Protein derived from fibronectin type iii domain, and use thereof
Patent Information
- Application Number
- AU2022484476
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2022-11-04
- Publication Date
- 2026-08-27
Smart Images

Figure 00000001_0000 
Figure 00000064_0000 
Figure 00000065_0000
Abstract
Description
FIELD OF THE INVENTION The present invention is involved in protein engineering, and particularly directed to fibronectin type III domain-based protein and application of the same protein, including a method for treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 (VEGFR2) activity or signaling, or a method for treating or preventing a disease or a disorder caused by angiogenesis. BACKGROUND OF THE INVENTION Recent efforts to develop molecular recognition modules based-on protein scaffolds other than immunoglobulins aim to overcome the inherent limitations of immunoglobulins as molecular recognition modules, including large size, complex heterodimeric architecture, and requirement of correctly formed disulfide bonds. Its fundamental assumption is that a binding interface is constructed on a suitable protein framework or a molecular scaffold, other than an antibody to develop molecules with affinity and specificity comparable to those of antibodies. The 10th human fibronectin type III domain (10Fn3) is one of widely used non-antibody scaffolds for engineering novel binding proteins. Many 10Fn3-based molecules are developed for therapeutic applications, and most are currently in clinical trials. 10Fn3 has several characteristics superior to immunoglobulin-based systems. 10Fn3 is a member of the immunoglobulin superfamily due to its global P-sandwich fold. The three surface loops proximal to its N-terminus are structurally equivalent to the three antigen-recognition loops or the complementarity-determining regions (CDRs) of an immunoglobulin variable domain. However, 10Fn3 lacks a disulfide bond, unlike the canonical immunoglobulin domain. 10Fn3 has a higher conformational stability, with the thermal transition above 80°C. 10Fn3 exhibits reversible and rapid unfolding and refolding. 10Fn3 has ~94 amino acid residues, less than the antigenbinding unit (VHH) of a heavy-chain antibody. All these features make 10Fn3 a particularly robust scaffold system compatible with diverse molecular display systems and with simple and efficient production methods. U.S. Patent Application No. 11 / 448,171, entitled “INHIBITORS OF TYPE 2 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTORS” provides a protein C7 targeting vascular endothelial growth factor receptor 2. The protein C7 is a 10Fn3-based protein and different from the wild-type form in that the sequences of the three surface loops in the wild-type form, 23DAPAVTVRY, 51PGSKST, and 75VTGRGDSPASSKP are substituted with 23RHPHFPTRY, 51PLQPPT, and 75VTDGRNGRLLSIP respectively. Since the three mutant regions are a targeting site for vascular endothelial growth factor receptor 2, the protein C7 can be used as a VEGFR2 antagonist and has the potential to be an anti-cancer drug. However, its development for becoming a drug comes to the deadlock due to the low thermostability and the low solubility. Therefore, there is a need to develop a 10Fn3-based protein scaffold with the high thermostability and the high solubility. SUMMARY OF THE INVENTION A protein variant C7-NM has been obtained by modifying a protein C7. The present invention is made based on that the design of introducing a disulfide bond into a protein C7-NM is accomplished by the program Disulfide by Design 2.0 (DbD2) with reference to the parameters including a B-factor, a X3 angle, and an energy. The newly-obtained protein variant has a high thermostability and a high solubility without effects on the activity of targeting a specific protein. Accordingly, the present invention provides a protein, which includes a 10th human fibronectin type III domain and has a first mutation at an amino acid residue with a cysteine residue and a second mutation at another amino acid residue with another cysteine residue, wherein the first mutation and the second mutation take place at a region of the 10th human fibronectin type III domain other than a loop FG so that a disulfide bond is formed between the cysteine residue formed by the first mutation and the cysteine residue formed by the second mutation. Exemplarily, the 10th human fibronectin type III domain comprises: an amino acid sequence of SEQ ID No.: 1. Exemplarily, the protein further comprises: a mutation to substitute an amino acid sequence of a loop BC with RHPHFPTRY, a mutation to substitute an amino acid sequence of a loop DE with PLQPPT, and a mutation to substitute an amino acid sequence of a loop FG with VTDGRNGRLLSIP. Exemplarily, the first mutation takes place at a P-strand A, a P-strand B, a P-strand C, a P-strand D, a P-strand E, a P-strand F, a P-strand G, a loop AB, a loop BC, a loop CD, a loop DE, or a loop EF of the 10th human fibronectin type III domain, and the second mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain. Exemplarily, the first mutation takes place at a P-strand A, a P-strand B, a P-strand C, a P-strand D, a P-strand E, a P-strand F, a P-strand G, a loop AB, a loop CD, or a loop EF of the 10th human fibronectin type III domain, and the second mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain. Exemplarily, the first mutation and the second mutation take place at a same region or different regions. Exemplarily, the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of a leucine residue at position 19 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue; the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue; the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue; the first mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; the first mutation comprises: a substitution of a leucine residue at position 19 with the cysteine residue, and the second mutation comprises: a substitution of a threonine residue at position 58 with the cysteine residue; the first mutation comprises: a substitution of an isoleucine residue at position 34 with the cysteine residue, and the second mutation comprises: a substitution of a phenylalanine residue at position 48 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 35 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a tyrosine residue at position 36 with the cysteine residue, and the second mutation comprises: a substitution of an isoleucine residue at position 70 with the cysteine residue; the first mutation comprises: a substitution of a glycine residue at position 37 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the second mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue; the first mutation comprises: a substitution of a lysine residue at position 63 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 66 with the cysteine residue; or the first mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation comprises: a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the protein comprises: an amino acid sequence selected from SEQ ID Nos.: 4-14. Exemplarily, the protein comprises: an amino acid sequence of SEQ ID No.: 11. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation and the second mutation do not comprise a substitution of a leucine residue at position 19 with the cysteine residue. