

46. The pharmaceutical composition of claim 45, wherein the second therapeutic agent comprises an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof.

47. A cell expressing the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42.

48. The cell of claim 47, wherein the cell is a hybridoma.

49. The cell of claim 47 or 48, wherein the trispecific antibody is recombinantlyproduced.

50. A method for treating cancer in a subject in need thereof, said method comprising administering to the subject a therapeutically effective amount of the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42 or the pharmaceutical composition of any one of claims 44-46.

51. The method of claim 50, wherein the trispecific antibody or trispecific binding fragment or the pharmaceutical composition is administered for a time sufficient to treat the cancer.

52. A method for inhibiting growth or proliferation of a cancer cell, said method comprising administering to said cell an effective amount of the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42 or the pharmaceutical composition of any one of claims 44-46, wherein said effective amount is sufficient to inhibit the growth or proliferation of said cancer cell.

53. The method of claim 52, wherein said cancer cell is in a subject and the trispecific antibody or trispecific binding fragment or the pharmaceutical composition is administered to the subject.

54. The method of claim 52, wherein said administration is conducted ex vivo.

55. A method of redirecting a T cell to BCMA and / or GPRC5D-expressing cancer cells in a subject in need thereof, said method comprising administering to said subject a therapeutically effective amount of the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42 or the pharmaceutical composition of any one of claims 44-46.

56. The method of claim 55, wherein the said therapeutically effective amount is sufficient to direct said T cell response to said cancer cells.

57. The method of any one of claims 50-56, wherein the cancer is a hematological cancer.

58. The method of claim 57, wherein the hematological cancer is a BCMA and / or GPRC5D -expressing B cell cancer.

59. The method of claim 58, wherein the BCMA and / or GPRC5D -expressing B cell cancer is multiple myeloma.

60. The method of claim 58 or 59, wherein the BCMA and / or GPRC5D -expressing B cell cancer is smoldering multiple myeloma (SMM).

61. The method of any one of claims 50-60, wherein the cancer is relapsed, refractory, or malignant cancer, or any combination thereof.

62. The method of any one of claims 50-51, 53, and 55-61, wherein the subject has received a prior treatment.

63. The method of claim 62, wherein the prior treatment comprises a proteasome inhibitor, an immunomodulatory drug, a CD38 antibody, a bispecific agent, a CART therapy, or any combination thereof.

64. The method of any one of claims 50-63, further comprising administering a second therapeutic agent.

65. The method of claim 64, wherein the second therapeutic agent is a chemotherapeutic agent or a targeted anti-cancer therapy.

66. The method of claim 65, wherein the chemotherapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2 (IL-2).

67. The method of claim 64, wherein the second therapeutic agent is an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof.

68. The method of any one of claims 50-51, 53, and 55-67, wherein the trispecific antibody or trispecific binding fragment, or the pharmaceutical composition is administered intravenously, intramuscularly, intraperitoneally, and / or subcutaneously to the subject.

69. The method of any one of claims 50-51, 53, and 55-68, wherein the trispecific antibody or trispecific binding fragment, or the pharmaceutical composition is administered subcutaneously to the subject.

70. A method for generating the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42, wherein said method comprises culturing the cell of any one of claims 47 to 49 and isolating said trispecific antibody or trispecific binding fragment.

71. A kit comprising (i) the trispecific antibody or trispecific binding fragment of any one of claims 1 to 42 and / or a polynucleotide of claim 43 and (ii) packaging for the same.

72. An antibody, or an antigen-binding fragment thereof, that binds to BCMA, comprising: a heavy chain complementarity determining region 1 (CDR1) having the amino acid sequence of GFTFSSYAMS (SEQ ID NO: 20), a heavy chain CDR2 having the amino acid sequence of AISGSGGSTY (SEQ ID NO: 21), and aheavy chain CDR3 having the amino acid sequence of DEGYSSGHYYGMDV (SEQ ID NO: 22).

73. The antibody or antigen-binding fragment of claim 72, further comprising: a light chain complementarity determining region 1 (CDR1) having the amino acid sequence of RASQSISSSFLT (SEQ ID NO: 17), a light chain CDR2 having the amino acid sequence of GASSRAT (SEQ ID NO: 18), and a light chain CDR3 having the amino acid sequence of QHYGSSPMYT (SEQ ID NO: 19).

74. The antibody or antigen-binding fragment of claim 72 or 73, comprising a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 24.

75. The antibody or antigen-binding fragment of any one of claims 72-74, comprising a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 23.

76. The antibody or antigen-binding fragment of any one of claims 72-75, wherein the antibody or antigen-binding fragment specifically binds residues 17-26 (LLHACIPCQL (SEQ ID NO: 162)) of BCMA BCMW37 chain.

