Methods of treating cancer with pdgfr alpha inhibitors

AU2022237561B2Pending Publication Date: 2026-08-27ELI LILLY & CO
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
AU2022237561
Authority / Receiving Office
AU · AU
Patent Type
Applications
Current Assignee / Owner
Priority Date
2021-03-19
Filing Date
2022-03-17
Publication Date
2026-08-27
Estimated Expiration
2042-03-17
Patent Text Reader

Abstract

Methods for treating cancer patients with human platelet derived growth factor receptor alpha inhibiting compounds, in which the patient is identified as having a cancer that is human platelet derived growth factor receptor beta negative.
Need to check novelty before this filing date? Find Prior Art

Description

The present invention relates to the field of cancer. More specifically, the present invention relates to the treatment of cancer patients with platelet derived growth factor receptor alpha (“PDGFRa”) inhibiting compounds. Even more particularly, the present invention relates to the treatment of cancer patients with PDGFRa inhibiting compounds, wherein the cancer patients are identified as being PDGFR beta (“PDGFRP”) negative. Cancer is a disease with extensive histoclinical heterogeneity including wide variations in tumor morphology and physiology. Although some conventional histologic and clinical features have been correlated to prognosis, the vast heterogeneity across the forms of cancer, spanning from the cellular to the tissue level, impacts response to therapy and subsequent benefit to the patient. Therefore, selectively treating cancer patients who will benefit from a particular treatment continues to pose a challenge. PDGFRa inhibiting compounds have shown promise as a therapeutic for cancer in preclinical and clinical studies. Despite this promise, PDGFRa inhibiting compounds have failed to meet therapeutic endpoints in some oncology clinical trials. For example, in clinical trials for treating soft tissue sarcoma, LARTRUVO®, an antibody that specifically binds human PDGFRa, failed to meet certain therapeutic endpoints. Thus, a need exists for improved methods for treating patients with PDGFRa inhibiting compounds. In particular, such methods should provide prognostic, diagnostic or predictive value for cancer patients treated with PDGFRa inhibiting compounds. The present disclosure addresses this need by providing methods of treating cancer patients with PDGFRa inhibiting compounds. Although in some instances, methods for treating particular types of cancer, or treating patients with specific therapeutics, have shown promise, with regard to treating cancer patients using PDGFRa inhibiting compounds, no reliable methods currently exist. The present disclosure, surprisingly provides methods of treating cancer patients with PDGFRa inhibiting compounds which provide prognostic, diagnostic or predictive value for cancer patients treated with PDGFRa inhibiting compounds. More particularly, embodiments of the present disclosure provide methods for treating cancer patients having a cancer that is human PDGFRP negative by administering a PDGFRa inhibiting compound. 2022237561   10 Aug 2026 In a first aspect, the present invention provides a method of treating a PDGFRp negative cancer in a human patient, comprising administering to the patient a pharmaceutical composition comprising an effective amount of a PDGFRa inhibiting compound, 5               wherein the PDGFRa inhibiting compound is an antibody, wherein the antibody specifically binds PDGFRa; wherein the antibody which specifically binds PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2; 10               wherein the antibody which specifically binds PDGFRa is administered in simultaneous, separate, or sequential combination with doxorubicin; wherein the cancer is soft tissue sarcoma; wherein the soft tissue sarcoma is leiomyosarcoma; and wherein the patient is female and wherein the female is determined to have a 15         PDGFRp negative cancer. In a second aspect, the present invention provides use of a pharmaceutical composition comprising an effective amount of a PDGFRa inhibiting compound in the manufacture of a medicament for treating a PDGFRp negative cancer in a human patient, wherein the PDGFRa inhibiting compound is an antibody, wherein the 20          antibody specifically binds PDGFRa; wherein the antibody which specifically binds PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2; wherein the antibody which specifically binds PDGFRa is administered in 25          simultaneous, separate, or sequential combination with doxorubicin; wherein the cancer is soft tissue sarcoma; wherein the soft tissue sarcoma is leiomyosarcoma; and wherein the patient is female and wherein the female is determined to have a PDGFRp negative cancer. 30          In a third aspect, the present invention provides a method for determining a cancer where a PDGFRa inhibiting compound is effective for treating the cancer, comprising the steps of: 2022237561   10 Aug 2026 contacting a biological sample from a cancer patient with a first antibody or antigen binding fragment thereof that specifically binds human PDGFRp, wherein a complex of the first antibody or antigen binding fragment thereof and human PDGFRp is formed; 5                contacting with a second antibody or antigen binding fragment thereof, the complex of the human PDGFRp antibody or antigen binding fragment thereof and human PDGFRp, wherein the second antibody comprises a detectable label; detecting a signal provided by said detectable label; and wherein, if the biological sample from the cancer patient is determined as 10          PDGFRp negative the cancer patient is determined as in need of treatment with a PDGFRa inhibiting compound, wherein the PDGFRa inhibiting compound is an antibody or antigen binding fragments which comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2; 15                    wherein the cancer is soft tissue sarcoma; wherein the soft tissue sarcoma is leiomyosarcoma; wherein the patient is female and wherein the female is determined to have a PDGFRp negative cancer; and wherein the biological sample is a tumor sample. 