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue; the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue; the first mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; the first mutation comprises: a substitution of an isoleucine residue at position 34 with the cysteine residue, and the second mutation comprises: a substitution of a phenylalanine residue at position 48 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 35 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a tyrosine residue at position 36 with the cysteine residue, and the second mutation comprises: a substitution of an isoleucine residue at position 70 with the cysteine residue; the first mutation comprises: a substitution of a glycine residue at position 37 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the second mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue; the first mutation comprises: a substitution of a lysine residue at position 63 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 66 with the cysteine residue; or the first mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation comprises: a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the protein comprises: an amino acid sequence selected from SEQ ID Nos.: 17-26. Exemplarily, the protein further has a third mutation at another amino acid residue with a cysteine residue and a fourth mutation at another amino acid residue with another cysteine residue, wherein the third mutation and the fourth mutation take place at a region of the 10th human fibronectin type III domain other than the loop FG so that a disulfide bond is formed between the cysteine residue formed by the third mutation and the cysteine residue formed by the fourth mutation. Exemplarily, the third mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain, and the fourth mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain. Exemplarily, the third mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain, and the fourth mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain. Exemplarily, the first mutation, the second mutation, the third mutation, and the fourth mutation take place at different regions. Exemplarily, the third mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of a leucine residue at position 19 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue; the fourth mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the fourth mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; or the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the fourth mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue. Exemplarily, the protein comprises: an amino acid sequence of SEQ ID No.: 15 or 16. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation, the second mutation, the third mutation, and the fourth mutation do not comprise a substitution of a leucine residue at position 19 with the cysteine residue. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue, the third mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, and the fourth mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Exemplarily, the protein comprises: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the fourth mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; or the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the fourth mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue. Exemplarily, the protein comprises: an amino acid sequence of SEQ ID No.: 27 or 28. Exemplarily, the protein is provided for targeting DDL4, EGFR, VEGFR2, or IGF-1R. The protein with reference to the present invention is based on a 10th human fibronectin type III domain, and a disulfide bond is introduced at a certain position of the basal structure to increase its thermostability and solubility. In the protein with reference to the present invention, the substitution for an amino acid sequence may be further performed to construct a proteinbinding interface for targeting a certain protein, e.g., DDL4, EGFR, VEGFR2, or IGF-1R. As such, the protein with reference to the present invention can be used as a receptor antagonist and has the potential to be a biopharmaceutical. The present invention further provides a pharmaceutical composition, which includes: the foregoing protein; and a pharmaceutically acceptable carrier. Exemplarily, the pharmaceutical composition is an orally administrable formulation, an injectable formulation, an inhalable formulation, or a topically or transdermally administrable formulation. The present invention further provides use of the foregoing pharmaceutical composition, which is for manufacturing a medicine for treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling. Exemplarily, the disease or the disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling comprises: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Exemplarily, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, non-small cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. The present invention further provides a method for treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling, which includes: administering the foregoing pharmaceutical composition to a subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit an activity thereof. Exemplarily, the disease or the disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling comprises: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Exemplarily, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, non-small cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. The present invention further provides use of the foregoing pharmaceutical composition, which is for manufacturing a medicine for treating or preventing a disease or a disorder caused by angiogenesis. Exemplarily, the disease or the disorder caused by angiogenesis comprises: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Exemplarily, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, non-small cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. The present invention further provides a method for treating or preventing a disease or a disorder caused by angiogenesis, which includes: administering the foregoing pharmaceutical composition to a subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit angiogenesis. Exemplarily, the disease or the disorder caused by angiogenesis comprises: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Exemplarily, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, non-small cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. The present invention further provides a nucleic acid, which includes a nucleotide sequence for encoding the foregoing protein. The present invention further provides a host cell, which has the foregoing nucleic acid. Exemplarily, the host cell is a prokaryotic cell or a eukaryotic cell. Exemplarily, the prokaryotic cell is Escherichia coli; the eukaryotic cell is a CHO cell, a COS cell, or a HEK293 cell. The present invention further provides a method for producing the foregoing protein, which includes: incubating the foregoing host cell to express the protein. BRIEF DESCRIPTION OF THE DRAWINGS FIG. 1 is a protein structure diagram showing the 3-dimensional structure of protein C7-NM; FIG. 2 is a protein structure diagram showing designable sites for disulfide bond formation in protein C7-NM; FIG. 3 is a curve chart comparing the melting temperature (Tm) of protein C7 and its variant measured by differential scanning calorimetry (DSC); FIG. 4 is a curve chart comparing the melting temperature of protein C7 and protein C7-SL1-LL2 measured by differential scanning calorimetry; FIG. 5 is a bar chart comparing the solubility of protein C7 and protein C7-SL1-LL2; and FIG. 6 is a bar chart comparing the affinity of protein C7 and protein C7-SL1-LL2 for VEGFR2 measured by the enzyme-linked immunosorbent assay (ELISA). DETAILED DESCRIPTION OF THE INVENTION The detailed description and preferred embodiments of the invention will be set forth in the following content, and provided for people skilled in the art to understand the characteristics of the invention. 