Genome engineering
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- PRESIDENT & FELLOWS OF HARVARD COLLEGE
- Filing Date
- 2023-10-13
- Publication Date
- 2026-07-30
AI Technical Summary
Current methods for genome editing in human induced pluripotent stem cells using Transcription Activator-Like Effector Nucleases (TALENs) face challenges due to repetitive sequences, which complicate DNA construct synthesis and impair lentiviral gene delivery, and existing assays for evaluating Non-Homologous End Joining (NHEJ) and Homology Directed Repair (HDR) have limited sensitivity and accuracy.
Development of modified TALENs lacking repeat sequences longer than 100 bp, combined with guide RNAs to direct site-specific DNA cleavage and insertion of donor nucleic acids, enabling precise genome editing and improved sensitivity in detecting editing frequencies through novel assay methods.
Enhances genome editing efficiency and sensitivity in human induced pluripotent stem cells by reducing repetitive sequence complications and improving assay accuracy, allowing for precise multiplex modifications and scarless genome editing.
Smart Images

Figure 00000068_0000 
Figure 00000068_0001 
Figure 00000068_0002
Abstract
Description
RELATED APPLICATION DATA This application is a divisional of Australian Patent Application No. 2021202581, which is 5 a divisional of Australian Patent Application No. 2018278911, which is a divisional of Australian Patent Application No. 2014293015, the entire contents of which is incorporated herein by reference. STATEMENT OF GOVERNMENT INTERESTS 10 This invention was made with government support under P50 HG003170 from the National Human Genome Research Center for Excellence in Genomics Science. The government has certain rights in the invention. BACKGROUND 15 Genome editing via sequence-specific nucleases is known. See references 1, 2, and 3 hereby incorporated by reference in their entireties. A nuclease-mediated double-stranded DNA (dsDNA) break in the genome can be repaired by two main mechanisms: Non-Homologous End Joining (NHEJ), which frequently results in the introduction of non-specific insertions and deletions (indels), or homology directed repair (HDR), which incorporates a homologous strand as 20 a repair template. See reference 4 hereby incorporated by reference in its entirety. When a sequence-specific nuclease is delivered along with a homologous donor DNA construct containing the desired mutations, gene targeting efficiencies are increased by 1000-fold compared to just the donor construct alone. See reference 5 hereby incorporated by reference in its entirety. Use of single stranded oligodeoxyribonucleotides (“ssODNs”) as DNA donors has been reported. See 25 references 21 and 22 hereby incorporated by reference in their entireties. Despite large advances in gene editing tools, many challenges and questions remain regarding the use of custom-engineered nucleases in human induced pluripotent stem cell (“hiPSC”) engineering. First, despite their design simplicity, Transcription Activator-Like Effectors Nucleases (TALENs) target particular DNA sequences with tandem copies of Repeat 30 Variable Diresidue (RVD) domains. See reference 6 hereby incorporated by reference in its entirtety. While the modular nature of RVDs simplifies TALEN design, their repetitive sequences complicate methods for synthesizing their DNA constructs (see references 2, 9, and 15-19 hereby incorporated by reference in their entireties) and also impair their use with lentiviral gene delivery vehicles. See reference 13 hereby incorporated by reference in its entirety. 2023248167 13 Oct 2023 In current practice, NHEJ and HDR are frequently evaluated using separate assays. Mismatch-sensitive endonuclease assays (see reference 14 hereby incorporated by reference in its entirety) are often used for assessing NHEJ, but the quantitative accuracy of this method is variable and the sensitivity is limited to NHEJ frequencies greater than~3%. See reference 15 hereby 5 incorporated by reference in its entirety. HDR is frequently assessed by cloning and sequencing, a completely different and often cumbersome procedure. Sensitivity is still an issue because, while high editing frequencies on the order of 50% are frequently reported for some cell types, such as U2OS and K562 (see references 12 and 14 hereby incorporated by reference in their entireties), frequencies are generally lower in hiPSCs. See reference 10 hereby incorporated by reference in 10 its entirety. Recently, high editing frequencies have been reported in hiPSC and hESC using TALENs (see reference 9 hereby incorporated by reference in its entirety), and even higher frequencies with the CRISPR Cas9-gRNA system (see references 16-19 hereby incorporated by reference in their entireties. However, editing rates at different sites appear to vary widely (see reference 17 hereby incorporated by reference in its entirety), and editing is sometimes not 15 detectable at all at some sites (see reference 20 hereby incorporated by reference in its entirety). Bacterial and archaeal CRISPR-Cas systems rely on short guide RNAs in complex with Cas proteins to direct degradation of complementary sequences present within invading foreign nucleic acid. See Deltcheva, E. et al. CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature 471, 602-607 (2011); Gasiunas, G., Barrangou, R., Horvath, P. & 20 Siksnys, V. Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proceedings of the National Academy of Sciences of the United States of America 109, E2579-2586 (2012); Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012); Sapranauskas, R. et al. The Streptococcus thermophilus CRISPR / Cas system provides immunity in Escherichia coli. 25 Nucleic acids research 39, 9275-9282 (2011); and Bhaya, D., Davison, M. & Barrangou, R. CRISPR-Cas systems in bacteria and archaea: versatile small RNAs for adaptive defense and regulation. Annual review of genetics 45, 273-297 (2011). A recent in vitro reconstitution of the S. pyogenes type II CRISPR system demonstrated that crRNA (“CRISPR RNA”) fused to a normally trans-encoded tracrRNA (“trans-activating CRISPR RNA”) is sufficient to direct Cas9 protein to 30 sequence-specifically cleave target DNA sequences matching the crRNA. Expressing a gRNA homologous to a target site results in Cas9 recruitment and degradation of the target DNA. See H. Deveau et al., Phage response to CRISPR-encoded resistance in Streptococcus thermophilus. Journal of Bacteriology 190, 1390 (Feb, 2008). 2023248167 13 Oct 2023 SUMMARY Aspects of the present disclosure are directed to the use of modified Transcription Activator-Like Effector Nucleases (TALENs) for genetically modifying a cell, such as a somatic cell or a stem cell. TALENs are known to include repeat sequences. Aspects of the present 5 disclosure are directed to a method of altering target DNA in a cell including introducing into a cell a TALEN lacking repeat sequences 100 bp or longer wherein the TALEN cleaves the target DNA and the cell undergoes nonhomologous end joining to produce altered DNA in the cell. According to certain aspects, repeat sequences of desired length have been removed from a TALEN. According to certain aspects, the TALEN is devoid of repeat sequences of certain desired length. 10 According to certain aspects, a TALEN is provided with repeat sequences of desired length removed. According to certain aspects, a TALEN is modified to remove repeat sequences of desired length. According to certain aspects, a TALEN is engineered to remove repeat sequences of desired length. Aspects of the present disclosure include methods of altering target DNA in a cell 15 including combining within a cell a TALEN lacking repeat sequences 100 bp or longer and a donor nucleic acid sequence wherein the TALEN cleaves the target DNA and the donor nucleic acid sequence is inserted into the DNA in the cell. Aspects of the present disclosure are directed to a virus including a nucleic acid sequence encoding a TALEN lacking repeat sequences 100 bp or longer. Aspects of the present disclosure are directed to a cell including a nucleic acid sequence 20 encoding a TALEN lacking repeat sequences 100 bp or longer. According to certain aspects described herein, the TALEN lacks repeat sequences 100 bp or longer, 90 bp or longer, 80 bp or longer, 70 bp or longer, 60 bp or longer, 50 bp or longer, 40 bp or longer, 30 bp or longer, 20 bp or longer, 19 bp or longer, 18 bp or longer, 17 bp or longer, 16 bp or longer, 15 bp or longer, 14 bp or longer, 13 bp or longer, 12 bp or longer, 11 bp or longer, or 10 bp or longer. 25 Aspects of the present disclosure are directed to making a TALE including combining an endonuclease, a DNA polymerase, a DNA ligase, an exonuclease, a plurality of nucleic acid dimer blocks encoding repeat variable diresidue domains and a TALE-N / TF backbone vector including an endonuclease cutting site, activating the endonuclease to cut the TALE-N / TF backbone vector at the endonuclease cutting site to produce a first end and a second end, activating the exonuclease 30 to create a 3’ and a 5’ overhang on the TALE-N / TF backbone vector and the plurality of nucleic acid dimer blocks and to anneal the TALE-N / TF backbone vector and the plurality of nucleic acid dimer blocks in a desired order, activating the DNA polymerase and the DNA ligase to connect the TALE-N / TF backbone vector and the plurality of nucleic acid dimer blocks. One of skill in the art will readily based on the present disclosure be able to identify suitable endonucleases, DNA 35 polymerases, DNA ligases, exonucleases, nucleic acid dimer blocks encoding repeat variable diresidue domains and TALE-N / TF backbone vectors. 