20          In a fourth aspect, the present invention provides an in vitro method of diagnosing a cancer which can be effectively treated by an antibody or antigen binding fragments thereof, that specifically binds human PDGFRa, comprising: a. contacting a biological sample from a cancer patient with an antibody or antigen-binding fragment thereof that specifically binds human PDGFRp, 25                wherein a complex of the PDGFRp antibody or antigen-binding fragment thereof and human PDGFRp is formed; b. removing any non-specifically bound first antibody or antigen-binding fragment thereof; c. detecting and quantifying the human PDGFRp in the biological sample; 30                and wherein the biological sample from the cancer patient is determined to be PDGFRp negative when PDGFRp in the biological sample is determined to be 2022237561   10 Aug 2026 present in less than about 10% of tumor cells of the biological sample, as determined by an IHC assay, wherein, if the biological sample from the cancer patient is determined to be PDGFRP negative the cancer patient is determined as in need of treatment with 5          an antibody or antigen binding fragments thereof, that specifically binds human PDGFRa, wherein the antibody or antigen binding fragments thereof which specifically binds human PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ 10         ID NO: 2; wherein the cancer is soft tissue sarcoma; wherein the soft tissue sarcoma is leiomyosarcoma; wherein the patient is female and wherein the female is determined to have a PDGFRP negative cancer; and 15                   wherein the biological sample is a tumor sample. Embodiments of the present disclosure further provide a method of treating cancer in a patient in need thereof, comprising administering to the patient an effective amount of a PDGFRa inhibiting compound. Specifically, embodiments of the present disclosure provide methods of treating cancer in a patient in need thereof, comprising administering 20 to the patient an effective amount of a PDGFRa inhibiting compound, wherein the patient is identified as having a cancer that is human PDGFRP negative. In yet another embodiment, the present disclosure provides a method of treating a patient having a human PDGFRP negative cancer, comprising administering to the patient an effective amount of a PDGFRa inhibiting compound. 25          Accordingly, embodiments of the present disclosure provide methods of treating cancer in a patient comprising identifying a patient as having a cancer that is human PDGFRP negative. In an embodiment the present disclosure provides a method of treating cancer in a patient in need thereof, comprising identifying the patient as having a cancer that is human PDGFRP negative, and administering an effective amount of a 30 PDGFRa inhibiting compound to the patient. In a further embodiment the present disclosure provides a method of treating cancer in a patient in need thereof, by administering to the patient an effective amount of a PDGFRa inhibiting compound, 2022237561   10 Aug 2026 wherein the patient is identified as having a cancer that is human PDGFRp negative and human PDGFRa positive. In some embodiments of the present disclosure methods of identifying a patient as having a cancer that is human PDGFRp negative comprise, contacting a biological 5 sample from the patient with an antibody that specifically binds human PDGFRp, and detecting binding of the antibody to human PDGFRp in the biological sample. According to embodiments of the present disclosure, a method of detecting PDGFRp in a biological sample is provided. Such methods comprise performing an assay on a biological sample from the patient. Embodiments of the present disclosure 10 further provide a method comprising contacting the biological sample with an antibody that specifically binds human PDGFRp and detecting binding of the antibody to human PDGFRp in the biological sample. According to embodiments of the present disclosure, a method of diagnosing a patient with cancer as in need of treatment with a PDGFRa inhibiting compound is 15 provided. Such methods comprise identifying the patient as having a cancer that is human PDGFRP negative. Such methods further comprise performing an assay on a biological sample from the patient. Embodiments of the present disclosure further provide a method comprising contacting the biological sample with an antibody that specifically binds human PDGFRP and detecting binding of the antibody to human PDGFRP in the biological sample. According to embodiments of the present disclosure, a method of quantifying human PDGFRP in a biological sample is provided. Such methods comprise contacting a biological sample from a patient with an antibody that specifically binds human PDGFRP and detecting binding of the antibody to human PDGFRP in the biological sample. In an embodiment of the present disclosure, the biological sample is determined to be PDGFRP negative when PDGFRP in the biological sample is determined to be present in less than about 10% of tumor cells of the biological sample. In yet other embodiments the biological sample is determined to be PDGFRP positive when PDGFRP in the biological sample is determined to be present in greater than or equal to about 10% of tumor cells of the biological sample. In a further embodiment of the present disclosure the patient is administered a PDGFRa inhibiting compound if the biological sample from the patient is determined to be PDGFRP negative. In particular embodiments the present disclosure provides a method of diagnosing a cancer patient as in need of treatment with a PDGFRa inhibiting compound, comprising the steps of: obtaining a biological sample from the patient; contacting the biological sample with an antibody or antigen-binding fragment thereof that specifically binds human PDGFRP, wherein a complex of the antibody or antigen-binding fragment thereof and human PDGFRP is formed; contacting with a second antibody or antigen binding fragment thereof, the complex of the human PDGFRP antibody or antigen-binding fragment thereof and human PDGFRP, wherein the second antibody comprises a detectable label; detecting a signal provided by said detectable label; and wherein, if the biological sample from the cancer patient is determined as PDGFRP negative the cancer patient is diagnosed as in need of treatment with a PDGFRa inhibiting compound. In a further embodiment the present disclosure comprises the step of administering to the cancer patient an effective amount of a PDGFRa inhibiting compound, if the biological sample is determined to be PDGFRP negative. An embodiment of the present disclosure, provides an in vitro method of diagnosing a cancer patient as in need of treatment with an antibody or antigen binding fragments thereof, that specifically binds human PDGFRa, comprising: obtaining a biological sample from the patient; contacting the biological sample with an antibody or antigen-binding fragment thereof that specifically binds human PDGFRP, wherein a complex of the PDGFRP antibody or antigen-binding fragment thereof and human PDGFRP is formed; removing any non-specifically bound PDGFRP antibody or antigenbinding fragment thereof; detecting and quantifying the human PDGFRP in the biological sample; and wherein, if the biological sample from the cancer patient is determined