1. DEFINITIONS The term “protein” used herein includes a wild-type protein produced by a natural cell, a recombinant protein made through genetic engineering, or a synthetic protein made through chemical synthesis, unless otherwise provided. Upon the condition of no adverse effect on the original activity, substitution, deletion, and / or insertion of at least one amino acid may be included in the protein sequence. The term “amino acid” used herein includes: D-amino acid or L-amino acid, unless otherwise provided. “D-” and “L-” are used to refer to the absolute configuration of amino acid, rather than a particular rotation direction of plane-polarized light. In the present disclosure, amino acid may be referred to by the one-letter symbol recommended by the IUPAC-IUB Biochemical Nomenclature Commission, unless otherwise provided. A character string composed of multiple one-letter symbols is used to represent a protein sequence, and the order of one-letter symbol in the protein sequence corresponds to the direction from the N-terminus to the C-terminus of amino acid in the protein. If there is a superscript deposited in front of a one-letter symbol, it indicates the number of the corresponding amino acid residue from the N-terminus. For example, 23DAPAVTVRY indicate that aspartate is at position 23 from the N-terminus of a protein, and so on. Substitution, deletion, and / or insertion in a protein sequence may occur in the protein non-functional domain, which usually has no effect on the original activity. Additionally, amino acid substitution may include conservative amino acid substitution, and conservative amino acid substitution indicates substitution within amino acid residues having a similar characteristic or within amino acid residues having a related side-chain. Substitution within amino acid residues having a similar characteristic, for example, is substitution within acidic amino acid residues, i.e., aspartate and glutamate, substitution within basic amino acid residues, i.e., lysine, arginine, and histidine, substitution within non-polar amino acid residues, i.e., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan, or substitution within uncharged amino acid residues, i.e., glycine, asparagine, glutamine, cysteine, serine, threonine, and tyrosine. Substitution within amino acid residues having a related side-chain, for example, is substitution within aliphatic-hydroxy amino acid residues, i.e., serine and threonine, substitution within amide-containing amino acid residues, i.e., asparagine and glutamine, substitution within aliphatic amino acid residues, i.e., alanine, valine, leucine, and isoleucine, or substitution within aromatic amino acid residues, i.e., phenylalanine, tryptophan, and tyrosine. The term “10th human fibronectin type III domain” used herein includes a N-terminal region, a p-strand A, a loop AB, a p-strand B, a loop BC, a P-strand C, a loop CD, a p-strand D, a loop DE, a P—strand E, a loop EF, a p-strand F, a loop FG, a P-strand G, and a C-terminal region from the N-terminus to the C-terminus, and contains at least 94 amino acid residues without any disulfide bond, unless otherwise provided, e.g., SEQ ID No.: 1. With reference to U.S. Patent Application No. 13 / 757,664, entitled “FIBRONECTIN BINDING DOMAINS WITH REDUCED IMMUNOGENICITY”, the N-terminal region is defined as the protein fragment at positions 1-7, the P-strand A is defined as the protein fragment at positions 8-13, the loop AB is defined as the protein fragment at positions 14-17, the P-strand B is defined as the protein fragment of positions 18-22, the loop BC is defined as the protein fragment at positions 2331, the P-strand C is defined as the protein fragment at positions 32-36, the loop CD is defined as the protein fragment at positions 37-47, the P-strand D is defined as the protein fragment at positions 48-50, the loop DE is defined as the protein fragment at positions 51-56, the P-strand E is defined as the protein fragment at positions 57-62, the loop EF is defined as the protein fragment at positions 63-67, the P-strand F is defined as the protein fragment at positions 68-74, the loop FG is defined as the protein fragment at positions 75-87, the P-strand G is defined as the protein fragment at positions 88-92, and the C-terminal region is defined as the protein fragment at positions 93 and 94. The loop BC, the loop DE, and the loop FG are formed at a side of the molecule, and the loop AB, the loop CD, and the loop EF are formed at another side of the molecule. For example, the N-terminal region includes 1VSDVPRD, the P-strand A includes 8LEVVAA, the loop AB includes 14TPTS, the P-strand B includes 18LLISW, the loop BC includes 23DAPAVTVRY, the P-strand C includes 32YRITY, the loop CD includes 37GETGGNSPVQE, the P-strand D includes 48FTV, the loop DE includes 51PGSKST, the P-strand E includes 57ATISGL, the loop EF includes 63KPGVD, the p-strand F includes 68YTITVYA, the loop FG includes 75VTGRGDSPASSKP, the p-strand G includes 88ISINY, and the C-terminal regions includes 93RT. The term “protein C7” used herein is intended to refer to a variant of the 10th human fibronectin type III domain, which can bind to vascular endothelial growth factor receptor 2 to inhibit the activity thereof, unless otherwise provided, e.g., SEQ ID No.: 2. Specifically, its protein sequence relative to the wild-type loop BC comprises 23RHPHFPTRY, its protein sequence relative to the wild-type loop DE comprises 51PLQPPT, and its protein sequence relative to the wild-type loop FG comprises 75VTDGRNGRLLSIP. The three mutant regions together form a target interface to vascular endothelial growth factor receptor 2. The term “protein C7-NM” used herein refers to a variant of protein C7, unless otherwise provided, e.g., SEQ ID No.: 3. Specifically, its amino acid relative that of the reference protein at position 12 is glutamate, its amino acid relative that of the reference protein at position 14 is serine, its amino acid relative that of the reference protein at position 18 is isoleucine, and its amino acid relative that of the reference protein at position 19 is glutamine. The term “vascular endothelial growth factor receptor 2” used herein refers to a transmembrane receptor tyrosine kinase, which can regulate the angiogenesis caused by VEGF-A and VEGF-B, unless otherwise provided. The term “vascular endothelial growth factor receptor 2” is synonymous with the term “kinase insert domain receptor (KDR)” and the term “fetal liver kinase 1 (FLK-1)”, and all are exchangeable. The term “treating” used herein indicates to provide a therapeutic intervention for curing or ameliorating disease or disorder, unless otherwise provided. That is, treating comprises completely or almost completely curing or ameliorating the disease or disorder. The term “preventing” used herein indicates to completely or almost completely stop disease or disorder from occurring, unless otherwise provided. For example, when a subject has no disease or disorder or is suspected to have disease or disorder but not resulting in the disease or disorder, a preventive intervention is provided to prevent the disease or disorder from occurring. The term “pharmaceutically acceptable carrier” used herein indicates an additive which is, within the scope of sound medical judgment, suitable for use in contact with the tissue of a subject without excessive toxicity, irritation, allergic response, or other problem or complication, and commensurate with a reasonable benefit / risk ratio, unless otherwise provided, e.g., a filler, a dilutant, an agglutinant, an adhesive, a lubricant, a fluidizer, a stabilizer, a colorant, a humectant, or a disintegrant. 2. 