2023248167 13 Oct 2023 Aspects of the present disclosure are directed to a method of altering target DNA in a stem cell expressing an enzyme that forms a co-localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner including (a) introducing into the stem cell a first foreign nucleic acid encoding an RNA complementary to the target DNA 5 and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA, introducing into the stem cell a second foreign nucleic acid encoding a donor nucleic acid sequence, wherein the RNA and the donor nucleic acid sequences are expressed, wherein the RNA and the enzyme co-localize to the target DNA, the enzyme cleaves the target DNA and the donor nucleic acid is inserted into the target DNA to 10 produce altered DNA in the stem cell. Aspects of the present disclosure are directed to a stem cell including a first foreign nucleic acid encoding for an enzyme that forms a co-localization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner. Aspects of the present disclosure are directed to a cell including a first foreign nucleic acid 15 encoding for an enzyme that forms a co-localization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner and including an inducible promoter for promoting expression of the enzyme. In this manner, expression can be regulated, for example, it can be started and it can be stopped. Aspects of the present disclosure are directed to a cell including a first foreign nucleic acid 20 encoding for an enzyme that forms a co-localization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner, wherein the first foreign nucleic acid is removable from genomic DNA of the cell using a removal enzyme, such as a transposase. Aspects of the present disclosure are directed to a method of altering target DNA in a cell expressing an enzyme that forms a co-localization complex with RNA complementary to the target 25 DNA and that cleaves the target DNA in a site specific manner including (a) introducing into the cell a first foreign nucleic acid encoding a donor nucleic acid sequence, introducing into the cell from media surrounding the cell an RNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA, wherein the donor nucleic acid sequence is expressed, wherein the 30 RNA and the enzyme co-localize to the target DNA, the enzyme cleaves the target DNA and the donor nucleic acid is inserted into the target DNA to produce altered DNA in the cell. Aspects of the present disclosure are directed to the use of an RNA guided DNA binding protein for genetically modifying a stem cell. In one aspect, the stem cell has been genetically modified to include a nucleic acid encoding for the RNA guided DNA binding protein and the stem 35 cell expresses the RNA guided DNA binding protein. According to a certain aspect, donor nucleic 2023248167 13 Oct 2023 acids for introducing specific mutations are optimized for genome editing using either the modified TALENs or the RNA guided DNA binding protein. Aspects of the present disclosure are directed to the modification of DNA, such as multiplex modification of DNA, in a stem cell using one or more guide RNAs (ribonucleic acids) 5 to direct an enzyme having nuclease activity expressed by the stem cell, such as a DNA binding protein having nuclease activity, to a target location on the DNA (deoxyribonucleic acid) wherein the enzyme cuts the DNA and an exogenous donor nucleic acid is inserted into the DNA, such as by homologous recombination. Aspects of the present disclosure include cycling or repeating steps of DNA modification on a stem cell to create a stem cell having multiple modifications of DNA 10 within the cell. Modifications may include insertion of exogenous donor nucleic acids. Multiple exogenous nucleic acid insertions can be accomplished by a single step of introducing into a stem cell, which expresses the enzyme, nucleic acids encoding a plurality of RNAs and a plurality of exogenous donor nucleic acids, such as by co-transformation, wherein the RNAs are expressed and wherein each RNA in the plurality guides the enzyme to a particular site 15 of the DNA, the enzyme cuts the DNA and one of the plurality of exogenous nucleic acids is inserted into the DNA at the cut site. According to this aspect, many alterations or modification of the DNA in the cell are created in a single cycle. Multiple exogenous nucleic acid insertions can be accomplished in a cell by repeated steps or cycles of introducing into a stem cell, which expresses the enzyme, one or more nucleic acids 20 encoding one or more RNAs or a plurality of RNAs and one or more exogenous nucleic acids or a plurality of exogenous nucleic acids wherein the RNA is expressed and guides the enzyme to a particular site of the DNA, the enzyme cuts the DNA and the exogenous nucleic acid is inserted into the DNA at the cut site, so as to result in a cell having multiple alterations or insertions of exogenous DNA into the DNA within the stem cell. According to one aspect, the stem cell 25 expressing the enzyme has been genetically altered to express the enzyme such as by introducing into the cell a nucleic acid encoding the enzyme and which can be expressed by the stem cell. In this manner, aspects of the present disclosure include cycling the steps of introducing RNA into a stem cell which expresses the enzyme, introducing exogenous donor nucleic acid into the stem cell, expressing the RNA, forming a co-localization complex of the RNA, the enzyme and the DNA, 30 enzymatic cutting of the DNA by the enzyme, and insertion of the donor nucleic acid into the DNA. Cycling or repeating of the above steps results in multiplexed genetic modification of a stem cell at multiple loci, i.e., a stem cell having multiple genetic modifications. According to certain aspects, DNA binding proteins or enzymes within the scope of the present disclosure include a protein that forms a complex with the guide RNA and with the guide 35 RNA guiding the complex to a double stranded DNA sequence wherein the complex binds to the DNA sequence. According to one aspect, the enzyme can be an RNA guided DNA binding 2023248167 13 Oct 2023 protein, such as an RNA guided DNA binding protein of a Type II CRISPR System that binds to the DNA and is guided by RNA. According to one aspect, the RNA guided DNA binding protein is a Cas9 protein. This aspect of the present disclosure may be referred to as co-localization of the RNA and 5 DNA binding protein to or with the double stranded DNA. In this manner, a DNA binding proteinguide RNA complex may be used to cut multiple sites of the double stranded DNA so as to create a stem cell with multiple genetic modifications, such as multiple insertions of exogenous donor DNA. According to certain aspects, a method of making multiple alterations to target DNA in a 10 stem cell expressing an enzyme that forms a co-localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner is provided including (a) introducing into the stem cell a first foreign nucleic acid encoding one or more RNAs complementary to the target DNA and which guide the enzyme to the target DNA, wherein the one or more RNAs and the enzyme are members of a co-localization complex for the target DNA, 15 introducing into the stem cell a second foreign nucleic acid encoding one or more donor nucleic acid sequences, wherein the one or more RNAs and the one or more donor nucleic acid sequences are expressed, wherein the one or more RNAs and the enzyme co-localize to the target DNA, the enzyme cleaves the target DNA and the donor nucleic acid is inserted into the target DNA to produce altered DNA in the stem cell, and repeating step (a) multiple times to produce multiple 20 alterations to the DN A in the stem cell. According to one aspect, the RNA is between about 10 to about 500 nucleotides. According to one aspect, the RNA is between about 20 to about 100 nucleotides. According to one aspect, the one or more RNAs is a guide RNA. According to one aspect, the one or more RNAs is a tracrRNA-crRNA fusion. 25 According to one aspect, the DNA is genomic DNA, mitochondrial DNA, viral DNA, or exogenous DNA. According to one aspect, a cell may be genetically modified to reversibly include a nucleic acid encoding a DNA binding enzyme using a vector which can be easily removed using an enzyme. Useful vectors methods are known to those of skill in the art and include lentivirus, adeno 30 associated virus, nuclease and integrase mediated tarteget insertion methods and transposon mediated insertion methods. According to one aspect, the nucleic acid encoding a DNA binding enzyme that has been added, such as by using a cassette or vector can be removed in its entirety along with the cassette and vector and without leaving a portion of such nucleic acid, cassette or vector in the genomic DNA, for example. Such removal is referred to in the art as “scarless” 35 removal, as the genome is the same as it was before addition of the nucleic acid, cassette or vector. 2023248167 13 Oct 2023 One exemplary embodiment for insertion and scarless removal is a PiggyBac vector commercially available from System Biosciences. Further features and advantages of certain embodiments of the present invention will become more fully apparent in the following description of embodiments and drawings thereof, 5 and from the claims. BRIEF DESCRIPTION OF THE DRAWINGS The foregoing and other features and advantages of the present embodiments will be more fully understood from the following detailed description of illustrative embodiments taken in 10 conjunction with the accompanying drawings in which: Fig. 1 is directed to functional tests of re-TALENs in human somatic and stem cells. (a) Schematic representation of experimental design for testing genome targeting efficiency. A genomically integrated GFP coding sequence is disrupted by the insertion of a stop codon and a 68bp genomic fragment derived from the AAVS1 locus (bottom). Restoration of the GFP sequence 15 by nuclease-mediated homologous recombination with tGFP donor (top) results in GFP+ cells that can be quantitated by FACS. Re-TALENs and TALENs target identical sequences within AAVS1 fragments. (b) Bar graph depicting GFP+ cell percentage introduced by tGFP donor alone, TALENs with tGFP donor, and re-TALENs with tGFP donor at the target locus, as measured by FACS. (N=3, 20 error bar =SD) Representative FACS plots are shown below. (c) Schematic overview depicting the targeting strategy for the native AAVS1 locus. The donor plasmid, containing splicing acceptor (SA)- 2A (self-cleaving peptides), puromycin resistant gene (PURO) and GFP were described (see reference 10 hereby incorporated by reference in its entirety. The locations of PCR primers used to detect successful editing events are depicted as blue arrows. 25 (d) Successfully targeted clones of PGP1 hiPSCs were selected with puromycin (0.5ug / mL) for 2 weeks. Microscopy images of three representative GFP+ clones are shown. Cells were also stained for the pluripotency markers TRA-1-60. Scale bar: 200 pm. (e) PCR assays performed on these the monoclonal GFP+ hiPSC clones demonstrated successful insertions of the donor cassettes at the AAVS1 site (lane 1,2,3), whereas plain hiPSCs show no 30 evidence of successful insertion (lane C). Fig. 2 relates to a comparison of reTALENs and Cas9-gRNAs genome targeting efficiency on CCR5 in iPSCs. (a) Schematic representation of genome engineering experimental design. At the re-TALEN pair or Cas9-gRNA targeting site, a 90mer ssODN carrying a 2bp mismatch against the genomic DNA 35 was delivered along with the reTALEN or Cas9-gRNA constructs into PGP1 hiPSCs. The cutting sites of the nucleases are depicted as red arrows in the figure. 