to be PDGFRP negative the cancer patient is diagnosed as in need of treatment with an antibody or antigen binding fragment thereof, that specifically binds human PDGFRa. In yet further embodiments the step of detecting human PDGFRP in the biological sample comprises detecting with a second antibody or antigen binding fragment thereof, the complex of the PDGFRP antibody or antigen-binding fragment thereof and human PDGFRP in the biological sample. In yet even further embodiments of the present disclosure, at least one of the PDGFRP antibody or antigen binding fragment thereof, or the second antibody or antigen binding fragment thereof, comprises a detectable label. In yet a further embodiment said step of detecting human PDGFRP in the biological sample comprises detecting a signal provided by the detectable label upon formation of the complex comprising, the PDGFRP antibody and human PDGFRP or the second antibody and human PDGFRp. In yet a further embodiment said step of detecting human PDGFRP in the biological sample comprises detecting a signal provided by the detectable label upon formation of the complex comprising, the antibody, human PDGFRp, and the second antibody. Further embodiments of the present disclosure comprise the step of administering to the cancer patient an effective amount of an antibody specifically binding PDGFRa, if the biological sample is determined to be PDGFRp negative. In embodiments of the present disclosure the PDGFRa inhibiting compound is an antibody or an antigen binding fragment thereof. In other embodiments of the present disclosure the PDGFRa inhibiting compound is a small molecule inhibitor. In particular embodiments, the PDGFRa inhibiting compound is an antibody that specifically binds PDGFRa. In even more particular embodiments, the antibody specifically binding PDGFRa is olaratumab. In some embodiments the PDGFRa inhibiting compound is an antibody drug conjugate. In some embodiments the PDGFRa inhibiting compound is an antibody where the antibody is labeled with a radiopharmaceutical targeting agent. According to some embodiments, antibodies are provided that specifically bind PDGFRa. In more specific embodiments, the antibody that specifically binds PDGFRa comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises heavy chain complementarity determining regions (HCDR) HCDR1, HCDR2, and HCDR3, and the VL comprises light chain complementarity determining regions (LCDR) LCDR1, LCDR2, and LCDR3, wherein: the HCDR1 comprises SEQ ID NO: 5, the HCDR2 comprises SEQ ID NO: 6, the HCDR3 comprises SEQ ID NO: 7, the LCDR1 comprises SEQ ID NO: 8, the LCDR2 comprises SEQ ID NO: 9, and the LCDR3 comprises SEQ ID NO: 10. In a further embodiment, the VH of the antibody that specifically binds PDGFRa comprises SEQ ID NO: 3 and the VL comprises SEQ ID NO: 4. In yet even a further embodiment, the antibody which specifically binds PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2. In yet a particular embodiment, the antibody which specifically binds PDGFRa is olaratumab. In yet further embodiments of the present disclosure, an effective amount of antibody or antigen binding fragment thereof, that specifically binds PDGFRa is administered to a patient identified as having a cancer that is human PDGFRp negative. In such embodiments an effective amount of antibody or antigen binding fragment thereof is administered to the patient identified as having a cancer that is human PDGFRp negative at a loading dose of about 15 mg / kg, or about 20 mg / kg, or about 25 mg / kg on each of day 1 and day 8 of a first 21-day cycle or on each of day 1 and day 8 of a first 28-day cycle, followed by administering a standard dose of the antibody or antigen binding fragment thereof to the patient, at about 15 mg / kg, about 20 mg / kg, or about 25 mg / kg on each of day 1 and day 8 of a subsequent 21-day cycle or on each of day 1 and day 8 of a subsequent 28-day cycle. In yet a further embodiment the antibody or antigen binding fragment thereof is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents. In an embodiment the chemotherapeutic agent comprises at least one of nab-paclitaxel, doxorubicin, gemcitabine, or docetaxel. In yet further embodiments of the present disclosure, an effective amount of olaratumab is administered to a patient identified as having a cancer that is human PDGFRp negative. In such embodiments an effective amount of olaratumab is administered to the patient identified as having a cancer that is human PDGFRp negative, at a loading dose of about 15 mg / kg, or about 20 mg / kg, or about 25 mg / kg, on each of day 1 and day 8 of a first 21-day cycle or on each of day 1 and day 8 of a first 28-day cycle, followed by administering a standard dose of olaratumab to the patient at about 15 mg / kg, about 20 mg / kg, or about 25 mg / kg, on each of day 1 and day 8 of a subsequent 21-day cycle or on each of day 1 and day 8 of a subsequent 28-day cycle. In yet a further embodiment olaratumab is administered in simultaneous, separate, or sequential combination with one or more chemotherapeutic agents. In an embodiment the chemotherapeutic agent comprises at least one of nab-paclitaxel, doxorubicin, gemcitabine, or docetaxel. In some embodiments of the present disclosure, the cancer determined as PDGFRp negative is soft tissue sarcoma, pancreatic cancer, endometrial cancer, ovarian cancer, osteosarcoma, chondrosarcoma, rhabdomyosarcoma, breast cancer, bone cancer, or prostate cancer. In some embodiments the cancer is leiomyosarcoma. In some embodiments the cancer is liposarcoma. In an embodiment of the present disclosure the cancer is a primary tumor. In an embodiment the cancer is a metastatic cancer. In yet other embodiments the cancer has metastasized. In particular embodiments of the present disclosure the patient is female, and the female is determined to have a PDGFRp negative cancer. Platelet derived growth factor receptor alpha (PDGFRa) and platelet derived growth factor receptor beta (PDGFRP) belong to the type III tyrosine kinase receptor (RTK) family and are implicated in various cancer types. PDGFRa has been considered as a relevant factor in tumor proliferation, angiogenesis, and metastatic dissemination in various cancer types. The terms “PDGFR alpha inhibiting compound” or “PDGFR alpha inhibitor” as used interchangeably herein, is a compound that decreases, blocks, inhibits, abrogates, or interferes with signal transduction resulting from the interaction of PDGFRa with either one or more of its ligands or binding partners. PDGFRa inhibiting compounds can be extracellular inhibitors or intracellular inhibitors and more than one inhibitor may be 7 employed. Extracellular inhibitors include, but are not limited to, compounds that bind to PDGFRa