10TH HUMAN FIBRONECTIN TYPE III DOMAIN-BASED PROTEIN A first embodiment of the present invention discloses a protein, which is based on the 10th human fibronectin type III domain and has a disulfide bond introduced at a certain site of the basal structure. In such a way, the thermostability and solubility of protein increase. With the foregoing high thermostability and high solubility and the properties originally exhibited in the 10th human fibronectin type III domain, amino acid substitution can be performed to construct a protein-binding interface for targeting a certain protein, e.g., DDL4, EGFR, VEGFR2, or IGF-1R. Accordingly, the protein of the present embodiment can be used as an antagonist and has the potential to be a biopharmaceutical. The protein of the present embodiment includes a 10th human fibronectin type III domain and has a first mutation at an amino acid residue with a cysteine residue and a second mutation at another amino acid residue with another cysteine residue, wherein the first mutation and the second mutation take place at a region of the 10th human fibronectin type III domain other than a loop FG so that a disulfide bond is formed between the cysteine residue formed by the first mutation and the cysteine residue formed by the second mutation. Preferably, the10th human fibronectin type III domain comprises SEQ ID No.: 1. In term of the region, the first mutation may take place at a p-strand A, a p-strand B, a p-strand C, a p-strand D, a p-strand E, a p-strand F, a p-strand G, a loop AB, a loop BC, a loop CD, a loop DE, or a loop EF of the 10th human fibronectin type III domain; the second mutation may take place at the p-strand A, the p-strand B, the p-strand C, the p-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain. Preferably, the first mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the p-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain; the second mutation takes place at the P-strand A, the P-strand B, the P-strand C, the P-strand D, the P-strand E, the P-strand F, the P-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain. The first mutation and the second mutation may take place at a same region of the foregoing region group or two different regions of the foregoing region group. For example, both the first mutation and the second mutation take place at the loop CD; or both the first mutation and the second mutation take place at the loop EF. For example, the first mutation takes place at the P-strand A, and the second mutation takes place at the P-strand B; the first mutation takes place at the P-strand A, and the second mutation takes place at the P-strand G; the first mutation takes place at the loop AB, and the second mutation takes place at the P-strand E; the first mutation takes place at the P-strand B, and the second mutation takes place at the P-strand E; the first mutation takes place at the P-strand C, and the second mutation takes place at the P-strand D; the first mutation takes place at the P-strand C, and the second mutation takes place at the loop CD; the first mutation takes place at the P-strand C, and the second mutation takes place at the P-strand F; the first mutation takes place at the loop CD, and the second mutation takes place at the loop EF; or the first mutation takes place at the loop EF, and the second mutation takes place at the P-strand G. In term of the protein sequence, the first mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of a leucine residue at position 19 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue; the second mutation may comprise: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Specifically, the first mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation may comprise: a substitution of a tryptophan residue at position 22 with the cysteine residue; the first mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation may comprise: a substitution of a serine residue at position 89 with the cysteine residue; the first mutation may comprise: a substitution of a serine residue at position 17 with the cysteine residue, and the second mutation may comprise: a substitution of a serine residue at position 60 with the cysteine residue; the first mutation may comprise: a substitution of a leucine residue at position 19 with the cysteine residue, and the second mutation may comprise: a substitution of a threonine residue at position 58 with the cysteine residue; the first mutation may comprise: a substitution of an isoleucine residue at position 34 with the cysteine residue, and the second mutation may comprise: a substitution of a phenylalanine residue at position 48 with the cysteine residue; the first mutation may comprise: a substitution of a threonine residue at position 35 with the cysteine residue, and the second mutation may comprise: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation may comprise: a substitution of a tyrosine residue at position 36 with the cysteine residue, and the second mutation may comprise: a substitution of an isoleucine residue at position 70 with the cysteine residue; the first mutation may comprise: a substitution of a glycine residue at position 37 with the cysteine residue, and the second mutation may comprise: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation may comprise: a substitution of a threonine residue at position 39 with the cysteine residue, and the second mutation may comprise: a substitution of an aspartate residue at position 67 with the cysteine residue; the first mutation may comprise: a substitution of a lysine residue at position 63 with the cysteine residue, and the second mutation may comprise: a substitution of a valine residue at position 66 with the cysteine residue; or the first mutation may comprise: a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation may comprise: a substitution of an asparagine residue at position 91 with the cysteine residue. The protein may further have a third mutation at another amino acid residue with a cysteine residue and a fourth mutation at another amino acid residue with another cysteine residue, wherein the third mutation and the fourth mutation take place at a region of the 10th human fibronectin type III domain other than the loop FG so that a disulfide bond is formed between the cysteine residue formed by the third mutation and the cysteine residue formed by the fourth mutation. On condition of having the at least two disulfide bonds, the thermostability and the solubility of the protein can enhance. In term of the region, the third mutation may take place at the p-strand A, the p-strand B, the p-strand C, the p-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain, and the fourth mutation may take place at the p-strand A, the p-strand B, the p-strand C, the p-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop BC, the loop CD, the loop DE, or the loop EF of the 10th human fibronectin type III domain. Preferably, the third mutation takes place at the p-strand A, the p-strand B, the p-strand C, the p-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain, and the fourth mutation takes place at the p-strand A, the p-strand B, the p-strand C, the p-strand D, the p-strand E, the p-strand F, the p-strand G, the loop AB, the loop CD, or the loop EF of the 10th human fibronectin type III domain. The first mutation, the second mutation, the third mutation, and the fourth mutation may take place at four different regions of the foregoing region group. For example, the first mutation takes place at the P-strand A, the second mutation takes place at the P-strand G, the third mutation takes place at the loop AB, and the fourth mutation takes place at the P-strand E; or the first mutation takes place at the P-strand A, the second mutation takes place at the P-strand G, the third mutation takes place at the loop CD, and the fourth mutation takes place at the loop EF. In term of the protein sequence, the third mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of a leucine residue at position 19 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue; the fourth mutation may comprise: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue. Specifically, the first mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation may comprise: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation may comprise: a substitution of a serine residue at position 17 with the cysteine residue, and the fourth mutation may comprise: a substitution of a serine residue at position 60 with the cysteine residue; or the first mutation may comprise: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation may comprise: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation may comprise: a substitution of a threonine residue at position 39 with the cysteine residue, and the fourth mutation may comprise: a substitution of an aspartate residue at position 67 with the cysteine residue. As described above, the protein of the present embodiment can target DDL4, EGFR, VEGFR2, or IGF-1R. For targeting VEGFR2, the protein of the present embodiment may further comprise: a mutation to substitute