2023248167 13 Oct 2023 (b) Deep sequencing analysis of HDR and NHEJ efficiencies for re-TALEN pairs (CCR5 #3) and ssODN, or the Cas9-gRNA and ssODN. Alterations in the genome of hiPSCs were analyzed from high-throughput sequence data by GEAS. Top: HDR was quantified from the fraction of reads that contained a 2bp point mutation built into the center of the ssODN (blue), and NHEJ activity was 5 quantified from the fraction of deletions (grey) / Insertions (red) at each specific position in the genome. For the reTALEN and ssODN graphs, green dashed lines are plotted to mark the outer boundary of the re-TALEN pair’s binding sites, which are at positions -26bp and +26bp relative to the center of the two re-TALEN binding sites. For Cas9-gRNA and ssODN graphs, the green dashed lines mark the outer boundary of the gRNA targeting site, which are at positions -20 and -1 10 bp relative to the PAM sequence. Bottom: Deletion / Insertion size distribution in hiPSCs analyzed from the entire NHEJ population with treatments indicated above. (c) The genome editing efficiency of re-TALENs and Cas9-gRNAs targeting CCR5 in PGP1 hiPSCs. Top: schematic representation of the targeted genome editing sites in CCR5. The 15 targeting sites 15 are illustrated by blue arrows below. For each site, cells were co-transfected with a pair of reTALENs and their corresponding ssODN donor carrying 2bp mismatches against the genomic DNA. Genome editing efficiencies were assayed 6 days after transfection. Similarly, 15 Cas9-gRNAs were transfected with their corresponding ssODNs individually into PGP 1-hiPSCs to target the same 15 sites and analyzed the efficiency 6 days after transfection. Bottom: the genome editing 20 efficiency of re-TALENs and Cas9-gRNAs targeting CCR5 in PGP1 hiPSCs. Panel 1 and 2 indicate NHEJ and HDR efficiencies mediated by reTALENs. Panel 3 and 4 indicate NHEJ and HDR efficiencies mediated by Cas9-gRNAs. NHEJ rates were calculated by the frequency of genomic alleles carrying deletions or insertions at the targeting region; HDR rates were calculated by the frequency of genomic alleles carrying 2bp mismatches. Panel 5, the DNasel HS profile of a 25 hiPSC cell line from ENCODE database (Duke DNase HS, iPS NIHi7 DS). Of note, the scales of different panels are different. (f) Sanger sequencing of the PCR amplicon from the three targeted hiPSC colonies confirmed that the expected DNA bases at the genome-insertion boundary is present. M: DNA ladder. C: control with plain hiPSCs genomic DNA. 30 Fig. 3 is directed to a study of functional parameters governing ssODN-mediated HDR with re-TALENs ir Cas9-gRNAs in PGP1 hiPSCs. (a) PGP1 hiPSCs were co-transfected with re-TALENs pair (#3) and ssODNs of different lengths (50, 70, 90,110, 130,150,170 nts). All ssODNs possessed an identical 2bp mismatch against the genomic DNA in the middle of their sequence. A 90mer ssODN achieved optimal HDR in the 35 targeted genome. The assessment of HDR, NHEJ-incurred deletion and insertion efficiency is as described herein. 2023248167 13 Oct 2023 (b) 90mer ssODNs corresponding to re-TALEN pair #3 each containing a 2bp mismatch (A) in the center and an additional 2bp mismatch (B) at different positions offset from A (where offsets varied from -30bp->30bp) were used to test the effects of deviations from homology along the ssODN. Genome editing efficiency of each ssODN was assessed in PGP1 hiPSCs. The bottom bar 5 graph shows the incorporation frequency of A only, B only, and A + B in the targeted genome. HDR rates decrease as the distance of homology deviations from the center increase. (c) ssODNs targeted to sites with varying distances (-620bp~ 480bp) away from the target site of re-TALEN pair #3 were tested to assess the maximum distance within which ssODNs can be placed to introduce mutations. All ssODNs earned a 2bp mismatch in the middle of their sequences. 10 Minimal HDR efficiency (<=().06%) was observed when the ssODN mismatch was positioned 40bp away from the middle of re-TALEN pair’s binding site. (d) PGP1 hiPSCs were co-transfected with Cas9-gRNA (AAVS1) and ssODNs of different orientation (Oc: complement to gRNA; On: non-complement to gRNA) and different lengths (30, 50, 70, 90, 110 nt). All ssODNs possessed an identical 2bp mismatch against the genomic DNA in 15 the middle of their sequence. A 70mer Oc achieved optimal HDR in the targeted genome. Fig. 4 is directed to using re-TALENs and ssODNs to obtain monoclonal genome edited hiPSC without selection. (a) Timeline of the experiment. (b) Genome engineering efficiency of re-TALENs pair and ssODN (#3) assessed by the NGS 20 platform described in Figure 2b. (c) Sanger sequencing results of monoclonal hiPSC colonies after genome editing. The 2bp heterogeneous genotype (CT / CT->TA / CT) was successfully introduced into the genome of PGP1-iPS-3-11, PGPl-iPS-3-13 colonies. (d) Immunofluorescence staining of targeted PGPl-iPS-3-11. Cells were stained for the 25 pluripotency markers Tra-1-60 and SSEA4. (e) Hematoxylin and eosin staining of teratoma sections generated from monoclonal PGPl-iPS-3-11 cells. Fig. 5. Design of reTALE. (a) Sequence alignment of the original TALE RVD monomer with monomers in re-TALE-16.5 (re-TALE-Ml ->rc-TALE-M 17). Nucleotide alterations from the 30 original sequence are highlighted in gray, (b) Test of repetitiveness of re-TALE by PCR. Top panel illustrates the structure of re-TALE / TALE and positions of the primers in the PCR reaction. Bottom panel illustrates PCR bands with condition indicated below. The PCR laddering presents with the original TALE template (right lane). Fig. 6. Design and practice of TALE Single-incubation Assembly (TASA) assembly. 35 (a) Schematic representation of the library of re-TALE dimer blocks for TASA assembly. There is a library of 10 re-TALE dimer blocks encoding two RVDs. Within each block, all 16 dimers share 2023248167 13 Oct 2023 the same DNA sequence except the RVD encoding sequences; Dimers in different blocks have distinct sequences but are designed such that they share 32bp overlaps with the adjacent blocks. DNA and amino acid sequence of one dimer (Block6_AC) are listed on the right. (b) Schematic representation of TASA assembly. The left panel illustrates the TASA assembly 5 method: a one-pot incubation reaction is conducted with an enzyme mixture / re-TALE blocks / re- TALE-N / TF backbone vectors. The reaction product can be used directly for bacterial transformation. The right panel illustrates the mechanism of TASA. The destination vector is linearized by an endonuclease at 37°C to cut off ccdB counter-selection cassette; the exonuclease, which processes the end of blocks and linearized vectors, exposes ssDNA overhangs at the end of 10 fragments to allow blocks and vector backbones to anneal in a designated order. W’hen the temperature rises up to 50°C, polymerases and ligases work together to seal the gap, producing the final constructs ready for transformation. (c) TASA assembly efficiency for re-TALEs possessing different monomer lengths. The blocks used for assembly are illustrated on the left and the assembly efficiency is presented on the right. 15 Fig. 7. The functionality and sequence integrity of Lenti-reTALEs. Fig 8. The sensitivity and reproducibility of GEAS. (A) Information-based analysis of HDR detection limit. Given the dataset of re-TALENs (#10) / ssODN, the reads containing the expected editing (HDR) were identified and these HDR reads were systematically removed to generate different artificial datasets with a "diluted" editing 20 signal. Datasets with 100, 99.8, 99.9, 98.9, 97.8, 89.2, 78.4, 64.9, 21.6, 10.8, 2.2, 1.1, 0.2, 0.1, 0.02, and 0% removal of HDR reads were generated to generate artificial datasets with HR efficiency ranging from 0-0.67%. For each individual dataset, mutual information (MI) of the background signal (in purple) and the signal obtained in the targeting site (in green) was estimated. MI at the targeting site is remarkably higher than the background when the HDR efficiency is above 25 0.0014%. A limit of HDR detection between 0.0014% and 0.0071% was estimated. MI calculation is described herein. (B) The test of reproducibility of genome editing assessment system. The pairs of plots (Top and Bottom) show the FIDR and NHEJ assessment results of two replicates with re-TALENs pair and cell type indicated above. For each experiment, nucleofection, targeted genome amplification, 30 deep-sequencing and data analysis were conducted independently. The genome editing assessment variation of replicates was calculated as (|HDRl-HDR2|) / ((HDR+HDR2) / 2) =AHDR / HDR and ^2 (|NHEJ1-NHEJ2|) / ((NHEJl+NHEJ2) / 2) =ANHEJ / NHEJ and the variation results are listed below the plots. The average variation of the system was (19%+11%+4%+9%+10%+35%) / 6=15%. Factors that may contribute to the variations include the status of cells under nucleofection, 35 nucleofection efficiency, and sequencing coverage and quality. 2023248167 13 Oct 2023 Fig. 9. Statistical analysis of NHEJ and HDR efficiencies by reTALENs and Cas9-gRNAs on CCR5. (a) The correlation of HR and NHEJ efficiencies mediated by reTALENs at identical sites in iPSCs (r=0.91, P< IX 10-5). 5 (b) The correlation of HR and NHEJ efficiencies mediated by Cas9-gRNA at identical sites in iPSCs (r=0.74, P=0.002). (c) The correlation of NHEJ efficiencies mediated by Cas9-gRNA and the Tm temperature of gRNA targeting site in iPSCs (r=0.52, P=0.04) Fig. 10. The correlation analysis of genome editing efficiency and epigenetic state. 10 Pearson correlation was used to study possible associations between DNase I sensitivity and genome engineering efficiencies (HR, NHEJ). The observed correlation was compared to a randomized set (N= 100000). Observed correlations higher than the 95th percentile, or lower than the 5th percentile of the simulated distribution were considered as potential associations. No remarkable correlation between DNasel sensitiivty and NHEJ / HR efficiencies was observed. 15 Fig. 11. The impact of homology pairing in the ssODN-mediated genome editing. (a) In the experiment described in Figure 3b, overall HDR as measured by the rate at which the middle 2b mismatch (A) was incorporated decreased as the secondary mismatches B increased their distance from the A (relative position of B to A varies from -30^30bp). The higher rates of incorporation when B is only lObp away from A (-10bp and +10b) may reflect a lesser need for 20 pairing of the SsODN against genomic DNA proximal to the dsDNA break. (b) Distribution of gene conversion lengths along the ssODN. At each distance of B from A, a fraction of HDR events incorporates only A while another fraction incorporates both A and B. These two events may be interpretable in terms of gene conversion tracts (Elliott et al., 1998), whereby A+B events represent long conversion tracts that extend beyond B and A-only events 25 represent shorter ones that do not reach to B. Under this interpretation, a distribution of gene conversion lengths in both directions along the oligo can be estimated (the middle of ssODN is defined as 0, conversion tracks towards the 5’ end of ssODN as - direction, and 3’ end as + direction). Gene conversion tracts progressively decrease in incidence as their lengths increase, a result veiy similar to gene conversion tract distributions seen with dsDNA donors, but on a highly 30 compressed distance scale of tens of bp for the ssDNA oligo vs. hundreds of bases for dsDNA donors. (c) Assays for gene conversion tracts using a single ssODN that contains a series of mutations and measuring contiguous series of incorporations. A ssODN donor with three pairs of 2bp mismatches (orange) spaced at intervals of 1 Ont on either side of the central 2bp mismatch (Top) was used. Few 35 genomic sequencing reads were detected (see reference 62 hereby incorporated by reference in its entirety) carrying >=1 mismatches defined by ssODN among >300,000 reads sequencing this 2023248167 13 Oct 2023 region. All these reads were plotted (bottom) and the sequence of the reads was color coded. Orange: defined mismatches; green: wild type sequence. Genome editing with this ssODN gave rise to a pattern in which middle mutation alone was incorporated 85% (53 / 62) of the time, with multiple B mismatches incorporated at other times. Although numbers of B incorporation events 5 were too low to estimate a distribution of tract lengths > 1 Obp, it is clear that the short tract region from -10-1 Obp predominates. Fig. 12. Cas9-gRNA nuclease and nickases genome editing efficiencies. PGP1 iPSCs were co-transfected with combination of nuclease (C2) (Cas9-gRNA) or nickase (Cc) (Cas9D 1 OA-gRNA) and ssODNs of different orientation (Oc and On). All ssODNs possessed an 10 identical 2bp mismatch against the genomic DNA in the middle of their sequence. The assessment of HDR is described herein. Fig. 13. The design and optimization of re-TALE sequence. The re-TALE sequence was evolved in several design cycles to eliminate repeats. In each cycle, synonymous sequences from each repeat are evaluated. Those with the largest hamming distance to 15 the evolving DNA are selected. The final sequence with cai = 0.59 AG= -9.8 kcal / mol. An R package was provided to carry out this general framework for synthetic protein design. Fig. 14 is a gel image showing PCR validation of the genomic insertion of Cas 9 in PGP1 cells. Line 3, 6, 9, 12 are PCR product of plain PGP1 cell lines. 