or one or more of its ligands (for example, PDGF-AA, -AB, -BB, -CC). Intracellular inhibitors include, but are not limited to, small molecule receptor tyrosine kinase inhibitors. Non-limiting examples of PDGFRa inhibiting compounds include antibodies, antigen binding fragments thereof, small molecule inhibitors, antibody drug conjugates, fusion proteins, immunoadhesin molecules, and oligopeptides. The terms “antibody,” and ‘antigen binding fragments thereof as used herein, refers to an immunoglobulin molecule that specifically binds an antigen. In an embodiment the antibody or antigen binding fragment thereof specifically binds PDGFRa. An exemplary antibody of the present disclosure is an immunoglobulin G type 1 (IgGl) antibody or antigen binding fragment thereof. According to particular embodiments, such antibody or antigen binding fragment thereof, comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises CDRs HCDR1, HCDR2 and HCDR3 and the VL comprises complementarity determining regions (CDRs) LCDR1, LCDR2, and LCDR3 wherein HCDR1 has the amino acid sequence of SEQ ID NO: 3, HCDR2 has the amino acid sequence of SEQ ID NO: 4, and HCDR3 has the amino acid sequence of SEQ ID NO: 5, LCDR1 has the amino acid sequence of SEQ ID NO: 6, LCDR2 has the amino acid sequence of SEQ ID NO: 7, and LCDR3 has the amino acid sequence of SEQ ID NO: 8. According to some embodiments the antibody or antigen binding fragment thereof provided by the present disclosure, the VH has the amino acid sequence of SEQ ID NO: 3 and the VL has the amino acid sequence of SEQ ID NO: 4. According to some embodiments the antibody or antigen binding fragment thereof provided by the present disclosure, comprises a light chain (LC) and a heavy chain (HC) wherein the HC has the amino acid sequence of SEQ ID NO: 1 and the LC has the amino acid sequence of SEQ ID NO: 2. In an embodiment of the present disclosure the antibody is olaratumab. According to some embodiments, antibodies of the present disclosure may be humanized. In some embodiments, antibodies of the present disclosure comprise an IgGl heavy chain. In some embodiments, antibodies of the present disclosure comprise a kappa light chain. According to even further embodiments, the present disclosure provides pharmaceutical compositions comprising an antibody of the present disclosure and one or more pharmaceutically acceptable carriers, diluents or excipients. Embodiments of an antibody include a monoclonal antibody, polyclonal antibody, human antibody, humanized antibody, chimeric antibody, bispecific or multispecific antibody, or conjugated antibody. The antibodies can be of any class (e.g., IgG, IgE, IgM, IgD, IgA), and any subclass (e.g., IgGl, IgG2, IgG3, IgG4). Assignment of amino acid residues to the CDRs may be done according to the well-known schemes, including those described in Kabat (Kabat et al., “Sequences of Proteins of Immunological Interest,” National Institutes of Health, Bethesda, Md. (1991)), Chothia (Chothia et al., “Canonical structures for the hypervariable regions of immunoglobulins”, Journal of Molecular Biology, 196, 901-917 (1987); Al-Lazikani et al., “Standard conformations for the canonical structures of immunoglobulins”, Journal of Molecular Biology, 273, 927-948 (1997)), North (North et al., “A New Clustering of Antibody CDRLoop Conformations”, Journal of Molecular Biology, 406, 228-256 (2011)), or IMGT (the international ImMunoGeneTics database available on at www.imgt.org; see Lefranc et al., Nucleic Acids Res. 1999; 27:209-212). The term “specifically binds PDGFRa” or “binds PDGFRa” as used herein, refers to an interaction of an antibody with an epitope region of human PDGFRa as provided in e.g., NCBI reference sequence P16234.1 (SEQ ID NO: 11). As used herein, the term “specifically binds PDGFRP” or “binds PDGFRP“ refers to an interaction of an antibody with an epitope region of human PDGFRP as provided in e.g., NCBI reference sequence P09619.1 (SEQ ID NO: 12). The terms “PDGFRP negative” or “PDGFRP positive” as used herein, refer to whether the form of cancer of a patient is a PDGFRP negative or PDGFRP positive form of cancer. As detailed herein, whether the form of cancer of a patient is a PDGFRP negative or PDGFRP positive form of cancer may be determined based on a qualitative or quantitative determination. According to embodiments here, whether the form of cancer of a patient is a PDGFRP negative or PDGFRP positive form of cancer may be determined based on an assessment of approximate levels of PDGFRP present in a biological sample from a cancer patient when compared to a reference value. According to a more particular embodiment, a patient is determined to have a PDGFRP negative form of cancer when the approximate level of PDGFRP present in the biological sample is less than about 10% of tumor cells in a biological sample from the patient, as determined by an IHC assay. In another embodiment, a patient is determined to have a PDGFRp negative form of cancer based on levels of PDGFRp as determined by a grading system using reference value(s). Levels of PDGFRp, as provided by assays of the present disclosure or assays known in the art, may be absolute values (e.g., level within a biological sample) or relative values (e.g., level compared to a reference). Levels of PDGFRp in tumor cells can be evaluated via assays including, but not limited to, immunohistochemistry (IHC), polymerase chain reaction (PCR), quantitative, qualitative or semi-quantitative reverse transcription PCR (RT-PCR), applications of automated or semi-automated image analysis of IHC or other quantitative / semi-quantitative / qualitative assessments of protein expression or mRNA expression, artificial intelligence analysis of scanned slides or other laboratory acquired data for protein expression, brightfield in situ hybridization (BRISH), fluorescent in situ hybridization (RNA FISH), protein immunofluorescence, quantitative / semi-quantitative / qualitative proteomics methods, cytological assays, and RNA sequencing. A “reference value” as used herein refers to a known, or approximate level of a reference value that can be an absolute or relative level, a range, a minimum level, a mean level, a threshold level, and / or a median level. Additionally, a reference value can also serve as a baseline or threshold value. According to a particular embodiment as used herein, a “reference value” of PDGFRp indicates whether a form of cancer of a patient is a PDGFRP negative or positive form of cancer. The terms “biological sample” or “patient sample” used interchangeably herein, refers to a human sample. Non-limiting sources of a biological sample for use in the present invention include cancer, tumors, tumor biopsy, biopsy aspirates, solid tissues, tumor