an amino acid sequence of the loop BC with RHPHFPTRY, a mutation to substitute an amino acid sequence of the loop DE with PLQPPT, and a mutation to substitute an amino acid sequence of the loop FG with VTDGRNGRLLSIP. Preferably, the protein of the present embodiment comprises: an amino acid sequence of SEQ ID No.: 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16. More preferably, the protein of the present embodiment comprises: an amino acid sequence of SEQ ID No.: 11, 15, or 16. According to the previous discovery, protein C7-NM could increase the thermostability and the solubility. The protein of the present embodiment may be modified with reference to the protein sequence of protein C7-NM. On condition that the first mutation and the second mutation do not comprise a substitution of the leucine residue at position 19 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. Specifically, on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. More specifically, on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue; the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue; the first mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; the first mutation comprises: a substitution of an isoleucine residue at position 34 with the cysteine residue, and the second mutation comprises: a substitution of a phenylalanine residue at position 48 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 35 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a tyrosine residue at position 36 with the cysteine residue, and the second mutation comprises: a substitution of an isoleucine residue at position 70 with the cysteine residue; the first mutation comprises: a substitution of a glycine residue at position 37 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 with the cysteine residue; the first mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the second mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue; the first mutation comprises: a substitution of a lysine residue at position 63 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 66 with the cysteine residue; or the first mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue, and the second mutation comprises: a substitution of an asparagine residue at position 91 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. Preferably, the protein of the present embodiment comprises: an amino acid sequence of SEQ ID No.: 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26. On condition that the first mutation, the second mutation, the third mutation, and the fourth mutation do not comprise a substitution of a leucine residue at position 19 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. Specifically, on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, the second mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue, the third mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, a substitution of a serine residue at position 17 with the cysteine residue, a substitution of an isoleucine residue at position 34 with the cysteine residue, a substitution of a threonine residue at position 35 with the cysteine residue, a substitution of a tyrosine residue at position 36 with the cysteine residue, a substitution of a glycine residue at position 37 with the cysteine residue, a substitution of a threonine residue at position 39 with the cysteine residue, a substitution of a lysine residue at position 63 with the cysteine residue, or a substitution of an aspartate residue at position 67 with the cysteine residue, and the fourth mutation comprises: a substitution of a tryptophan residue at position 22 with the cysteine residue, a substitution of a valine residue at position 45 with the cysteine residue, a substitution of a phenylalanine residue at position 48 with the cysteine residue, a substitution of a threonine residue at position 58 with the cysteine residue, a substitution of a serine residue at position 60 with the cysteine residue, a substitution of a valine residue at position 66 with the cysteine residue, a substitution of an aspartate residue at position 67 with the cysteine residue, a substitution of an isoleucine residue at position 70 with the cysteine residue, a substitution of a serine residue at position 89 with the cysteine residue, or a substitution of an asparagine residue at position 91 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. More specifically, on condition that the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a serine residue at position 17 with the cysteine residue, and the fourth mutation comprises: a substitution of a serine residue at position 60 with the cysteine residue; or the first mutation comprises: a substitution of a leucine residue at position 8 with the cysteine residue, the second mutation comprises: a substitution of a serine residue at position 89 with the cysteine residue, the third mutation comprises: a substitution of a threonine residue at position 39 with the cysteine residue, and the fourth mutation comprises: a substitution of an aspartate residue at position 67 with the cysteine residue, the protein of the present embodiment may further comprise: a mutation to substitute an alanine residue at position 12 with a glutamate residue, a mutation to substitute a threonine residue at position 14 with a serine residue, a mutation to substitute a leucine residue at position 18 with an isoleucine residue, and a mutation to substitute a leucine residue at position 19 with a glutamine residue. Preferably, the protein of the present embodiment comprises: an amino acid sequence of SEQ ID No.: 27 or 28. The protein of the present embodiment may be produced through genetic engineering or chemical synthesis. The chemical synthesis, for example, is solid-phase synthesis or liquid-phase synthesis. Ammonium sulfate or ethanol precipitation, acid extraction, ion-exchange chromatography, affinity chromatography, or lectin chromatography may be implemented for isolation and purification of the protein of the present embodiment. Preferably, high performance liquid chromatography (HPLC) is implemented. The protein of the present embodiment may further include a hydrophilic group for increasing its solubility or circulation half-life. The hydrophilic group may be connected to a N-terminus of the protein. Preferably, the hydrophilic group is polyethylene glycol, polypropylene glycol, polylactic acid, polyglycolic acid, polyvinyl alcohol, or dextran. More preferably, the hydrophilic group is polyethylene glycol containing 2-40 repeating ethylene glycol units. The protein of the present embodiment may further include an affinity tag for protein purification. The affinity tag may be connected to a N-terminus or a C-terminus of the protein. Preferably, the affinity tag is a His-tag, a GST-tag, a MBP-tag, a NusA-tag, or a SUMO-tag. 3. PHARMACEUTICAL COMPOSITION A second embodiment of the present invention discloses a pharmaceutical composition including the protein of the first embodiment. The pharmaceutical composition can be administered to a subject to bind to a certain protein therein so that the pharmaceutical composition can be used as an antagonist against the certain protein and inhibit the activity or the signaling thereof. The pharmaceutical composition of the second embodiment comprises: the protein of the first embodiment; and a pharmaceutically acceptable carrier. Generally, the pharmaceutically acceptable carrier can allow the pharmaceutical composition to be in various forms or to be suitable in various routes of administration. Preferably, the pharmaceutical composition is an orally administrable formulation, an injectable formulation, an inhalable formulation, or a topically or transdermally administrable formulation for various routes of administration. Preferably, the pharmaceutical composition is a tablet, a capsule, a granule, a dispersant, a solution, a syrup, a suspension, or an emulsion. The pharmaceutically acceptable carrier may be an excipient, a filler, a dilutant, an agglutinant, an adhesive, a lubricant, a fluidizer, a stabilizer, a colorant, a humectant, or a disintegrant. The excipient, for example, is sodium citrate, calcium carbonate, or calcium phosphate; the filler, for example, is lactose or high molecular weight polyethylene glycol; the dilutant, for example, is water, ethanol, propanediol, or glycerol; the adhesive, for example, is sucrose, gelatin, or acacia gum; the lubricant, for example, is magnesium stearate, calcium stearate, zinc stearate, sodium stearate, stearate, aluminum stearate, leucine, glycerol behenate, or hydrogenated vegetable oil; the fluidizer, for example, is sodium aluminosilicate, calcium silicate, microcrystalline cellulose, maize starch, sodium benzoate, calcium carbonate, magnesium carbonate, talcum, calcium stearate, magnesium stearate, zinc stearate, magnesium lauryl sulfate, or magnesium oxide; the stabilizer, for example, is citrate or ascorbic acid; the colorant, for example, is titanium dioxide or ferric oxide; the humectant, for example, is Pluronic F68, Tween 20, or Tween 80; the disintegrant, for example, is potato starch, tapioca starch, or silicate. 