20 Fig. 15 is a graph of the inRNA expression level of Cas9 mRNA under the induction. Fig. 16 is a graph showing genome targeting efficiency by different RNA designs. Fig. 17 is a graph showing genome targeting efficiency of 44% homologous recombination achieved by a guide RNA - donor DNA fusion. Fig. 18 is a diagram showing the genotype of isogenic PGP1 cell lines generated by system 25 decribed herein. PGPl-iPS-BTHH has the single nucleotides deletion phenotype as the BTHH patient. PGP1-NHEJ has 4bp deletions that generated frame-shift mutations in a different way. Fig. 19 is a graph showing that cardiomyocyte derived from isogenic PGP1 iPS recapitulated defective ATP production and FIFO ATPase specific activity as demonstrated in patient specific cells. 30 DETAILED DESCRIPTION Aspects of the present invention are directed to the use of a TALEN that lacks certain repeat sequences, for nucleic acid engineering, for example by cutting double stranded nucleic acid. The use of the TALEN to cut double stranded nucleic acid can result in nonhomologous end 35 joining (NHEJ) or homologous recombination (HR). Aspects of the present disclosure also 2023248167 13 Oct 2023 contemplate the use of a TALEN that lacks repeat sequences for nucleic acid engineering, for example by cutting double stranded nucleic acid, in the presence of a donor nucleic acid and insertion of the donor nucleic acid into the double stranded nucleic acid, such as by nonhomologous end joining (NHEJ) or homologous recombination (HR). 5 Transcription activator-like effector nucleases (TALENs) are known in the art and include artificial restriction enzymes generated by fusing a TAL effector DNA binding domain to a DNA cleavage domain. Restriction enzymes are enzymes that cut DNA strands at a specific sequence. Transcription activator-like effectors (TALEs) can be engineered to bind to a desired DNA sequence. See Boch, Jens (February 2011). "TALEs of genome targeting". Nature Biotechnology 10 29 (2): 135-6 hereby incorporated by reference in its entirety. By combining such an engineered TALE with a DNA cleavage domain (which cuts DNA strands), a TALEN is produced which is a restriction enzyme that is specific for any desired DNA sequence. According to certain aspects, the TALEN is introduced into a cell for target nucleic acid editing in situ, such as genome editing in situ. 15 According to one aspect, the non-specific DNA cleavage domain from the end of the FokI endonuclease can be used to construct hybrid nucleases that are active in yeast cells, plant cells and animal cells. The FokI domain functions as a dimer, requiring two constructs with unique DNA binding domains for sites in the target genome with proper orientation and spacing. Both the number of amino acid residues between the TALE DNA binding domain and the FokI cleavage 20 domain and the number of bases between the two individual TALEN binding sites affect activity. The relationship between amino acid sequence and DNA recognition of the TALE binding domain allows for designable proteins. Software programs such as DNAWorks can be used to design TALE constructs. Other methods of designing TALE constructs are known to those of skill in the art. See Cermak, T.; Doyle, E. L.; Christian, M.; Wang, L.; Zhang, Y.; Schmidt, C.; Baller, 25 J. A.; Somia, N. V. et al. (2011). "Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting". Nucleic Acids Research. doi:10.1093 / nar / gkr218; Zhang, Feng; et.al. (February 2011). “Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription”, Nature Biotechnology 29 (2): 149-53; Morbitzer, R.; Elsaesser, J.; Hausner, J.; Lahaye, T. (2011). "Assembly of custom TALE-type DNA binding 30 domains by modular cloning". Nucleic Acids Research. doi:10’1093 / nar / gkrl51; Li, T.; Huang, S.; Zhao, X.; Wright, D. A.; Carpenter, S.; Spalding, M. H.; Weeks, D. P.; Yang, B. (2011). "Modularly assembled designer TAL effector nucleases for targeted gene knockout and gene replacement in eukaryotes". Nucleic Acids Research. doi”10.1093 / nar / gkrl88; Geipier, R.; Scholze, H.; Hahn, S.; Streubel, J.; Bonas, LL; Behrens, S. E.; Boch, J. (2011). "Transcriptional 2023248167 13 Oct 2023 Activators of Human Genes with Programmable DNA-Specificity". In Shiu, Shin-Han. PLoS ONE 6 (5): el9509; Weber, E.; Gruetzner, R.; Werner, S.; Engler, C.; Marillonnet, S. (2011). "Assembly of Designer TAL Effectors by Golden Gate Cloning". In Bendahmane, Mohammed. PLoS ONE 6 (5): el9722 hereby incorporated by reference in their entireties. 5 According to an exemplary aspect, once the TALEN genes have been assembled they may inserted into plasmids according to certain embodiments; the plasmids are then used to transfect the target cell where the gene products are expressed and enter the nucleus to access the genome. According to exemplary aspects, TALENs as described herein can be used to edit target nucleic acids, such as genomes, by inducing double-strand breaks (DSB), which cells respond to with 10 repair mechanisms. Exemplary repair mechanisms include non-homologous end joining (NHEJ) which reconnects DNA from either side of a double-strand break where there is very little or no sequence overlap for annealing. This repair mechanism induces errors in the genome via insertion or deletion (indels), or chromosomal rearrangement; any such errors may render the gene products coded at that location non-functional. See Miller, Jeffrey; et.al. (February 2011). "A TALE 15 nuclease architecture for efficient genome editing". Nature Biotechnology 29 (2): 143-8 hereby incorporated by reference in its entirety. Because this activity can vary depending on the species, cell type, target gene, and nuclease used, the activity can be monitored by using a heteroduplex cleavage assay which detects any difference between two alleles amplified by PGR. Cleavage products can be visualized on simple agarose gels or slab gel systems. 20 Alternatively, DNA can be introduced into a genome through NHEJ in the presence of exogenous double-stranded DNA fragments. Homology directed repair can also introduce foreign DNA at the DSB as the transfected double-stranded sequences are used as templates for the repair enzymes. According to certain aspects the TALENs described herein can be used to generate stably modified human embryonic stem cell and induced pluripotent stem cell (IPSCs) clones. 25 According to certain aspects the TALENs described herein can be used to generate knockout species such as C. elegans, knockout rats, knockout mice or knockout zebrafish. According to one aspect of the present disclosure, embodiments are directed to the use of exogenous DNA, nuclease enzymes such as DNA binding proteins and guide RNAs to co-localize to DNA within a stem cell and digest or cut the DNA with insertion of the exogenous DNA. Such 30 DNA binding proteins are readily known to those of skill in the art to bind to DNA for various purposes. Such DNA binding proteins may be naturally occurring. DNA binding proteins included within the scope of the present disclosure include those which may be guided by RNA, referred to herein as guide RNA. According to this aspect, the guide RNA and the RNA guided DNA binding protein foim a co-localization complex at the DNA. Such DNA binding proteins 2023248167 13 Oct 2023 having nuclease activity are known to those of skill in the art, and include naturally occurring DNA binding proteins having nuclease activity, such as Cas9 proteins present, for example, in Type II CRISPR systems. Such Cas9 proteins and Type II CRISPR systems are well documented in the art. See Makarova et al., Nature Reviews, Microbiology, Vol. 9, June 2011, pp. 467-477 including 5 all supplementary information hereby incorporated by reference in its entirety. Exemplary DNA binding proteins having nuclease activity function to nick or cut double stranded DNA. Such nuclease activity may result from the DNA binding protein having one or more polypeptide sequences exhibiting nuclease activity. Such exemplary DNA binding proteins may have two separate nuclease domains with each domain responsible for cutting or nicking a 10 particular strand of the double stranded DNA. Exemplary polypeptide sequences having nuclease activity known to those of skill in the art include the McrA-HNH nuclease related domain and the RuvC-like nuclease domain. Accordingly, exemplary DNA binding proteins are those that in nature contain one or more of the McrA-HNH nuclease related domain and the RuvC-like nuclease domain. 