cells, and metastatic, migrating, circulating tumor cells. Additionally, biological sample may also refer to blood, plasma, serum, lymph fluid, ascites, fluidic extracts, the external sections of the skin, respiratory, nasal, intestinal, and genitourinary tracts, tears, saliva, milk, organs, cell cultures and / or cell culture constituents. The term "about" as used herein, means within 5%. The term “cancer” as used herein, is a disease pathologically characterized by the physiological condition in a mammal that is typically characterized by unregulated cell proliferation, immortality, metastatic potential, rapid growth and proliferation rate, and / or certain characteristic morphological features. Often, cancer cells are in the form of a tumor, but such cells may exist alone or may circulate in the blood stream as independent cells, such as leukemic cells, or metastatic, migrating, or circulating, tumor cells. The cancer may be a solid tumor or a leukemia. Tumors may be benign, malignant, or dormant and may also be characterized as primary tumors or metastatic tumors. In some embodiments, non-limiting examples of cancer include soft tissue sarcoma, pancreatic cancer, endometrial cancer, osteosarcoma, chondrosarcoma, rhabdomyosarcoma, breast cancer, bone cancer, prostate cancer, gastrointestinal cancer, colon cancer, squamous cell carcinoma, head and neck cancer, small-cell lung cancer, non-small cell lung cancer, glioblastoma, cervical cancer, ovarian cancer, bladder cancer, hepatoma, colorectal cancer, salivary gland carcinoma, kidney cancer, vulval cancer, thyroid cancer, hepatic cancer, and / or laryngeal cancer. The terms “soft tissue sarcoma” or “STS” as used herein, is a type of cancer that begins in the tissues that connect, support and surround other body structures. This includes fat, muscle, fibrous tissues, blood vessels, nerves, tendons, linings of joints, or deep skin tissues, and / or the lining of joints. They can be found in any part of the body. More than 50 subtypes of soft tissue sarcoma exist. Types of STS include, but are not limited to, angiosarcoma, dermatofibrosarcoma protuberans, epithelioid sarcoma, gastrointestinal stromal tumor (GIST), Kaposi's sarcoma, liposarcoma, malignant peripheral nerve sheath tumors, myxofibrosarcoma, rhabdomyosarcoma, solitary fibrous tumor, synovial sarcoma, or undifferentiated pleomorphic sarcoma. Chemotherapeutic agents are chemical agents or drugs that are selectively destructive to cancer cells and tissues. Chemotherapeutics may include but are not limited to compounds such as, taxane compounds, compounds that act via taxane mechanisms, platinum compounds, anthracycline compounds, antimetabolites, epipodophyllotoxin compounds, camptothecin compounds, or any combination thereof. Chemotherapy drugs can be administered alone or in combination with other therapeutic agents. In some embodiments a chemotherapeutic agent comprises nab-paclitaxel, doxorubicin, docetaxel, or gemcitabine. The term “diagnosis” as used herein, is used to refer to the identification or classification of a molecular or pathological state, disease or condition (e.g., cancer). For example, “diagnosis” may refer to identification of a particular type of cancer. “Diagnosis” may also refer to the classification of a particular subtype of cancer, e.g., by histopathological criteria, or by molecular features (e.g., a subtype characterized by expression of one or a combination of biomarkers (e.g., particular genes or proteins encoded by said genes, or expression levels of particular genes or proteins encoded by said genes)). Embodiments of the present disclosure also pertain to methods of clinical diagnosis, or prognosis, of a subject performed by a medical professional using the methods disclosed herein. The methods, as described herein, can, for example, be performed by an individual, a health professional, or a third party, for example a service provider who interprets information from the subject. As explained herein, a medical professional may initiate or modify treatment after receiving information regarding a diagnostic method of the present disclosure. For example, a medical professional may recommend a therapy, a change in therapy or an additional diagnostic assessment. The terms “treat” or “treating” or “treatment” as used herein, refer to processes involving a slowing, interrupting, arresting, controlling, stopping, reducing, regressing, and / or reversing the progression or severity of an existing disease such as cancer, but does not necessarily involve a total elimination of the disease, or disease state. The term an “effective amount” as used herein, refers to an amount of a protein or nucleic acid or vector or composition or inhibiting compound that will elicit the biological or medical response of a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, slow or delay disease progression, or prevent a disease, etc. In a non-limiting embodiment, the term “effective amount” refers to an amount necessary (at dosages and for periods of time and for the means of administration) of a protein or nucleic acid or vector or composition or inhibiting compound that, when administered to a subject, is effective to at least partially alleviate, inhibit, prevent and / or ameliorate a condition, or a disorder or a disease to achieve the desired therapeutic result. An effective amount of the protein or nucleic acid or vector or composition or inhibiting compound may vary according to factors such as the disease type and state, age, sex, and weight of the individual, and the ability of the protein or nucleic acid or vector or composition, or therapeutic, such as an antibody, to elicit a desired response in the individual. An effective amount is also one in which any toxic or detrimental effects of the protein or nucleic acid or vector or composition or 12 inhibiting compound of the present invention are outweighed by the therapeutically beneficial effects. The terms “patient,” “subject,” and “individual,” as used interchangeably herein, refers to a human. In certain embodiments, the patient is further characterized with a disease, disorder, or condition (e.g., cancer). In another embodiment, the patient is further characterized as being at risk of developing a disorder, disease, or condition (metastasis, growth, spread of the cancer or tumor) and would benefit from a reduction in the risk of metastasis, growth, spread of the cancer or tumor. An antibody of the present invention can be incorporated into a pharmaceutical composition which can be prepared by methods well known in the art and comprise an antibody of the present invention and one or more pharmaceutically acceptable carrier(s) and / or diluent(s) (e.g., Remington, The Science and Practice of