4. PHARMACEUTICAL USE A third embodiment of the present invention discloses use of a pharmaceutical composition of the second embodiment, which is for manufacturing a medicine for treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling. This medicine can be administered to a subject to inhibit vascular endothelial growth factor receptor 2 activity or signaling. That is, this medicine can be administered to a subject in need of treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling so that the treatment or prevention effect can be achieved by inhibiting vascular endothelial growth factor receptor 2 activity or signaling in the subject. This medicine may be administered by different routes, e.g., oral administration, injection administration, inhalation administration, or topical or transdermal administration. The disease or the disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling may comprise: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Preferably, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, nonsmall cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. A fourth embodiment of the present invention discloses a method for treating or preventing a disease or a disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling, which includes: administering the pharmaceutical composition of the second embodiment to a subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit the activity or block the signaling. This pharmaceutical composition may be administered by different routes, e.g., oral administration, injection administration, inhalation administration, or topical or transdermal administration. The disease or the disorder caused by or related to vascular endothelial growth factor receptor 2 activity or signaling may comprise: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Preferably, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, nonsmall cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. A fifth embodiment of the present invention discloses use of the pharmaceutical composition of the second embodiment, which is for manufacturing a medicine for treating or preventing a disease or a disorder caused by angiogenesis. This medicine can be administered to a subject to inhibit angiogenesis. That is, this medicine can be administered to a subject in need of treating or preventing a disease or a disorder caused by angiogenesis so that the treatment or prevention effect can be achieved by inhibiting angiogenesis in the subject. This medicine may be administered by different routes, e.g., oral administration, injection administration, inhalation administration, or topical or transdermal administration. The disease or the disorder caused by angiogenesis may comprise: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Preferably, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, nonsmall cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. A sixth embodiment of the present invention discloses a method for treating or preventing a disease or a disorder caused by angiogenesis, which includes: administering the pharmaceutical composition of the second embodiment to a subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit angiogenesis. This pharmaceutical composition may be administered by different routes, e.g., oral administration, injection administration, inhalation administration, or topical or transdermal administration. The disease or the disorder caused by angiogenesis may comprise: autoimmune disorder, cardiac disorder, retinopathy, renal disease, hemangioblastoma, hemangioma, thyroid hyperplasia, chronic inflammation, Meigs syndrome, pericardial effusion, pleural effusion, diabetes, endometriosis, undesirable fibrosis, or cancer. Preferably, the cancer comprises: kidney cancer, pancreatic carcinoma, breast cancer, head and neck cancer, prostate cancer, malignant glioma, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, nonsmall cell lung cancer, synovial sarcoma, thyroid cancer, or melanoma. 5. OTHERS A seventh embodiment of the present invention discloses a nucleic acid, which includes a nucleotide sequence for encoding the protein of the first embodiment. For controlling the protein expression, the nucleic acid may further include a promoter, which is operably linked to the nucleotide sequence for encoding the protein. The term ”being operably linked to” herein indicates that two or more than two nucleotide sequences are in a functional relationship with each other. An eighth embodiment of the present invention discloses a host cell, which includes the nucleic acid of the seventh embodiment. Since the host cell has the nucleotide sequence for encoding the protein, the protein can be produced through cultivating the host cell. The host cell may be a prokaryotic cell or a eukaryotic cell. The prokaryotic cell, for example, is Escherichia coli; the eukaryotic cell, for example, is a CHO cell, a COS cell, or a HEK293 cell. A ninth embodiment of the present invention discloses a method for producing the protein of the first embodiment, which includes: incubating the host cell of the eighth embodiment to express the protein. Further, an inducer may be selected for inducing the host cell to express the protein according to the promoter. The following examples are offered to further illustrate the invention. Example 1: design of introducing disulfide bond As shown in FIG. 1, protein C7-NM has 8 P—strands and a loop is formed between two adjacent P—strands. Protein C7-NM was used as parent protein, and the program Disulfide by Design 2.0 (DbD2) was used for design of introducing a disulfide bond into the parent protein with reference to the parameters including a B-factor, a x3 angle, and an energy. As shown in FIG. 2 and Table 1, the designable site for disulfide bond formation is between two P— strands, between two loops, or between one P—strand and one loop. The amino acid sequences of variant proteins having at least one disulfide bond are listed in Table 2, and each variant protein is obtained by introducing the amino acid sequence of protein C7 as reference sequence and performing amino acid substitution thereon according to the designable site for disulfide bond formation. Table 1: crystallography parameter Site for disulfide bond formation X3 angle Energy B-factor C7- LL1 L9ioop / W23ioop +108.9 0.96 32.53 C7- LL2 S18loop / S61loop +118.6 2.83 30.52 C7- LL3 T40loop / D68loop -78.0 1.46 54.97 C7- LL4 K64ioop / V67ioop +81.4 2.43 33.68 C7- SS1 L20strand / T59strand +122.0 2.56 33.88 C7- SS2 I35strand / F49strand C7- SS3 Y37strand / I71 strand +125.7 3.11 27.37 C7- SL1 L9looP / S90strand +95.7 5.48 29.88 C7- SL2 T36strand / V46loop +120.0 3.61 48.37 C7- SL3 G38strand / V46loop -86.9 4.52 49.88 C7- SL4 D68loop / N92strand Table 2: amino acid sequence Protein Sequence 10Fn3-WT VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEF TVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT C7 VSDVI ftvpL RDLE