77. The antibody or antigen-binding fragment of any one of claims 72-76, wherein the antibody or antigen-binding fragment specifically binds to BCMA with an affinity of about 1 xlO'10 to 1 x 10'7 M.

78. The antibody or antigen-binding fragment of claim 77, wherein the antibody or antigen-binding fragment specifically binds to BCMA with an affinity of about 2 xlO'10to 9 xlO'10 M.

79. The antibody or antigen-binding fragment of any one of claims 72-78 wherein the antibody or antigen-binding fragment is a human antibody or antigen-binding fragment.

80. The antibody or antigen-binding fragment of any one of claims 72-79 wherein the antibody or antigen-binding fragment is recombinant.

81. The antigen binding fragment of any one of claims 72 to 80 wherein the antigen binding fragment is a Fab fragment, a Fab2 fragment, or a single chain antibody.

82. The antibody or antigen-binding fragment of any one of claims 72-81 wherein the antibody or antigen-binding fragment thereof is an IgGl, IgG2, IgG3, or IgG4 isotype.

83. The antibody or antigen-binding fragment of any of claims 72-82, wherein the antibody or antigen-binding fragment thereof is an IgGl or an IgG4 isotype.

84. A pharmaceutical composition comprising the antibody or antigen-binding fragment of any one of claims 72-83 and a pharmaceutically acceptable carrier.

85. The pharmaceutical composition of claim 84, wherein the pharmaceutical composition further comprises a second therapeutic agent.

86. The pharmaceutical composition of claim 85, wherein the second therapeutic agent comprises an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof.

87. A cell expressing the antibody or antigen-binding fragment of any one of claims 72-83.

88. The cell of claim 87 wherein the cell is a hybridoma.

89. The cell of claim 87 wherein the antibody is recombinantly produced.

90. A method for treating cancer in a subject in need thereof, said method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment of any one of claims 72-83 or the pharmaceutical composition of any one of claims 84-86.

91. The method of claim 90, wherein the antibody or antigen-binding fragment or the pharmaceutical composition is administered for a time sufficient to treat the cancer.

92. A method for inhibiting growth or proliferation of a cancer cell, said method comprising administering to said cell an effective amount of the antibody or antigen-binding fragment of any one of claims 72-83 or the pharmaceutical composition of any one of claims 84-86, wherein said effective amount is sufficient to inhibit the growth or proliferation of said cancer cell.

93. The method of claim 92, wherein said cancer cell is in a subject and the antibody or antigen-binding fragment or the pharmaceutical composition is administered to the subject.

94. The method of claim 92, wherein said administration is conducted ex vivo.

95. The method of any one of claims 90-94, wherein the cancer is a hematologicalcancer.

96. The method of claim 95, wherein the hematological cancer is a BCMA-expressing B cell cancer.

97. The method of claim 96, wherein the BCMA-expressing B cell cancer is multiple myeloma.

98. The method of claim 97, wherein the BCMA-expressing B cell cancer is smoldering multiple myeloma (SMM).

99. The method of any one of claims 90-98, wherein the cancer is relapsed, refractory, or malignant cancer, or any combination thereof.

100. The method of any one of claims 90-91, 93, and 95-99, wherein the subject has received a prior treatment.

101. The method of claim 100, wherein the prior treatment comprises a proteasome inhibitor, an immunomodulatory drug, a CD38 antibody, a bispecific agent, a CART therapy, or a combination thereof.

102. The method of any one of claims 90-101 further comprising administering a second therapeutic agent.

103. The method of claim 102 wherein the second therapeutic agent is a chemotherapeutic agent or a targeted anti-cancer therapy.

104. The method of claim 103 wherein the chemotherapeutic agent is cytarabine, an anthracycline, histamine dihydrochloride, or interleukin 2 (IL-2).

105. The method of claim 102 wherein the second therapeutic agent is an anti-CD38 agent, an immunomodulatory imide drug (IMiD), an immune checkpoint inhibitor, an immune co-stimulating agent, a gamma secretase inhibitor, a T-cell enhancer, or any combination thereof.

106. The method of any one of claims 90-91, 93, and 95-105, wherein the antibody or antigen-binding fragment or the pharmaceutical composition is administered intravenously, intramuscularly, intraperitoneally, and / or subcutaneously to the subject.

107. The method of any one of claims 90-91, 93, and 95-106, wherein the antibody or antigen-binding fragment, or the pharmaceutical composition is administered subcutaneously to the subject.

108. A method for generating the antibody or antigen-binding fragment of any one of claims 72-83, wherein said method comprises culturing the cell of any one of claims 87 to 89 and isolating said antibody or antigen-binding fragment.

109. A synthetic polynucleotide encoding the antibody or antigen-binding fragment of any one of claims 72-83.

110. A kit comprising (i) the antibody or antigen-binding fragment of any one of claims 72-83 and / or a polynucleotide of claim 109 and (ii) packaging for the same.