Pharmacy, 22nd Edition, Loyd V., Ed., Pharmaceutical Press, 2012, which provides a compendium of formulation techniques as are generally known to practitioners). Suitable carriers for pharmaceutical compositions include any material which, when combined with an antibody of the present invention, retains the molecule’s activity and is non-reactive with the patient’s immune system. A pharmaceutical composition comprising an antibody of the present invention can be administered to a patient at risk for, or exhibiting, diseases or disorders as described herein by parental routes (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular, or transdermal). EXAMPLES Example 1: Assessment of Overall Survival in PDGFRB negative advanced or metastatic Soft Tissue Sarcoma patients Study Design: Patients with advanced or metastatic soft tissue sarcoma are treated with olaratumab (20 mg / kg loading dose on Days 1 and 8 of a 21-day cycle in Cycle 1, followed by 15 mg / kg on Days 1 and 8 in subsequent 21-day cycle) in combination with doxorubicin (75 mg / m2 on Day 1) (“investigational cohort”) and compared to patients treated with placebo (on Days 1 and 8) plus doxorubicin (75 mg / m2 on Day 1) (“control cohort”). Patients are treated for 8 cycles, followed by olaratumab monotherapy or placebo until evidence of progressive disease, unacceptable toxicity or death. PDGFR0 tumor expression status of patients is determined substantially as described herein. Patients are assessed for median overall survival (OS). Methods of determining PDGFRfi expression. PDGFRP expression in tumor cells can be evaluated via methods including, but not limited to, immunohistochemistry, quantitative, qualitative or semi-quantitative reverse transcription PCR (RT-PCR), applications of automated or semi-automated image analysis of IHC or other quantitative / semi-quantitative / qualitative assessments of protein expression, artificial intelligence analysis of scanned slides or other laboratory acquired data for protein expression, brightfield in situ hybridization (BRISH), fluorescent in situ hybridization (RNA FISH), protein immunofluorescence, quantitative / semi-quantitative / qualitative proteomics methods and RNA sequencing. Immunohistochemistry Assay to determine PDGFRp expression . For immunohistochemistry analysis, tumor tissue from patients is collected, formalin-fixed in 10% neutral buffered formalin, and paraffin-embedded (FFPE). PDGFRP protein expression on tumor cells is assessed by immunohistochemistry. Briefly, from FFPE tissue blocks containing the patient tumor tissue, a 4-6 micrometer section is obtained and placed on a positively charged glass slide. Anti-PDGFRp mouse monoclonal antibody 2B3 is used to detect expression of PDGFRp (clone 2B3, Cell Signaling Technology® catalog number 3175S), diluted in Dako Primary Antibody Diluent with Background Reducing Components (Dako / Agilent catalog number S3022) at 0.25 pg / mL. Immunohistochemistry is performed on a Dako Autostainer Link 48 / PT Link Incubator. Deparaffinization with the Link 48 / PT Link Incubator is accomplished at 97 °C for 20 minutes. Target retrieval is next accomplished with immersion of the unstained slides into EnVision™ FLEX Target Retrieval Solution High pH (Dako) on the Dako Link48 / PT Link Incubator. Following a rinse in RT EnVision™ FLEX Wash Buffer (lx), specific immunohistochemical staining with the 2B3 antibody is accomplished by FLEX Peroxidase Block for 5 minutes, application of the 0.25 ug / mL concentration of anti-human PDGFRP antibody 2B3 with incubation for 60 minutes, followed by FLEX / HRP application and incubation for 20 minutes, then application of FLEX DAB+ Substrate Chromogen for 10 minutes, and finally FLEX hematoxylin for 5 minutes. Ready-to-use FLEX Mouse Negative Control (Dako / Agilent catalog number IR750) is performed alongside PDGFRP staining and used as a quality control (negative control) for the assay. Stained slides are then evaluated by trained personnel using a brightfield microscope. PDGFRP tumor expression status is provided dichotomously as “positive” or “negative”, where a “positive” result is defined as samples where at least 10% of the tumor cells present (rounded to the nearest decile) demonstrate at least weak but specific membranous staining (1+ on a 0, 1+, 2+, 3+ scale of staining intensity, with 1+ being weakest but still specific membrane staining and 3+ being strong and diffuse membrane staining). “Negative” corresponded to staining that did not meet these criteria. Results: STS Patients'. As demonstrated in Table 1, STS patients identified as having PDGFRP negative tumor status had a significant improvement in median OS of 28.32 months in the investigational cohort when compared to 20.57 months for patients in the control cohort (HR=0.85 [95% CI: 0.54-1.33] p=0.4861). Furthermore, patients in the investigational cohort identified as having both PDGFRP negative tumors status and PDGFRa positive tumor status also showed a significant improvement in median OS of 28.5 months (N=66) vs. 20.6 months (N=75) in the control cohort. However, no significant differences in median OS between the investigational and control cohort were observed in patients whose tumor status was identified as, PDGFRP positive (18.8 months vs 19.9 months respectively for the investigational and control cohort), PDGFRa positive (17.2 months vs 19.1 months respectively for the investigational and control cohort), and PDGFRa negative (23.6 months vs 21.9 months respectively for the investigational and control cohort). Table 1: Median OS in STS Patients Category of Patients Olaratumab + Doxorubicin Placebo + Doxorubicin N Median OS months (95% CI) N Median OS months (95% ci) HR (95% CI) p-value PDGFRP negative 66 28.32 (14.42 - NA) 75 20.57 (16.49 - NA) 0.85 (0.54 - 1.33) p=0.4861 PDGFRP positive 163 18.79 (15.24 - 21.19) 160 19.88 (15.57 23.75) 1.10 (0.84 - 1.44) p=0.4759 N = patients treated in investigation cohort or control cohort; OS = Overall Survival; HR = Hazard Ratio; CI = confidence interval, p-value = Stratified Log-rank p-value. LMS Patients'. As demonstrated in Table 2, LMS patients in the investigational cohort identified as having PFGDRP negative tumor status had a significant improvement in median OS of 29.11 months (N=29) compared to 21.88 months (N=37) in the control cohort (HR=0.65 [95% CI: 0.33-1.25; p=0.1970). However, no differences in median OS in LMS patients identified as having PDGFRP positive tumor status was observed between the investigational cohort (20.14 months; N=77) and the control cohort (21.39 months; N=73) (HR=1.05 [95% CI: 0.71-1.55; p=0.7951). LMS Female Patients'. Analysis of PDGFRP status in LMS female patients, showed a significant improvement in OS HR in the subpopulation