qppT VVAATPTSLLISW| rHpHfptR atisglkpgvdytitvyavtD YYRITYGETGGNSPVQE . RNGRLLSIpISINYRT C7-NM MVSD EFTVP HHHH VPRD LQPP HH LEVVEASPTSIQISWRHP TATISGLKPGVDYTITVY HFPT AVTI RYYRITYGETGGNSPVQ ) GRNGRLLSIpISINYRT C7-LL1- His MVSD EFTVP HHHH VPRD. LQPP HH cevvaatptsllisc|rh|p TATISGLKPGVDYTITVY HFPT AVTI RYYRITYGETGGNSPVQ ) GRNGRLLSIpISINYRT C7-LL2- His MVSD EFTVP HHHH VPRD LQPP HH levvaatptclliswRHp TATICGLKPGVDYTITVY HFp AVTI [| RYYRITYGETGGNSPVQ ) GRNGRLLSIPISINYRT C7-LL3- His MVSD EFTVP HHHH VPRD LQPP HH levvaatptslliswRHP TATISGLKPGVCYTITVY HFPT AVTI RYYRITYGECGGNSPVQ ) GRNGRLLSIPISINYRT C7-LL4- His MVSD EFTVP HHHH VPRD LQPP HH levvaatptslliswRHP TATISGLCPGCDYTITVY HFPT AVTI RYYRITYGETGGNSPVQ ) GRNGRLLSIPISINYRT C7-SS1- His MVSDV EFTVP|] HHHHH PRDL L QPP H evvaatptslciswRhP r ACISGLKPGVDYTITVY HFPT AVTD ryyritygetggnspvq grngrlLsIPisinyrt C7-SS2- His MVSDV QECTV THHHH PRDL pLqp HH EVVAATPTSLLISwRhP pTATISGLKPGVDYTITV HFPT YAVT RYYRCTYGE dgrngrll tggnspv s|pisinyr C7-SS3- His MVSDV EFTVP|] HHHHf PRDL L QPP H EVVAATPTSLLISwRhP r atisglkpgvdytctvy HFPT T AVTI ryyritcgetggnspvq ) GRNGRLLSIPISINYRT C7-SL1- His MVSDV EFTVP|] HHHHH J PRDC L QPP H :EVVAATPTSLLISwRhP ATISGLKPGVDYTITVY HFPT VVTD ryyritygetggnspvq GRNGRLLSIpICINYRT C7-SL2- His MVSDV EFTVP|] HHHHH PRDL L QPP H EVVAATPTSLLISwRhP ATISGLKPGVDYTITVY HFPT VVTD ryyricygetggnspcq GRNGRLLSIPISINYRT C7-SL3- His MVSDV EFTVP|] HHHHH PRDL L QPP H EVVAATPTSLLISwRhP ATISGLKPGVDYTITVY HFPT VVTD ryyritycetggnspcq GRNGRLLSIPISINYRT C7-SL4- His MVSDV EFTVP|] HHHHH PRDL L QPP H EVVAATPTSLLISwRhP r atisglkpgvcytitvy HFPT VVTD ryyritygetggnspvq GRNGRLLSIpISICYRT C7-SL1- LL2-His MVSDV QEFTV THHHH J PRDC PLQP HH :evvaatptclliswRHp PTATICGLKPGVDYTITV HFPT YAVT RYYRITYGE dgrngrll tggnspv s|picinyr C7-SL1- LL3-His mvsdvprdcevvaatptslliswRHPhfptRyyritygecggnspvq eftvpLqppTatisglkpgvcytitvyavTdgrngrllSIPicinyrt HHHHHH 1. Any one-letter symbol within the box is a mutant amino acid residue relative to protein 10Fn3-WT 2. Any one-letter symbol above the bottom line is a mutant amino acid residue relative to protein C7 Example 2: protein production Protein C7 and its variant protein were expressed in Escherichia coli. Briefly, protein C7 and its variant protein were expressed in either a bacterial 5 strain BL21(DE3) pLysS or a bacterial strain SHuffle. The medium for strain BL21(DE3) pLysS was a LB medium; that for strain SHuffle was a LLB medium. Firstly, a strain BL21(DE3) pLysS was cultivated in a 5-mL culture 10 medium at 37OC for 16-18 hours (30°C for strain SHuffle). The strain BL21(DE3) pLysS was transferred to a 500-mL culture medium, and then cultivated at 37OC for approximately 4 hours (30°C and 6 hours for strain SHuffle). After 500pL-IPTG (the concentration was 1 M) was added, the strain BL21(DE3) pLysS was induced at 25C for approximately 16-18 hours to 15 express protein (16C and 48 hours for strain SHuffle). After which, the cell pellet was obtained by centrifugation. Bacteria were dissolved in binding Buffer A (50 mM of sodium phosphate, 300 mM of sodium chloride, pH7.0) and then were lysed with a French press (the pressure was 1500 psi). After a supernatant was obtained by centrifugation, the supernatant was loaded into a nickel column pre-equilibrated with Buffer A. A target protein was eluted with gradient of elution buffer (300 mM of imidazole in Buffer A, pH7.0). After elution, glycine SDS-PAGE was performed for protein confirmation. Finally, dialysis with PBS was performed on the obtained recombinant protein, and the recombinant protein was stored at -80C until being used. Example 3: analysis for protein property Differential scanning calorimetry (DSC) was used to measure the melting temperature of protein. As shown in Table 3 and FIG. 3, the difference in melting temperature between protein C7-SL1 and protein C7 is 37.0C higher than that between other protein having a single disulfide bond and protein C7, which implies that protein C7-SL1 has good thermostability. As shown in Table 3 and FIGS. 3-4, protein C7-SL1-LL2 and protein C7-SL1-LL3, each protein obtained by introducing another disulfide bond in protein C7-SL1, have better thermostability. Ammonium sulfate precipitation was used to measure the protein solubility with reference to J Pharm Sci. 2008 Oct;97(10):4155-66. As shown in Table 3, the solubility of protein C7-SL1 in PBS is approximately six times greater than that of protein C7, and also greater than other protein having a single disulfide bond, which indicates that protein C7-SL1 has good solubility. As shown in Table 3, protein C7-SL1-LL2 and protein C7-SL1-LL3, each protein obtained by introducing another disulfide bond in protein C7-SL1, have the solubility in PBS seven times greater than that of protein C7. Cell proliferation assay was used to analyze the inhibitory activity of protein against human umbilical vein endothelial cell (HUVEC) proliferation. As shown in Table 3, there is no significant difference between the inhibitory activity of protein C7-SL1 against HUVEC proliferation and that of protein C7, which implies that protein C7-SL1 has the ability to inhibit angiogenesis. As shown in Table 3, protein C7-SL1-LL2 and protein C7-SL1-LL3, each protein obtained by introducing another disulfide bond in protein C7-SL1, have inhibitory activity against HUVEC proliferation not significantly different from that of protein C7. This implies protein C7-SL1-LL2 and protein C7-SL1-LL3 also have the ability to inhibit angiogenesis. Enzyme-linked immunosorbent assay (ELISA) was used to analyze the affinity of protein to vascular endothelial growth factor receptor 2. As shown in Table 3, there is no significant difference between the affinity of protein C7-SL1 to vascular endothelial growth factor receptor 2 and that of protein C7, which implies that protein C7-SL1 has the ability to bind to vascular endothelial growth factor receptor 2. As shown in Table 3 and FIG. 6, protein C7-SL1-LL2 and protein C7-SL1-LL3, each protein obtained by introducing another disulfide bond in protein C7-SL1, have the affinity to vascular endothelial growth factor receptor 2 not significantly different from that of protein C7. Specifically, the affinity of protein C7-SL1-LL2 to vascular endothelial growth factor receptor 2 is slightly greater than that of protein C7. This implies that protein C7-SL1-LL2 and protein C7-SL1-LL3 also have the ability to bind to vascular endothelial growth factor receptor 2. 5 Table 3. protein property Site for disulfide bond formation Yield (mg / L) Solubility in PBS (mg / mL) Thermostability Inhibition of HUVEC proliferation: IC50 (nM) Binding affinity to VEGFR2: IC50 (nM) Tm (°C) ATm (°C) C7 34.7 1 59.3 0 34.2±6.8 16.8±4.4 C7- LL1 L9loop / W 23ioop ND ND ND ND ND ND C7- LL2 S18loop / S 61loop 5.8 ND 75.7 +16.4 93.8±20.4 18.9±0.9 C7- LL3 T40loop / D 68loop 10.7 ND 76.5 +17.2 73.9±0.0 9.8±0.0 C7- LL4 K64loop / V 67loop 3.5 ND ND ND 384.9±292.3 16.6±3.0 C7- SS1 L20strand / T59strand 3.9 ND 73.3 +14.0 ND 17.5±1.5 C7- SS2 I35strand / F 49strand ND ND ND ND ND ND C7- SS3 Y37strand / I 71 strand ND ND ND ND ND ND C7- SL1 L9loop / S9 0strand 101.0 5.9 96.3 +37.0 48.6±10.2 17.6±2.8 C7- SL2 T36strand / V46loop 14.7 2.0 49.2 -10.1 146.9±0.0 17.1±4.2 C7- SL3 G38strand / V46loop 12.4 2.7 71.9 +12.6 115.2±0.0 21.3±0.0 C7- SL4 D68loop / N 92strand 4.5 ND 61.6 +2.3 354.0±0.0 18.5±4.0 C7- SL1- LL2 L9loop / S9 0strand S18loop / S 61 loop 15.3 6.7 111.3 +52.0 52.0±15.1 12.8±0.0 C7- SL1- LL3 L9loop / S 90strand T40loop / D 68loop 13.8 6.5 111.1 +51.8 55.4±8.9 19.2±3.5 1. ATm = (Tm of the test protein) - (Tm of protein C7) 2. ND indicates not detectable because of protein formation in inclusion bodies or not being detected While the invention has been described in connection with what is considered the most practical and preferred embodiments, it is understood that this invention is not limited to the disclosed embodiments but is intended to cover various arrangements included within the spirit and scope of the broadest 5 interpretation so as to encompass all such modifications and equivalent arrangements.