15 An exemplary DNA binding protein is an RNA guided DNA binding protein of a Type II CRISPR System. An exemplary DNA binding protein is a Cas9 protein. In S. pyogenes, Cas9 generates a blunt-ended double-stranded break 3bp upstream of the protospacer-adjacent motif (PAM) via a process mediated by two catalytic domains in the protein: an HNH domain that cleaves the complementary strand of the DNA and a RuvC-like domain that 20 cleaves the non-complementary strand. See Jinkc et al., Science 337, 816-821 (2012) hereby incorporated by reference in its entirety. Cas9 proteins are known to exist in many Type II CRISPR systems including the following as identified in the supplementary information to Makarova et al., Nature Reviews, Microbiology, Vol. 9, June 2011, pp. 467-477: Methanococcus maripaludis C7; Corynebacterium diphtheriae; Corynebacterium efficiens YS-314; 25 Corynebacterium glutamicum ATCC 13032 Kitasato; Corynebacterium glutamicum ATCC 13032 Bielefeld; Corynebacterium glutamicum R; Corynebacterium kroppenstedtii DSM 44385; Mycobacterium abscessus ATCC 19977; Nocardia farcinica IFM10152; Rhodococcus erythropolis PR4; Rhodococcus jostii RHA1; Rhodococcus opacus B4 uid36573; Acidothermus cellulolyticus 11B; Arthrobacter chlorophenolicus A6; Kribbella flavida DSM 17836 uid43465; 30 Thermomonospora curvata DSM 43183; Bifidobacterium dentium Bdl; Bifidobacterium longum DJO10A; Slackia heliotrinireducens DSM 20476; Persephonella marina EX Hl; Bacteroides fragilis NCTC 9434; Capnocytophaga ochracea DSM 7271; Flavobacterium psychrophilum JIP02 86; Akkermansia muciniphila ATCC BAA 835; Roseiflexus castenholzii DSM 13941; Roseiflexus RSI; Synechocystis PCC6803; Elusimicrobium minutum Peil91; uncultured Termite group 1 35 bacterium phylotype Rs D17; Fibrobacter succinogenes S85; Bacillus cereus ATCC 10987; 2023248167 13 Oct 2023 Listeria innocua;Lactobacillus casei; Lactobacillus rhamnosus GG; Lactobacillus salivarius UCC118; Streptococcus agalactiae A909; Streptococcus agalactiae NEM316; Streptococcus agalactiae 2603; Streptococcus dysgalactiae equisimilis GGS 124; Streptococcus equi zooepidemicus MGCS10565; Streptococcus gallolyticus UCN34 uid46061; Streptococcus gordonii 5 Challis subst CHI; Streptococcus mutans NN2025 uid46353; Streptococcus mutans; Streptococcus pyogenes Ml GAS; Streptococcus pyogenes MGAS5005; Streptococcus pyogenes MGAS2096; Streptococcus pyogenes MGAS9429; Streptococcus pyogenes MGAS10270; Streptococcus pyogenes MGAS6180; Streptococcus pyogenes MGAS315; Streptococcus pyogenes SSI-1; Streptococcus pyogenes MGAS 10750; Streptococcus pyogenes NZ131; Streptococcus 10 thermophiles CNRZ1066; Streptococcus thermophiles LMD-9; Streptococcus thermophiles LMG 18311; Clostridium botulinum A3 Loch Maree; Clostridium botulinum B Eklund 17B; Clostridium botulinum Ba4 657; Clostridium botulinum F Langeland; Clostridium cellulolyticum H10; Finegoldia magna ATCC 29328; Eubacterium rectale ATCC 33656; Mycoplasma gallisepticum; Mycoplasma mobile 163K; Mycoplasma penetrans; Mycoplasma synoviae 53; Streptobacillus 15 moniliformis DSM 12112; Bradyrhizobium BTAil; Nitrobacter hamburgensis X14; Rhodopseudomonas palustris BisB18; Rhodopseudomonas palustris BisB5; Parvibaculum lavamentivorans DS-1; Dinoroseobacter shibae DFL 12; Gluconacetobacter diazotrophicus Pal 5 FAPERJ; Gluconacetobacter diazotrophicus Pal 5 JGI; Azospirillum B510 uid46085; Rhodospirillum rubrum ATCC 11170; Diaphorobacter TPSY uid29975; Verminephrobacter 20 eiseniae EF01-2; Neisseria meningitides 053442; Neisseria meningitides alphal4; Neisseria meningitides Z2491; Desulfovibrio salexigens DSM 2638; Campylobacter jejuni doylei 269 97; Campylobacter jejuni 81116; Campylobacter jejuni; Campylobacter lari RM2100; Helicobacter hepaticus; Wolinella succinogenes; Tolumonas auensis DSM 9187; Pseudoalteromonas atlantica T6c; Shewanella pealeana ATCC 700345; Legionella pneumophila Paris; Actinobacillus 25 succinogenes BOZ; Pasteurella multocida; Francisella tularensis novicida UI 12; Francisella tularensis holarctica; Francisella tularensis FSC 198; Francisella tularensis tularensis; Francisella tularensis WY96-3418; and Treponema denticola ATCC 35405. Accordingly, aspects of the present disclosure are directed to a Cas9 protein present in a Type II CRISPR system. The Cas9 protein may be referred by one of skill in the art in the literature as Csnl. The S. 30 pyogenes Cas9 protein is shown below. See Deltcheva et al., Nature 471, 602-607 (2011) hereby incorporated by reference in its entirety. MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE 35 ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFG NIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSD 2023248167 13 Oct 2023 VDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGN LIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELH 5 AILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEE WDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFL SGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWG RLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSL 10 HEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDH IVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKS KLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVR 15 K MIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLJARKKDWDPKKYGGFDSPTVA YSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVE 20 QHKHYLDEnEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGA PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD- According to one aspect, the RNA guided DNA binding protein includes homologs and orthologs of Cas9 which retain the ability of the protein to bind to the DNA, be guided by the RN A 25 and cut the DNA. According to one aspect, the Cas9 protein includes the sequence as set forth for naturally occurring Cas9 from S. pyogenes and protein sequences having at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% homology thereto and being a DNA binding protein, such as an RNA guided DNA binding protein. According to one aspect, an engineered Cas9-gRNA system is provided which enables 30 RNA-guided genome cutting in a site specific manner in a stem cell, if desired, and modification of the stem cell genome by insertion of exogenous donor nucleic acids. The guide RNAs are complementary to target sites or target loci on the DNA. The guide RNAs can be crRNA-tracrRNA chimeras. The guide RNAs can be introduced from media surrounding the cell. In this manner a method of continuously modifying a cell is provided to the extent that various guide 35 RNAs are provided to surrounding media and with the uptake by the cell of the guide RNAs and with supplementation of the media with additional guide RNAs. Supplementation may be in a 2023248167 13 Oct 2023 continuous manner. The Cas9 binds at or near target genomic DNA. The one or more guide RNAs bind at or near target genomic DNA. The Cas9 cuts the target genomic DNA and exogenous donor DNA is inserted into the DNA at the cut site. Accordingly, methods are directed to the use of a guide RNA with a Cas9 protein and an 5 exogenous donor nucleic acid to multiplex insertions of exogenous donor nucleic acids into DNA within a stem cell expressing Cas9 by cycling the insertion of nucleic acid encoding the RNA (or providing RNA from the surrounding media) and exogenous donor nucleic acid, expressing the RNA (or uptaking the RNA), colocalizing the RNA, Cas9 and DNA in a manner to cut the DNA, and insertion of the exogenous donor nucleic acid. The method steps can be cycled in any desired 10 number to result in any desired number of DNA modifications. Methods of the present disclosure are accordingly directed to editing target genes using the Cas9 proteins and guide RNAs described herein to provide multiplex genetic and epigenetic engineering of stem cells. Further aspects of the present disclosure are directed to the use of DNA binding proteins or systems (such as the modified TALENS or Cas9 described herein) in general for the multiplex 15 insertion of exogenous donor nucleic acids into the DNA, such as genomic DNA, of a stem cell, such as a human stem cell. One of skill in the art will readily identify exemplary DNA binding systems based on the present disclosure. Cells according to the present disclosure unless otherwise specified include any cell into which foreign nucleic acids can be introduced and expressed as described herein. It is to be 20 understood that the basic concepts of the present disclosure described herein are not limited by cell type. Cells according to the present disclosure include somatic cells, stem cells, eukaryotic cells, prokaryotic cells, animal cells, plant cells, fungal cells, archael cells, eubacterial cells and the like. Cells include eukaryotic cells such as yeast cells, plant cells, and animal cells. Particular cells include mammalian cells, such as human cells. Further, cells include any in which it would be 25 beneficial or desirable to modify DNA. Target nucleic acids include any nucleic acid sequence to which a TALEN or RNA guided DNA binding protein having nuclease activity as described herein can be useful to nick or cut. Target nucleic acids include any nucleic acid sequence to which a co-localization complex as described herein can be useful to nick or cut. Target nucleic acids include genes. For purposes of 30 the present disclosure, DNA, such as double stranded DNA, can include the target nucleic acid and a co-localization complex can bind to or otherwise co-localize with the DNA or a TALEN can otherwise bind with the DNA at or adjacent or near the target nucleic acid and in a manner in which the co-localization complex or the TALEN may have a desired effect on the target nucleic acid. Such target nucleic acids can include endogenous (or naturally occurring) nucleic acids and 35 exogenous (or foreign) nucleic acids. One of skill based on the present disclosure will readily be able to identify or design guide RNAs and Cas9 proteins which co-localize to a DNA or a TALEN 2023248167 13 Oct 2023 which binds to a DNA, including a target nucleic acid. One of skill will further be able to identify transcriptional regulator proteins or domains, such as transcriptional activators or transcriptional repressors, which likewise co-localize to a DNA including a target nucleic acid. DNA includes genomic DNA, mitochondrial DNA, viral DNA or exogenous DNA. According to one aspect, 5 materials and methods useful in the practice of the present disclosure include those described in Di Carlo, et al., Nucleic Acids Research, 2013, vol. 41, No. 7 4336-4343 hereby incorporated by reference in its entirety for all purposes including exemplary strains and media, plasmid construction, transformation of plasmids, electroporation of transcient gRNA cassette and donor nucleic acids, transformation of gRNA plasmid with donor DNA into Cas9-expressing cells, 10 galactose induction of Cas9, identification of CRISPR-Cas targets in yeast genome, etc. Additional references including information, materials and methods useful to one of skill in carrying out the invention are provided in Mali,P., Yang,L., Esvelt,K.M., Aach,J., Guell,M., DiCarlo,J.E., Norville,J.E. and Church,G.M. (2013) RNA-Guided human genome engineering via Cas9. Science, 10.1126fscience. 1232033; Storici,F., Durham,C.L., Gordenin,D.A. and 15 Resnick,M.A. (2003) Chromosomal site-specific double-strand breaks are efficiently targeted for repair by oligonucleotides in yeast. PNAS, 100, 14994-14999 and Jinek,M., Chylinski,K., Fonfara,!., Hauer,M., DoudnaJ.A. and Charpentier,E. (2012) A programmable dual-RNA-Guided DNA endonuclease in adaptive bacterial immunity. Science, 337, 816-821 each of which are hereby incorporated by reference in their entireties for all purposes. 