of LMS female patients identified as having PDGFRP negative tumor status (0.55; N = 53; p = 0.14) when compared to OS HR for LMS female patients identified as having PDGFRP positive tumor status (1.34; N = 115; p = 0.20). Further adjusting for ECOG PS, the OS HR for PDGFRP positive women with LMS was 1.34 (N = 115; p = 0.20), while the OS HR for PDGFRP negative women with LMS was 0.55 (N = 53; p= 0.14) . This difference in OS HR between PDGFRP positive and negative women with LMS resulted in a statistically significant “treatment by PDGFRP ” interaction (N = 168; p = 0.040). LMS Patients, where LMS Female Patients having PDGFR / 3positive tumor status are excluded. As demonstrated in Table 2, LMS patients, where the LMS Female Patients identified as having PDGFRP positive tumor status are excluded from the LMS Median OS analysis, a significant overall survival benefit in the investigational cohort of 28.5 months (N=58) is observed when compared to 20.9 months (N=61) in the control cohort (HR = 0.60; N=119; p = 0.035). This interaction of PDGFRP expression status is not observed for men with LMS. Table 2. Median OS in LMS Patients Category of Patients Olaratumab + Doxorubicin Placebo + Doxorubicin N Median OS months (95% CI) N Median OS months (95% CI) Hazard Ratio (95% CI) p-value LMS PDGFRP negative 29 29.11 (20.73, NA) 37 21.88 (16.72, 35.55) 0.65 (0.33, 1.25) p=0.1970 LMS PDGFRp positive 77 20.14 (13.08, 22.11) 73 21.39 (15.57, 24.57) 1.05 ((0.71, 1.55) p=0.7951 LMS Patients excluding PDGFRp positive Females 58 28.5 61 20.9 0.60; p = 0.035 SI = patients treated in investigation cohort or control cohort; OS = Overall Survival; HR = Hazard Ratio; CI = confidence interval; p-value = stratified Log-rank p-value. Example 2: Assessment of Overall Survival in PDGFRB negative non-resectable metastatic Pancreatic Cancer patients Study Design'. Median overall survival of patients with PDGFR0 negative non-resectable metastatic Pancreatic cancer are treated with olaratumab in a dose escalation schedule (15 mg / kg, 20 mg / kg, or 25 mg / kg administered on days 1, 8, and 15 of a 28-day cycle) in combination with nab-paclitaxel and gemcitabine (administered on days 1, 8, and 15 for a 28-day cycle per USPI insert). Patients with non-resectable metastatic Pancreatic cancer are treated with olaratumab on days 1, 8, and 15 of a 28-day cycle followed by administration of nab-paclitaxel (125 mg / m2), and gemcitabine (1000 mg / m2) on days 1, 8, and 15 of each 28-day cycle. Patients are assessed for overall survival. Example 3: Assessment of Overall Survival in PDGFRB negative advanced Soft Tissue Sarcoma patients Study Design'. Median overall survival of patients with PDGFR0 negative advanced or metastatic soft tissue sarcoma are treated with olaratumab in a dose escalation study at 15 mg / kg of olaratumab (administered on days 1 and 8) or 20 mg / kg of olaratumab (administered on days 1 and 8), in combination with gemcitabine administered at 900 mg / m2 on days 1 and 8 and docetaxel administered at 75 mg / m2 on day 8 of a 21-day cycle. Patients are assessed for overall survival. SEQUENCES SEQ ID NO: 1     (HC of human PDGFR alpha antibody) MGWSCIILFLVATATGVHSQLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWG WLRQSPGKGLEWIGSFFYTGSTYYNPSLRSRLTISVDTSKNQFSLMLSSVTAADT AVYYCARQSTYYYGSGNYYGWFDRWDQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 2 (LC of human PDGFR alpha antibody) MGWSCIILFLVATATGVHSEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQ QKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSN WPPAFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGEC SEQ ID NO: 3     (VH of human PDGFR alpha antibody) QLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWGWLRQSPGKGLEWIGSFFY TGSTYYNPSLRSRLTISVDTSKNQFSLMLSSVTAADTAVYYCARQSTYYYGSGNY YGWFDRWDQGTL VT VS S SEQ ID NO: 4 (VL of human PDGFR alpha antibody) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRAT GIPARF SGSGSGTDFTLTIS SLEPEDF AVYYCQQRSNWPP AFGQGTKVEIK SEQ ID NO: 5     (HCDR1 of human PDGFR alpha antibody) SSSYY SEQ ID NO: 6 (HCDR2 of human PDGFR alpha antibody) SFFYTGSTYYNPSLRS SEQ ID NO: 7 (HCDR3 of human PDGFR alpha antibody) QSTYYYGSGNYYGWFDR SEQ ID NO: 8 (LCDR1 of human PDGFR alpha antibody) RASQSVSSYLA SEQ ID NO: 9 (LCDR2 of anti-human PDGFR alpha antibody) DASNRAT SEQ ID NO: 10 (LCDR3 of human PDGFR alpha antibody) QQRSNWPPA SEQ ID NO: 11 (human PDGFR alpha) MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSW QYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENEL EGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVV PASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKT VYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVP EATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVK HFVVEVRAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSG HYTIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIE WMICKDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCL AKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIR WRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTA YGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTK SGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVIL SFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDS EVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQG KIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGIL LWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPE KRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTY KNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESA IETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL SEQ ID NO: 12 (human PDGFR beta) MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSG SAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLET DERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDV ALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQ TVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHI PSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRS RTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKV AEAGHYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMP QPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQ HVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIML WQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSG AFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHL NVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYS NALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSN YMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVH RDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLY TTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEI MQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQAR LPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASST LNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSF L