Claims
1. A protein, comprising: a 10th human fibronectin type III domain, wherein the protein has a first mutation at an amino acid residue with a cysteine residue5 and a second mutation at another amino acid residue with another cysteine residue, wherein the first mutation and the second mutation take place at a region of the 10th human fibronectin type III domain other than a loop FG so that a disulfide bond is formed between the cysteine residue formed by the first mutation and the cysteine residue formed by the second mutation;10 wherein the protein comprises: an amino acid sequence of SEQ ID No.:11, 15, or 16.
2. A protein, comprising: a 10th human fibronectin type III domain, wherein the protein has a first mutation at an amino acid residue with a cysteine residue 15 and a second mutation at another amino acid residue with another cysteineresidue, wherein the first mutation and the second mutation take place at a region of the 10th human fibronectin type III domain other than a loop FG so that a disulfide bond is formed between the cysteine residue formed by the first mutation and the cysteine residue formed by the second mutation;20 wherein the protein comprises: an amino acid sequence of SEQ ID No.:13.
3. A pharmaceutical composition, comprising:a protein as claimed in claim 1 or 2; and25 a pharmaceutically acceptable carrier.2022484476 31 Jul 20264. A method for treating or preventing a disease or a disorder caused by vascular endothelial growth factor receptor 2 activity, comprising:administering a pharmaceutical composition as claimed in claim 3 to a5 subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit an activity thereof.
5. A method for treating or preventing a disease or a disorder caused by angiogenesis, comprising:10 administering a pharmaceutical composition as claimed in claim 3 to asubject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit angiogenesis.
6. A protein, comprising:15 a 10th human fibronectin type III domain;wherein the 10th human fibronectin type III domain comprises: an aminoacid sequence of SEQ ID No.: 1;wherein the protein comprises: a mutation to substitute positions 23-31 of SEQ ID No.: 1 with RHPHFPTRY, a mutation to substitute positions 51-56 of20 SEQ ID No.: 1 with PLQPPT, and a mutation to substitute positions 75-87 of SEQ ID No.: 1 with VTDGRNGRLLSIP;wherein the protein comprises: a first mutation and a second mutation so that a disulfide bond is formed between a cysteine residue formed by the first mutation and a cysteine residue formed by the second mutation;25 wherein the first mutation comprises: a substitution of a leucine residue at2022484476 31 Jul 2026position 8 of SEQ ID No.: 1 with the cysteine residue, and the second mutation comprises: a substitution of a serine residue at position 89 of SEQ ID No.: 1 with the cysteine residue.5 7. The protein as claimed in claim 6, further comprising:a third mutation and a fourth mutation so that a disulfide bond is formed between a cysteine residue formed by the third mutation and a cysteine residue formed by the fourth mutation;wherein the third mutation comprises: a substitution of a serine residue at10 position 17 of SEQ ID No.: 1 with the cysteine residue, and the fourth mutation comprises: a substitution of a serine residue at position 60 of SEQ ID No.: 1 with the cysteine residue.
8. The protein as claimed in claim 6, further comprising:15 a third mutation and a fourth mutation so that a disulfide bond is formedbetween a cysteine residue formed by the third mutation and a cysteine residue formed by the fourth mutation;wherein the third mutation comprises: a substitution of a threonine residue at position 39 of SEQ ID No.: 1 with the cysteine residue, and the fourth20 mutation comprises: a substitution of an aspartate residue at position 67 of SEQ ID No.: 1 with the cysteine residue.
9. The protein as claimed in claim 6, comprising: an amino acid sequence of SEQ ID No.: 11.252022484476 31 Jul 202610. The protein as claimed in claim 7, comprising: an amino acid sequence of SEQ ID No.: 15.
11. The protein as claimed in claim 8, comprising: an amino acid sequence of 5 SEQ ID No.: 16.
12. A pharmaceutical composition, comprising:a protein as claimed in claim 6, 7, 8, 9, 10, or 11; anda pharmaceutically acceptable carrier.1013. A method for treating or preventing a disease or a disorder caused by vascular endothelial growth factor receptor 2 activity, comprising:administering a pharmaceutical composition as claimed in claim 12 to a subject in need thereof to bind to the subject’s vascular endothelial growth15 factor receptor 2 so as to inhibit an activity thereof.
14. A method for treating or preventing a disease or a disorder caused by angiogenesis, comprising:administering a pharmaceutical composition as claimed in claim 12 to a20 subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit angiogenesis.
15. A protein, comprising:a 10th human fibronectin type III domain;25 wherein the 10th human fibronectin type III domain comprises: an amino2022484476 31 Jul 2026acid sequence of SEQ ID No.: 1;wherein the protein comprises: a mutation to substitute positions 23-31 of SEQ ID No.: 1 with RHPHFPTRY, a mutation to substitute positions 51-56 of SEQ ID No.: 1 with PLQPPT, and a mutation to substitute positions 75-87 of5 SEQ ID No.: 1 with VTDGRNGRLLSIP;wherein the protein comprises: a first mutation and a second mutation so that a disulfide bond is formed between a cysteine residue formed by the first mutation and a cysteine residue formed by the second mutation;wherein the first mutation comprises: a substitution of a glycine residue at10 position 37 of SEQ ID No.: 1 with the cysteine residue, and the second mutation comprises: a substitution of a valine residue at position 45 of SEQ ID No.: 1 with the cysteine residue.
16. The protein as claimed in claim 15, comprising: an amino acid sequence of 15 SEQ ID No.: 13.
17. A pharmaceutical composition, comprising:a protein as claimed in claim 15 or 16; anda pharmaceutically acceptable carrier.2018. A method for treating or preventing a disease or a disorder caused byvascular endothelial growth factor receptor 2 activity, comprising:administering a pharmaceutical composition as claimed in claim 17 to a subject in need thereof to bind to the subject’s vascular endothelial growth25 factor receptor 2 so as to inhibit an activity thereof.2022484476 31 Jul 202619. A method for treating or preventing a disease or a disorder caused by angiogenesis, comprising:administering a pharmaceutical composition as claimed in claim 17 to a5 subject in need thereof to bind to the subject’s vascular endothelial growth factor receptor 2 so as to inhibit angiogenesis.
Citation Information
Patent Citations
Libraries of modified fibronectin type III tenth domain-containing polypeptides
US10995131B2
Multivalent fibronectin based scaffold domain proteins
US20210017252A1