20 Foreign nucleic acids (i.e. those which are not part of a cell’s natural nucleic acid composition) may be introduced into a cell using any method known to those skilled in the art for such introduction. Such methods include transfection, transduction, viral transduction, microinjection, lipofection, nucleofection, nanoparticle bombardment, transformation, conjugation and the like. One of skill in the art will readily understand and adapt such methods using readily 25 identifiable literature sources. Donor nucleic acids include any nucleic acid to be inserted into a nucleic acid sequence as described herein. The following examples are set forth as being representative of the present disclosure. These examples are not to be construed as limiting the scope of the present disclosure as these and 30 other equivalent embodiments will be apparent in view' of the present disclosure, figures and accompanying claims. 2023248167 13 Oct 2023 EXAMPLE I Guide RNA Assembly 19bp of the selected target sequence (i.e. 5’-N19 of 5’-N19-NGG-3’) were incorporated into two complementary lOOmer oligonucleotides 5 (TTCTTGGCTTTATATATCTTGTGGAAAGGACG AAACACCGN19GTTTTAGAGCT AGAA ATAGCAAGTTAAAATAAGGCTAGTCC). Each lOOmer oligonucleotide was suspended at lOOmM in water, mixed with equal volume and annealed in thermocycle machine (95°C, 5min; Ramp to 4°C, 0.1°C / sec). To prepare the destination vector, the gRNA cloning vector (Addgene plasmid ID 41824) was linearized using AfUI and the vector was purified. The (lOul) gRNA 10 assembly reaction was earned out with lOng annealed lOObp fragment, lOOng destination backbone, IX Gibson assembly reaction mix (New England Biolabs) at 50°C for 30min. The reaction can be processed directly for bacterial transformation to colonize individual assemblies. EXAMPLE II 15 Re-Coded TALEs Design and Assembly re-TALEs were optimized at different levels to facilitate assembly, and improve expression. re-TALE DNA sequences were first co-optimized for a human codon-usage, and low mRNA folding energy at the 5’ end (GeneGA, Bioconductor). The obtained sequence was evolved through several cycles to eliminate repeats (direct or inverted) longer than 11 bp (See Fig. 12). In each 20 cycle, synonymous sequences for each repeat are evaluated. Those with the largest hamming distance to the evolving DNA are selected. The sequence of one of re-TALE possessing 16.5 monomers as follows CTAACCCCTGAACAGGTAGTCGCTATAGCTTCAAATATCGGGGGCAAGCAAGCACTTG AGACCGTTCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCGGAGCA 25 AGTCGTCGCGATCGCGAGCAACGGCGGGGGGAAGCAGGCGCTGGAAACTGTTCAGAG ACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAGGTTGTCGCAATA GCAAGTAATATAGGCGGTAAGCAAGCCCTAGAGACTGTGCAACGCCTGCTCCCCGTGC TGTGTCAGGCTCACGGTCTGACACCTGAACAAGTTGTCGCGATAGCCAGTCACGACGG GGGAAAACAAGCTCTAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAAGCACAT 30 GGGTTAACACCCGAACAAGTAGTAGCGATAGCGTCAAATAACGGGGGTAAACAGGCT TTGGAGACGGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTACGCCAG AACAGGTGGTTGCAATTGCCTCCAACATCGGCGGGAAACAAGCGTTGGAAACTGTGC AGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAGGTTGTGGC CATCGCTAGCCACGACGGAGGGAAGCAGGCTCTTGAAACCGTACAGCGACTTCTCCCA 2023248167 13 Oct 2023 GTTTTGTGCCAAGCTCACGGGCTAACCCCCGAGCAAGTAGTTGCCATAGCAAGCAACG GAGGAGGAAAACAGGCATTAGAAACAGTTCAGCGCTTGCTCCCGGTACTCTGTCAGG CACACGGTCTAACTCCGGAACAGGTCGTAGCCATTGCTTCCCATGATGGCGGCAAACA GGCGCTAGAGACAGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGCCTCACC 5 CCGGAGCAGGTCGTTGCCATCGCCAGTAATATCGGCGGAAAGCAAGCTCTCGAAACA GTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCAGGTAG TGGCAATCGCATCTCACGATGGAGGTAAACAAGCACTCGAGACTGTCCAAAGATTGTT ACCCGTACTATGCCAAGCGCATGGTTTAACCCCAGAGCAAGTTGTGGCTATTGCATCT AACGGCGGTGGCAAACAAGCCTTGGAGACAGTGCAACGATTACTGCCTGTCTTATGTC 10 AGGCCCATGGCCTTACTCCTGAGCAAGTCGTAGCTATCGCCAGCAACATAGGTGGGAA ACAGGCCCTGGAAACCGTACAACGTCTCCTCCCAGTACTTTGTCAAGCACACGGGTTG ACACCGGAACAAGTGGTGGCGATTGCGTCCAACGGCGGAGGCAAGCAGGCACTGGAG ACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAGAGCAGG TGGTAGCAATAGCGTCGAACATCGGTGGTAAGCAAGCGCTTGAAACGGTCCAGCGTCT 15 TCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACCAGAACAAGTGGTTGCTATTGCT AGTAACAACGGTGGAAAGCAGGCCCTCGAGACGGTGCAGAGGTTACTTCCCGTCCTCT GTCAAGCGCACGGCCTCACTCCAGAGCAAGTGGTTGCGATCGCTTCAAACAATGGTGG AAGACCTGCCCTGGAA 20 According to certain aspects, TALEs may be used having at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 98% sequence identity, or at least 99% sequence identity to the above sequence. One of skill will readily understand where the above sequence may vary while still maintaining the DNA binding activity of the TALE. 25 re-TALE dimer blocks encoding two RVDs (see Fig. 6A) were generated by two rounds of PCR under standard Kapa HIFI (KPAP) PCR conditions, in which the first round of PCR introduced the RVD coding sequence and the second round of PCR generated the entire dimer blocks with 36bp overlaps with the adjacent blocks. PCR products were purified using QIAquick 96 PCR Purification Kit (QIAGEN) and the concentrations were measured by Nano-drop. The 30 primer and template sequences are listed in Table 1 and Table 2 below. Table 1. re-TALE blocks sequences CGCAATGCGCTCACGGGAGCACCCCTCAACCTAACCCCTGAACAGGTA GTCGCTATAGCTTCANNNNNNGGGGGCAAGCAAGCACTTGAGACCGT blockO TCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCGGA GCAAGTCGTCGCGATCGCGAGCNNNNNNGGGGGGAAGCAGGCGCTGG 2023248167 13 Oct 2023 AAACTGTTCAGAGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTC block 1 AGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAG GTTGTCGCAATAGCAAGTNNNNNNGGCGGTAAGCAAGCCCTAGAGAC TGTGCAACGCCTGCTCCCCGTGCTGTGTCAGGCTCACGGTCTGACACC TGAACAAGTTGTCGCGATAGCCAGTNNNNNNGGGGGAAAACAAGCTC TAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAAGCACATGGGT TA block 1' TGCGCTCACGGGAGCACCCCTCAACCTCACCCCCGAACAGGTTGTCGC AATAGCAAGTNNNNNNGGCGGTAAGCAAGCCCTAGAGACTGTGCAAC GCCTGCTCCCCGTGCTGTGTCAGGCTCACGGTCTGACACCTGAACAAG TTGTCGCGATAGCCAGTNNNNNNGGGGGAAAACAAGCTCTAGAAACG GTTCAAAGGTTGTTGCCCGTTCTGTGCCAAGCACATGGGTTA block2 AGGTTGTTGCCCGTTCTGTGCCAAGCACATGGGTTAACACCCGAACAA GTAGTAGCGATAGCGTCANNNNNNGGGGGTAAACAGGCTTTGGAGAC GGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTACGCC AGAACAGGTGGTTGCAATTGCCTCCNNNNNNGGCGGGAAACAAGCGT TGGAAACTGTGCAGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTT GACGCCT block3 AGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAG GTTGTGGCCATCGCTAGCNNNNNNGGAGGGAAGCAGGCTCTTGAAAC CGTACAGCGACTTCTCCCAGTTTTGTGCCAAGCTCACGGGCTAACCCC CGAGCAAGTAGTTGCCATAGCAAGCNNNNNNGGAGGAAAACAGGCAT TAGAAACAGTTCAGCGCTTGCTCCCGGTACTCTGTCAGGCACACGGTC TA block4 CGCTTGCTCCCGGTACTCTGTCAGGCACACGGTCTAACTCCGGAACAG GTCGTAGCCATTGCTTCCNNNNNNGGCGGCAAACAGGCGCTAGAGAC CGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGCCTCACCCC GGAGCAGGTCGTTGCCATCGCCAGTNNNNNNGGCGGAAAGCAAGCTC TCGAAACAGTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGAC TG block5 CGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCAG GTAGTGGCAATCGCATCTNNNNNNGGAGGTAAACAAGCACTCGAGAC TGTCCAAAGATTGTTACCCGTACTATGCCAAGCGCATGGTTTAACCCC 2023248167 13 Oct 2023 AGAGCAAGTTGTGGCTATTGCATCTNNNNNNGGTGGCAAACAAGCCTT GGAGACCGTGCAACGATTACTGCCTGTCTTATGTCAGGCCCATGGCCT T block6 CGATTACTGCCTGTCTTATGTCAGGCCCATGGCCTTACTCCTGAGCAGG TGGTCGCTATCGCCAGCNNNNNNGGGGGCAAGCAAGCACTGGAAACA GTCCAGCGTTTGCTTCCAGTACTTTGTCAGGCGCATGGATTGACACCG GAACAAGTGGTGGCTATAGCCTCANNNNNNGGAGGAAAGCAGGCGCT GGAAACCGTCCAACGTCTTTTACCGGTGCTTTGCCAGGCGCACGGGCT C block6' CGATTACTGCCTGTCTTATGTCAGGCCCATGGCCTTACTCCTGAGCAAG TCGTAGCTATCGCCAGCNNNNNNGGTGGGAAACAGGCCCTGGAAACC GTACAACGTCTCCTCCCAGTACTTTGTCAAGCACACGGGTTGACACCG GAACAAGTGGTGGCGATTGCGTCCNNNNNNGGAGGCAAGCAGGCACT GGAGACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCT C block? CGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAGAGCAG GTGGTAGCAATAGCGTCGNNNNNNGGTGGTAAGCAAGCGCTTGAAAC GGTCCAGCGTCTTCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACC AGAACAAGTGGTTGCTATTGCTAGTNNNNNNGGTGGAAAGCAGGCCC TCGAGACGGTGCAGAGGTTACTTCCCGTCCTCTGTCAAGCGCACGGCC TC Table 2. re-TALE blocks primer sequences blockO-F CGCAATGCGCTCACGGGAGCACCCCTCAACctAACCCCTGAACAGGT* A*G blockO-R GAGACCATGCGCCTGACAAAGTACAGGCAGCAGTCTCTGAACAG*T* T blockl'-F TGGCGCAATGCGCTCACGGGAGCACCCCTCA*A*C block 1-F AGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACA* G*G block 1- R / blockl'- R TAACCCATGTGCTTGGCACAGAACGGGCAACAACCTTTGAACCG*T*T block2-F AGGTTGTTGCCCGTTCTGTGCCAAGCACATGGGTTAACACCCgaac*a*a 2023248167 13 Oct 2023 blcok2-R AGGCGTCAAGCCGTGGGCTTGACACAAAACAGGAAGGAGTCTCTGCA CAG*T*t block3-F AGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTG*A*G block3-R TAGACCGTGTGCCTGACAGAGTACCGGGAGCAAGCGCT*G*A block4-F CGCTTGCTCCCGGTACTCTGTCAGGCACACGGTCTAA*C*T block4-R CAGTCCATGAGCTTGACATAGGACTGGCAACAGCCGTT*G*T block5-F CGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGA*C*G block5-R AAGGCCATGGGCCTGACATAAGACAGGCAGTAATCGTT*G*C block6-F CGATTACTGCCTGTCTTATGTCAGGCCCATGGCCTTA*C*T block6-R GAGCCCGTGCGCCTGGCAAAGCACCGGTAAAAGACGTTGGA*C*G block6'-F CGATTACTGCCTGTCTTATGTCAGGCCCATGGCCTTACTCCTGAGCAA *G*T block6'-R GAGCCCATGAGCCTGGCAAAGAACCGGAAGAAGCCGTT*G*G block7-F CGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAGAGCAG g*t*g blcok7-R GAGGCCGTGCGCTTGACAGAGGACGGGAAGTAACCTCT*G*C re-TALENs and re-TALE-TF destination vectors were constructed by modifying the TALE-TF and TALEN cloning backbones (see reference 24 hereby incorporated by reference in its entirety). The 0.5 RVD regions on the vectors were re-coded and SapI cutting site was incorporated 5 at the designated re-TALE cloning site. The sequences of re-TALENs and re-TALE-TF backbones are provided in Fig. 20. Plasmids can be pre-treated with SapI (New England Biolabs) with manufacturer recommended conditions and purified with QIAquick PCR purification kit (QIAGEN). A (lOul) one-pot TASA assembly reaction was carried out with 200ng of each block, 10 500ng destination backbone, IX TASA enzyme mixture (2U SapI, 100U Ampligase (Epicentre), lOmU T5 exonuclease (Epicentre), 2.5U Phusion DNA polymerase (New England Biolabs)) and IX isothermal assembly reaction buffer as described before (see reference 25 hereby incorporated by reference in its entirety) (5% PEG-8000, 100 mM Tris-HCl pH 7.5, 10 inM MgC12, 10 mM DTT, 0.2 mM each of the four dNTPs and 1 mM NAD). Incubations were performed at 37°C for 15 5min and 50 °C for 30 min. TASA assembly reaction can be processed directly for bacterial transformation to colonize individual assemblies. The efficiency of obtaining full length construct is ~20% with this approach. Alternatively, >90% efficiency can be achieved by a three-step assembly. First, lOul re-TALE assembly reactions are performed with 200ng of each block, IX reTALE enzyme mixture (100U Ampligase, 12.5mU T5 exonuclease, 2.5U Phusion DNA 20 polymerase) and IX isothermal assembly buffer at 50°C for 30min, followed by standardized Kapa 2023248167 13 Oct 2023 HIFI PCR reaction, agarose gel electrophoresis, and QIAquick Gel extraction (Qiagen) to enrich the full length re-TALEs. 