Claims

1. A method of treating a PDGFRP negative cancer in a human patient, comprising administering to the patient a pharmaceutical composition comprising an effective amount of a PDGFRa inhibiting compound,wherein the PDGFRa inhibiting compound is an antibody, wherein the antibody specifically binds PDGFRa;wherein the antibody which specifically binds PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2;wherein the antibody which specifically binds PDGFRa is administered in simultaneous, separate, or sequential combination with doxorubicin;wherein the cancer is soft tissue sarcoma;wherein the soft tissue sarcoma is leiomyosarcoma; andwherein the patient is female and wherein the female is determined to have a PDGFRP negative cancer.

2. Use of a pharmaceutical composition comprising an effective amount of a PDGFRa inhibiting compound in the manufacture of a medicament for treating a PDGFRP negative cancer in a human patient,wherein the PDGFRa inhibiting compound is an antibody, wherein theantibody specifically binds PDGFRa;2022237561   10 Aug 2026wherein the antibody which specifically binds PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2;wherein the antibody which specifically binds PDGFRa is administered in simultaneous, separate, or sequential combination with doxorubicin;wherein the cancer is soft tissue sarcoma;wherein the soft tissue sarcoma is leiomyosarcoma; andwherein the patient is female and wherein the female is determined to have a PDGFRp negative cancer.

3. The method of Claim 1 or the use of Claim 2, wherein the effective amount of a PDGFRa inhibiting compound is olaratumab, and is administered to the patient at a loading dose of about 15 mg / kg, or about 20 mg / kg, or about 25 mg / kg, on each of day 1 and day 8 of a first 21-day cycle or on each of day 1 and day 8 of a first 28-day cycle, followed by administering a standard dose of olaratumab at about 15 mg / kg, about 20 mg / kg, or about 25 mg / kg, on each of day 1 and day 8 of a subsequent 21-day cycle or on each of day 1 and day 8 of a subsequent 28-day cycle.

4. A method for determining a cancer where a PDGFRa inhibiting compound is effective for treating the cancer, comprising the steps of:contacting a biological sample from a cancer patient with a first antibody or antigen binding fragment thereof that specifically binds human2022237561   10 Aug 2026PDGFRP, wherein a complex of the first antibody or antigen binding fragment thereof and human PDGFRP is formed;contacting with a second antibody or antigen binding fragment thereof, the complex of the human PDGFRP antibody or antigen binding fragment thereof and human PDGFRP, wherein the second antibody comprises a detectable label;detecting a signal provided by said detectable label; andwherein, if the biological sample from the cancer patient isdetermined as PDGFRP negative the cancer patient is determined as in need of treatment with a PDGFRa inhibiting compound,wherein the PDGFRa inhibiting compound is an antibody or antigen binding fragments which comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2;wherein the cancer is soft tissue sarcoma;wherein the soft tissue sarcoma is leiomyosarcoma;wherein the patient is female and wherein the female is determined to have a PDGFRP negative cancer; andwherein the biological sample is a tumor sample.

5. An in vitro method of diagnosing a cancer which can be effectively treated by an antibody or antigen binding fragments thereof, that specifically binds human PDGFRa, comprising:a. contacting a biological sample from a cancer patient with an antibody or antigen-binding fragment thereof that specifically binds human2022237561   10 Aug 2026PDGFRP, wherein a complex of the PDGFRp antibody or antigenbinding fragment thereof and human PDGFRP is formed;b. removing any non-specifically bound first antibody or antigen-binding fragment thereof;c. detecting and quantifying the human PDGFRP in the biological sample; andwherein the biological sample from the cancer patient is determined to be PDGFRP negative when PDGFRP in the biological sample is determined to be present in less than about 10% of tumor cells of the biological sample, as determined by an IHC assay,wherein, if the biological sample from the cancer patient is determined to be PDGFRP negative the cancer patient is determined as in need of treatment with an antibody or antigen binding fragments thereof, that specifically binds human PDGFRa,wherein the antibody or antigen binding fragments thereof which specifically binds human PDGFRa comprises a heavy chain (HC) and a light chain (LC), wherein the HC comprises SEQ ID NO: 1 and the LC comprises SEQ ID NO: 2;wherein the cancer is soft tissue sarcoma;wherein the soft tissue sarcoma is leiomyosarcoma;wherein the patient is female and wherein the female is determined to have a PDGFRP negative cancer; andwherein the biological sample is a tumor sample.2022237561   10 Aug 20266. The method of Claim 5, wherein the step of detecting comprises detecting with a second antibody the complex of the PDGFRP antibody or antigen binding fragment thereof and human PDGFRP in the biological sample.

7. The method of Claim 5 or 6, wherein at least one of the antibody or the second antibody comprises a detectable label and wherein said step of detecting comprises detecting a signal provided by the detectable label upon formation of the complex comprising, the antibody and human PDGFRP or the second antibody and human PDGFRP.

8. The method of Claim 5 or 6, wherein the second antibody comprises a detectable label and wherein said step of detecting comprises detecting a signal provided by the detectable label upon formation of the complex comprising, the antibody, human PDGFRP, and the second antibody.

Citation Information

Patent Citations

  • QUANTITATIVE ASSAYS FOR PDGFR-ß IN BODY FLUIDS

    WO2007021860A2

  • Combination therapy

    WO2016003789A1

  • Combination therapy for pancreatic cancer

    WO2018169779A1

  • Combination therapy for soft tissue sarcoma

    WO2019231803A1