200ng re-TALE amplicons can then be mixed with 500ng Sap 1-pretreated destination backbone, IX re-TALE assembly mixture and IX isothermal assembly reaction buffer and incubated at 50 °C for 30 min. The re-TALE final assembly reaction can be processed 5 directly for bacterial transformation to colonize individual assemblies. One of skill in the art will readily be able to select endonucleases, exonucleases, polymerases and ligases from among those known to practice the methods described herein. For example, type Ils endonucleases can be used, such as: Fok 1, Bts I, Ear I, Sap I. Exonucleases which are titralable can be used, such as lamda exonuclease, T5 exonuclease and Exonuclease III. Non-hotstart polymerases can be used, such as 10 phusion DNA polymerase, Taq DNA polymerase and VentR DNA polymerase. Thermostable ligases can be used in this reaction, such as Amp ligase, pfu DNA ligase, Taq DNA ligase. In addition, different reaction conditions can be used to activate such endonucleases, exonucleases, polymerases and ligases depending on the particular species used. 15 EXAMPLE III Cell Line and Cell Culture PGP1 iPS cells were maintained on Matrigel (BD Biosciences)-coated plates in mTeSRl (Stemcell Technologies). Cultures were passaged every 5-7 days with TrypLE Express (Invitrogen). 293T and 293FT cells were grown and maintained in Dulbecco’s modified Eagle’s 20 medium (DMEM, Invitrogen) high glucose supplemented with 10% fetal bovine Serum (FBS, Invitrogen), penicillin / streptomycin (pen / strep, Invitrogen), and non-essential amino acids (NEAA, Invitrogen). K562 cells were grown and maintained in RPMI (Invitrogen) supplemented with 10% fetal bovine serum (FBS, Invitrogen 15%) and penicillin / streptomycin (pen / strep, Invitrogen). All cells were maintained at 37°C and 5% CO2 in a humidified incubator. 25 A stable 293T cell line for detecting HDR efficiency was established as described in reference 26 hereby incorporated by reference in its entirety. Specifically, the reporter cell lines bear genomically integrated GFP coding sequences disrupted by the insertion of a stop codon and a 68bp genomic fragment derived from the AAV SI locus. 30 EXAMPLE IV Test of re-TALENs Activity 293T reporter cells were seeded at densities of 2 x 105 cells per well in 24-well plate and transfected them with Ipg of each re-TALENs plasmid and 2 pg DNA donor plasmid using Lipofectamine 2000 following the manufacturer’s protocols. Cells were harvested using TrypLE 35 Express (Invitrogen) ~18 h after transfection and resuspended in 200 pl of media for flow cytometry analysis using an LSRFortessa cell analyzer (BD Biosciences). The flow cytometry data 2023248167 13 Oct 2023 were analyzed using FlowJo (FlowJo). At least 25,000 events were analyzed for each transfection sample. For endogenous AAVS1 locus targeting experiment in 293T, the transfection procedures were identical as described above and puromycin selection was conducted with drag concentration at 3pg / ml 1 week after transfection. 5 EXAMPLE V Functional Lentiviras Generation Assessment The lentiviral vectors were created by standard PCR and cloning techniques. The lentiviral plasmids were transfected by Lipofectamine 2000 with Lentiviral Packaging Mix (Invitrogen) into 10 cultured 293FT cells (Invitrogen) to produce lentiviras. Supernatant was collected 48 and 72h posttransfection, sterile filtered, and lOOul filtered supernatant was added to 5 * 105 fresh 293T cells with polybrene. Lentiviras titration was calculated based on the following formula: virus titration = (percentage of GFP+ 293T cell * initial cell numbers under transduction) / (the volume of original virus collecting supernatant used in the transduction experiment). To test the functionality of 15 lentiviras, 3 days after transduction, lentiviras transduced 293T cells were transfected with 30 ng plasmids carrying mCherry reporter and 500ng pUC19 plasmids using Lipofectamine 2000 (Invitrogen). Cell images were analyzed using Axio Observer Z.l (Zeiss) 18 hours after transfection and harvested using TrypLE Express (Invitrogen) and resuspended in 200 pl of media for flow cytometry analysis using a LSRFortessa cell analyzer (BD Biosciences). The flow 20 cytometry data were analyzed using BD FACSDiva (BD Biosciences). EXAMPLE VI Test of re-TALENs and Cas9-gRNA genome editing efficiency PGP1 iPSCs were cultured in Rho kinase (ROCK) inhibitor Y-27632 (Calbiochem) 2h 25 before nucleofection. Transfections were done using P3 Primary Cell 4D-Nucleofector X Kit (Lonza). Specifically, cells were harvested using TiypLE Express (Invitrogen) and 2x106 cells were resuspended in 20 pl nucleofection mixture containing 16.4 pl P3 Nucleofector solution, 3.6 pl supplement, Ipg of each re-TALENs plasmid or lug Cas9 and lug gRNA construct, 2pl of 100 pM ssODN. Subsequently, the mixtures were transferred to 20pl Nucleocuvette strips and 30 nucleofection was conducted using CB150 program. Cells were plated on Matrigel-coated plates in mTeSRl medium supplemented with ROCK inhibitor for the first 24 hrs. For endogenous AAVS1 locus targeting experiment with dsDNA donor, the same procedure was followed except 2 pg dsDNA donor was used and the mTeSRl media was supplemented with puromycin at the concentration of 0.5ug / mL 1 week after transfection. 35 The information of reT ALENs, gRNA and ssODNs used in this example are listed in Table 3 and Table 4 below. 2023248167 13 Oct 2023 Table 3. Information of re-TALEN pairs / Cas9-gRNA targeting CCR5 # targe ting site re- TAL ENs re- TAL ENs re-TALEN-L targeting sequence re-TALEN-R targeting sequence gRNA targeting sequence gRA N target ing seque nee start positi on pair target ing site (start) pair / chr3: target ing site (end) / chr3: 1 4640 9942 4640 9993 TCCCCACTTTCT TGTGAA TAACCACTCAG GACAGGG CACTTTCTTGTG AATCCTT 4640 9946 2 4641 0227 4641 0278 TCACACAGCAA GTCAGCA TAGCGGAGCAG GCTCGGA TGGGCTAGCGG AGCAGGCT 4641 0264 3 4641 1260 4641 1311 TACCCAGACGA GAAAGCT TCAGACTGCCA AGCTTGA ACCCAGACGAG AAAGCTGA 4641 1261 4 4641 1464 4641 1515 TCTTGTGGCTC GGGAGTA TATTGTCAGCA GAGCTGA AGAGGGCATCTT GTGGCTC 4641 1456 5 4641 1517 4641 1568 TTGAGATTTTC AGATGTC TATACAGTCAT ATCAAGC ATCAAGCTCTCT TGGCGGT 4641 1538 6 4641 1634 4641 1685 TTCAGATAGAT TATATCT TGCCAGATACA TAGGTGG GCTTCAGATAGA TTATATC 4641 1632 7 4641 2396 4641 2447 TTATACTGTCT ATATGAT TCAGCTCTTCT GGCCAGA ACGGATGTCTCA GCTCTTC 4641 2437 8 4641 2432 4641 2483 TGGCCAGAAGA GCTGAGA TTACCGGGGAG AGTTTCT CCGGGGAGAGT TTCTTGTA 4641 2461 2023248167 13 Oct 2023 9 4641 2750 4641 2801 TTTGCAGAGAG ATGAGTC TTAGCAGAAGA TAAGATT GAAATCTTATCT TCTGCTA 4641 2782 10 4641 3152 4641 3203 TATAAGACTAA ACTACCC TCGTCTGCCAC CACAGAT AATGCATGACAT TCATCTG 4641 3172 11 4641 4305 4641 4356 TAAAACAGTTT GCATTCA TATAAAGTCCT AGAATGT AACAGTTTGCAT TCATGGA 4641 4308 12 4641 4608 4641 4659 TGGCCATCTCT GACCTGT TAGTGAGCCCA GAAGGGG CCAGAAGGGGA CAGTAAGA 4641 4632 13 4641 4768 4641 4820 TAGGTACCTGG CTGTCGT TGACCGTCCTG GCTTTTA CTGACAATCGAT AGGTACC 4641 4757 14 4641 5017 4641 5068 TGTCATGGTCA TCTGCTA TCGACACCGAA GCAGAGT ACACCGAAGCA GAGTTTTT 4641 5046 15 4642 0034 4642 0084 TGCCCCCGCGA GGCCACA TCTGGAAGTTG AACACCC GGAAGTTGAAC ACCCTTGC 4642 0062 Table 4. ssODN design for studying ssODN-mediated genome editing Fi gu re 3b Dist ance bet wee n the seco ndar y mut atio n and DS B 90- *1 CTACTGTCATTCAGGGCAATACCCAGACGAGAAAGCTGAGGGTAT AACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT 90- *2 CTACTGTCATTCAGCCCAATACCCTAACGAGAAAGCTGAGGGTATA ACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT 90- *3 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAAGTGAGGGTATA ACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT 90M- 0 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAGCTGAGGGTATA ACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT 90- *4 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAGCTGAGGGTATA ACAGGTTTGTAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT 90- *5 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAGCTGAGGGTATA ACAGGTTTCAAGCTTGGCTCTCTGACTACAGAGGCCACTGGCTT 2023248167 13 Oct 2023 90- *6 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAGCTGAGGGTATA ACAGGTTTCAAGCTTGGCAGTCTGACTAGTGAGGCCACTGGCTT Fi gu re 3c dist ance bet wee n ssO DN and the DS B L670 bp_9 OM CACTTTATATTTCCCTGCTTAAACAGTCCCCCGAGGGTGGGTGCGG AAAAGGCTCTACACTTGTTATCATTCCCTCTCCACCACAGGCAT L570 bp_9 OM TTTGTATTTGGGTTTTTTTAAAACCTCCACTCTACAGTTAAGAATTC TAAGGCACAGAGCTTCAATAATTTGGTCAGAGCCAAGTAGCAG L480 bp_9 OM GGAGGTTAAACCCAGCAGCATGACTGCAGTTCTTAATCAATGCCCC TTGAATTGCACATATGGGATGAACTAGAACATTTTCTCGATGAT L394 bp_9 OM CTCGATGATTCGCTGTCCTTGTTATGATTATGTTACTGAGCTCTACT GTAGCACAGACATATGTCCCTATATGGGGCGGGGGTGGGGGTG L290 bp_9 OM GGTGTCTTGATCGCTGGGCTATTTCTATACTGTTCTGGCTTTTCGGA AGCAGTCATTTCTTTCTATTCTCCAAGCACCAGCAATTAGCTT L200 bp_9 OM GCTTCTAGTTTGCTGAAACTAATCTGCTATAGACAGAGACTCCGAC GAACCAATTTTATTAGGATTTGATCAAATAAACTCTCTCTGACA L114 bp_9 OM GAAAGAGTAACTAAGAGTTTGATGTTTACTGAGTGCATAGTATGCA CTAGATGCTGGCCGTGGATGCCTCATAGAATCCTCCCAACAACT L45b p_90 M GCTAGATGCTGGCCGTGGATGCCTCATAGAATCCTCCCAACAACCG ATGAAATGACTACTGTCATTCAGCCCAATACCCAGACGAGAAAG R40b p_90 M ACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTTTA CCCCTGGGTTAGTCTGCCTCTGTAGGATTGGGGGCACGTAATTT R100 bp_9 OM TTAGTCTGCCTCTGTAGGATTGGGGGCACGTAATTTTGCTGTTTAAG GTCTCATTTGCCTTCTTAGAGATCACAAGCCAAAGCTTTTTAT R200 bp_9 OM GGAAGCCCAGAGGGCATCTTGTGGCTCGGGAGTAGCTCTCTGCTAC cttctcagctctgctgacaatacttgagattttcagatgtcacc 2023248167 13 Oct 2023 R261 bp_9 0M TCAGCTCTGCTGACAATACTTGAGATTTTCAGATGTCACCAACCAG CAAGAGAGCTTGATATGACTGTATATAGTATAGTCATAAAGAAC R322 bp_9 0M CATAAAGAACCTGAACTTGACCATATACTTATGTCATGTGGAAATC TTCTCATAGCTTCAGATAGATTATATCTGGAGTGAAGAATCCTG R375 M_9 0M GTGGAAAATTTCTCATAGCTTCAGATAGATTATATCTGGAGTGAGC AATCCTGCCACCTATGTATCTGGCATAGTGTGAGTCCTCATAAA R448 bp_9 0M GGTTTGAAGGGCAACAAAATAGTGAACAGAGTGAAAATCCCCACC TAGATCCTGGGTCCAGAAAAAGATGGGAAACCTGTTTAGCTCACC Com plem ent-30me r GGCCACTAGGGACAAAATTGGTGAcagaaa Fi gu re 3d ssO DN leng th and orie ntati on for Cas 9-gR NA targ etin g Com plem ent-50me r CCCACAGTGGGGCCACTAGGGACAAAATTGGTGAcagaaaagccccatcc Com plem ent-70me r TCCCCTCCACCCCACAGTGGGGCCACTAGGGACAAAATTGGTGAcag aaaagccccatccttaggcctcc Com plem ent-90me r cttTTATCTGTCCCCTCCACCCCACAGTGGGGCCACTAGGGACAAAAT TGGTGAcagaaaagccccatccttaggcctcctccttcctag Com plem ent- gttctgggtacttTTATCTGTCCCCTCCACCCCACAGTGGGGCCACTAGGGA CAAAATTGGTGAcagaaaagccccatccttaggcctcctccttcctagtctcctgata 2023248167 13 Oct 2023 110m er Non comp leme nt- 30me r TTTCTGTCACCAATGGTGTCCCTAGTGGCC Non comp leme nt- 50me r GGATGGGGCTTTTCTGTCACCAATGGTGTCCCTAGTGGCCCCACTG TGGG Non comp leme nt- 70me r GGAGGCCTAAGGATGGGGCTTTTCTGTCACCAATGGTGTCCCTAGT GGCCCCACTGTGGGGTGGAGGGGA Non comp leme nt- 90me r CTAGGAAGGAGGAGGCCTAAGGATGGGGCTTTTCTGTCACCAATG GTGTCCCTAGTGGCCCCACTGTGGGGTGGAGGGGACAGATAAAAG Non comp leme nt- 110m er TATCAGGAGACTAGGAAGGAGGAGGCCTAAGGATGGGGCTTTTCT GTCACCAATGGTGTCCCTAGTGGCCCCACTGTGGGGTGGAGGGGAC AGATAAAAGTACCCAGAAC Fi gu re ssO DN don Cas9 gRN TTCTAGTAACCACTCAGGACAGGGGGGTTCAGCCCAAAAATTCACA AGAAAGTGGGGACCCATGGGAAAT 2023248167 13 Oct 2023 2c or for Cas 9-gR NA targ etin g CC R5 A- CCR 5-1 Cas9 gRN A- CCR 5-2 CAGCAAGTCAGCAGCACAGCGTGTGTGACTCCGAGGGTGCTCCGCT AGCCCACATTGCCCTCTGGGGGTG Cas9 gRN A- CCR 5-3 GTCAGACTGCCAAGCTTGAAACCTGTCTTACCCTCTACTTTCTCGTC TGGGTATTGGGCTGAATGACAGT Cas9 gRN A- CCR 5-4 CAGAGCTGAGAAGACAGCAGAGAGCTACTCCCGAAGCACAAGATG CCCTCTGGGCTTCCGTGACCTTGGC Cas9 gRN A- CCR 5-5 CTGACAATACTTGAGATTTTCAGATGTCACCAACGACCAAGAGAGC TTGATATGACTGTATATAGTATAG Cas9 gRN A- CCR 5-6 CAGATACATAGGTGGCAGGATTCTTCACTCCAGACTTAATCTATCT GAA GCTATGAGAAATTTTCC AC AT Cas9 TATATGATTGATTTGCACAGCTCATCTGGCCAGATAAGCTGAGACA TCCGTTCCCCTACAAGAAACTCTC 2023248167 13 Oct 2023 gRN A- CCR 5-7 Cas9 gRN A- CCR 5-8 ATCTGGCCAGAAGAGCTGAGACATCCGTTCCCCTTGAAGAAACTCT CCCCGGTAAGTAACCTCTCAGCTG Cas9 gRN A- CCR 5-9 AGGCATCTCACTGGAGAGGGTTTAGTTCTCCTTAAGAGAAGATAAG ATTTCAAGAGGGAAGCTAAGACTC Cas9 gRN A- CCR 5-10 ATAATATAATAAAAAATGTTTCGTCTGCCACCACTAATGAATGTCA TGCATTCTGGGTAGTTTAGTCTTA Cas9 gRN A- CCR 5-11 TTTATAAAGTCCTAGAATGTATTTAGTTGCCCTCGTTGAATGCAAAC TGTTTTATAC ATCAATAGGTTTT Cas9 gRN A- CCR 5-12 GCTCAACCTGGCCATCTCTGACCTGTTTTTCCTTCCCACTGTCCCCT TCTGGGCTCACTATGCTGCCGCC Cas9 TTTTAAAGCAAACACAGCATGGACGACAGCCAGGCTCCTATCGATT 2023248167 13 Oct 2023 gRN A-CCR 5-13 GTCAGGAGGATGATGAAGAAGATT Cas9 gRN A- CCR 5-14 GCTTGTCATGGTCATCTGCTACTCGGGAATCCTAATTACTCTGCTTC GGTGTCGAAATGAGAAGAAGAGG Cas9 gRN A- CCR 5-15 ATACTGCCCCCGCGAGGCCACATTGGCAAACCAGCTTGGGTGTTCA ACTTCCAGACTTGGCCATGGAGAA ssO DN don or for reT AL ENs targ etin g CC R5 reTA LEN-CCR 5-1 CTGAAGAATTTCCCATGGGTCCCCACTTTCTTGTGAATCCTTGGAGT GAACCCCCCTGTCCTGAGTGGTTACTAGAACACACCTCTGGAC reTA LEN-CCR 5-2 TGGAAGTATCTTGCCGAGGTCACACAGCAAGTCAGCAGCACAGCC AGTGTGACTCCGAGCCTGCTCCGCTAGCCCACATTGCCCTCTGGG reTA LEN-CCR 5-3 CTACTGTCATTCAGCCCAATACCCAGACGAGAAAGCTGAGGGTATA ACAGGTTTCAAGCTTGGCAGTCTGACTACAGAGGCCACTGGCTT reTA LEN-CCR 5-4 GGAAGCCCAGAGGGCATCTTGTGGCTCGGGAGTAGCTCTCTGCTAC CTTCTCAGCTCTGCTGACAATACTTGAGATTTTCAGATGTCACC reTA LEN- TCAGCTCTGCTGACAATACTTGAGATTTTCAGATGTCACCAACGCC CAAGAGAGCTTGATATGACTGTATATAGTATAGTCATAAAGAAC 2023248167 13 Oct 2023 CCR 5-5 reTA LEN- GTGGAAAATTTCTCATAGCTTCAGATAGATTATATCTGGAGTGAGC CCR AATCCTGCCACCTATGTATCTGGCATAGTGTGAGTCCTCATAAA 5-6 reTA LEN- GAAACAGCATTTCCTACTTTTATACTGTCTATATGATTGATTTGGTC CCR AGCTCATCTGGCCAGAAGAGCTGAGACATCCGTTCCCCTACAA 5-7 reTA LEN- TTGATTTGCACAGCTCATCTGGCCAGAAGAGCTGAGACATCCGTAT CCR CCCTACAAGAAACTCTCCCCGGTAAGTAACCTCTCAGCTGCTTG 5-8 reTA LEN- GGAGAGGGTTTAGTTCTCCTTAGCAGAAGATAAGATTTCAAGATGA CCR GAGCTAAGACTCATCTCTCTGCAAATCTTTCTTTTGAGAGGTAA 5-9 reTA LEN- TAATATAATAAAAAATGTTTCGTCTGCCACCACAGATGAATGTCGA CCR GCATTCTGGGTAGTTTAGTCTTATAACCAGCTGTCTTGCCTAGT 5-10 reTA LEN- TTAAAAACCTATTGATGTATAAAACAGTTTGCATTCATGGAGGGTG CCR ACTAAATACATTCTAGGACTTTATAAAAGATCACTTTTTATTTA 5-11 reTA LEN- GACATCTACCTGCTCAACCTGGCCATCTCTGACCTGTTTTTCCTATT CCR TACTGTCCCCTTCTGGGCTCACTATGCTGCCGCCCAGTGGGAC 5-12 reTA LEN- TCATCCTCCTGACAATCGATAGGTACCTGGCTGTCGTCCATGCTAC CCR GTTTGCTTTAAAAGCCAGGACGGTCACCTTTGGGGTGGTGACAA 5-13 2023248167 13 Oct 2023 reTA LEN- GGCTGGTCCTGCCGCTGCTTGTCATGGTCATCTGCTACTCGGGAGA CCR CCTAAAAACTCTGCTTCGGTGTCGAAATGAGAAGAAGAGGCACA 5-14 reTA LEN- GGCAAGCCTTGGGTCATACTGCCCCCGCGAGGCCACATTGGCAAGT CCR CAGCAAGGGTGTTCAACTTCCAGACTTGGCCATGGAGAAGACAT 5-15 EXAMPLE VII Amplicon Library Preparation of the Targeting Regions Cells were harvested 6 days after nucleofection and 0.1 pl prepGEM tissue protease 5 enzyme (ZyGEM) and 1 pl prepGEM gold buffer (ZyGEM) were added to 8.9 pl of the 2~5 X 105 cells in the medium. 1 ul of the reactions were then added to 9 pl of PCR mix containing 5ul 2X KAPA Hifl Hotstart Readymix (KAPA Biosystems) and lOOnM corresponding amplification primer pairs. Reactions were incubated at 95°C for 5 min followed by 15 cycles of 98°C, 20 s; 65°C, 20 s and 72°C, 20 s. To add the Illumina sequence adaptor used, 5 pl reaction products were 10 then added to 20 pl of PCR mix containing 12.5 pl 2X KAPA HIFI Hotstart Readymix (KAPA Biosystems) and 200 nM primers carrying Illumina sequence adaptors. Reactions were incubated at 95°C for 5min followed by 25 cycles of 98°C, 20s; 65°C, 20s and 72°C, 20s. PCR products were purified by QIAquick PCR purification kit, mixed at roughly the same concentration, and sequenced with MiSeq Personal Sequencer. The PCR primers are listed in Table 5 below. 15 Table 5. CCR5 targeting site PCR primer sequences # targeting in CCR5 name primer sequence 1 site 1 -F1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATTTT GCAGTGTGCGTTACTCC sitel-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGTTT GCAGTGTGCGTTACTCC sitel-F3 ACACTCTTTCCCTACACGACGCTCTTCCGATCTGCCTAATTT GCAGTGTGCGTTACTCC sitel-F4 ACACTCTTTCCCTACACGACGCTCTTCCGATCTTGGTCATTT GCAGTGTGCGTTACTCC site 1 -R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTCCAAGCAA 2023248167 13 Oct 2023 CTAAGTCACAGCA 2 Site2-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATATG AGGAAATGGAAGCTTG Site2-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGAT GAGGAAATGGAAGCTTG Site2-F3 ACACTCTTTCCCTACACGACGCTCTTCCGATCTGCCTAAAT GAGGAAATGGAAGCTTG Site2-F4 ACACTCTTTCCCTACACGACGCTCTTCCGATCTTGGTCAATG AGGAAATGGAAGCTTG Site2-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTCATTAGGG TATTGGAGGA 3 site3-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATAAT CCTCCCAACAACTCAT site3-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGAA TCCTCCCAACAACTCAT site3-F3 ACACTCTTTCCCTACACGACGCTCTTCCGATCTGCCTAAAA TCCTCCCAACAACTCAT site3-F4 ACACTCTTTCCCTACACGACGCTCTTCCGATCTTGGTCAAAT CCTCCCAACAACTCAT site3_R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTCCCAATCCT ACAGAGGCAG 4 site4-F 1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATAA GCCAAAGCTTTTTATTC site4-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGAA GCCAAAGCTTTTTATTC site4-F3 ACACTCTTTCCCTACACGACGCTCTTCCGATCTGCCTAAAA GCCAAAGCTTTTTATTC site4-F4 ACACTCTTTCCCTACACGACGCTCTTCCGATCTTGGTCAAA GCCAAAGCTTTTTATTC site4_R ACACTCTTTCCCTACACGACGCTCTTCCGATCTAAGCCAAA GCTTTTTATTCT 5 site5-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATATC TTGTGGCTCGGGAGTAG site5-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGATC TTGTGGCTCGGGAGTAG 2023248167 13 Oct 2023 site5-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTTGGCAGGA TTCTTCACTCCA 6 site6-F 1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATCTA TTTTGTTGCCCTTCAAA site6-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGCTA TTTTGTTGCCCTTCAAA site6-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAACCTGAA CTTGACCATATACT 7 site7-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATCA GCTGAGAGGTTACTTACC site7-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGCA GCTGAGAGGTTACTTACC site7-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAATGATTTA ACTCCACCCTC 8 site8-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATACT CCACCCTCCTTCAAAAGA site8-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGACT CCACCCTCCTTCAAAAGA site8-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTTGGTGTTTG CCAAATGTCT 9 site9_F 1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATGG GCACATATTCAGAAGGCA site9_F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGGG GCACATATTCAGAAGGCA site9_R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAGTGAAAG ACTTTAAAGGGAGCA 10 sitelO-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATCAC AATTAAG A GTTGTCATA sitelO-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGCA CAATTAAGAGTTGTCATA sitelO-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTCTCAGCTA GAGCAGCTGAAC 11 site 11-Fl CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTGACACTTG ATAATCCATC sitel 1-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGTCA 2023248167 13 Oct 2023 ATGTAGACATCTATGTAG sitel 1-R ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATTCA ATGTAGACATCTATGTAG 12 sitel2-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATACT GCAAAAGGCTGAAGAGC sitel2-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGACT GCAAAAGGCTGAAGAGC sitel2-F3 ACACTCTTTCCCTACACGACGCTCTTCCGATCTGCCTAAACT GCAAAAGGCTGAAGAGC sitel2-F4 ACACTCTTTCCCTACACGACGCTCTTCCGATCTTGGTCAACT GCAAAAGGCTGAAGAGC sitel 2-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTGCCTATAA AATAGAGCCCTGTCAA 13 site 13-Fl ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATCTC TATTTTATAGGCTTCTTC sitel3-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGCTC TATTTTATAGGCTTCTTC sitel 3-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAGCCACCA CCCAAGTGATC 14 site 14-F1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTACATCGTTC CAGACATTAAAGATAGTC sitel4-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATTTC CAGACATTAAAGATAGTC sitel 4-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAATCATGA TGGTGAAGATAAG 15 sitel 5-F1 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCGTGATCCG GCAGAGACAAACATTAAA sitel 5-F2 ACACTCTTTCCCTACACGACGCTCTTCCGATCTCCGGCAGA GACAAACATTAAA sitel 5-R CTCGGCATTCCTGCTGAACCGCTCTTCCGATCTAGCTAGGA AGCCATGGCAAG illumina adaptor PE-PCR-F AATGATACGGCGACCACCGAGATCTACACTCTTTCCCTACA cgac*g*c PE-PCR-R CAAGCAGAAGACGGCATACGAGATCGGTCTCGGCATTCCT 2023248167 13 Oct 2023 GCTGAACc*g*c Illi |j|jp IBB 3 site3-M-F ACACTCTTTCCCTACACGACGCTCTTCCGATCTAGTGCATA GTATGTGCTAGATGCTG site3-M-R GTGACTGGAGTTCAGACGTGTGCTCTTCCGATCTTGATCTC TAAGAAGGCAAATGAGAC illumina Index-PCR CAAGCAGAAGACGGCATACGAGATN1N2N3N4N5N6GTGAC TGGAGTTCAGACGTGTGCTCTTCCGATCT adaptor universal- PCR AATGATACGGCGACCACCGAGATCTACACTCTTTCCCTACA CGACGCTCTTCCGATCT *index-PCR primers are purchased from epicentre (ScriptSeq™ Index PCR Primers) EXAMPLE VIII 5 Genome Editing Assessment System (GEAS) Next generation sequencing has been utilized to detect rare genomic alterations. See references 27-30 hereby incorporated by reference in their entireties. To enable wide use of this approach to quickly assess HDR and NHEJ efficiency in hiPSCS, software was created, referred to as a “pipeline”, to analyze the genome engineering data. This pipeline is integrated in one single 10 Unix module, which uses different tools such as R, BL AT, and FASTX Toolkit. Barcode splitting: Groups of samples were pooled together and sequenced using MiSeq 150bp paired end (PE150) (Illumina Next Gen Sequencing), and later separated based on DNA barcodes using FASTX Toolkit. Quality filtering: Nucleotides with lower sequence quality (phred score<20) were trimmed. 15 After trimming, reads shorter than 80 nucleotides were discarded. Mapping: BLAT was used to map the paired reads independently to the reference genome and .psi files were generated as output. Indel calling: Indels were defined as the full length reads containing 2 blocks of matches in the alignment. Only reads following this pattern in both paired end reads were considered. As a 20 quality control, the indel reads were required to possess minimal 70nt matching with the reference genome and both blocks to be at least 20 nt long. Size and position of indels were calculated by the positions of each block to the reference genome. Non-homologous end joining (NHEJ) has been estimated as the percentage of reads containing indels (see equation 1 below). The majority of NHEJ events have been detected at the targeting site vicinity. 25 Homology directed recombination (HDR) efficiency: Pattern matching (grep) within a 12bp window centering over DSB was used to count specific signatures corresponding to reads 2023248167 13 Oct 2023 containing the reference sequence, modifications of the reference sequence (2bp intended mismatches), and reads containing only Ibp mutation within the 2bp intended mismatches (see equation 1 below). Equation 1. Estimation ofNHEJ and HDR 5 A= reads identical to the reference: XXXXXABXXXXX B= reads containing 2bp mismatch programed by ssODN: XXXXXabXXXXX C= reads containing only 1 bp mutation in the target site: such as XXXXXaBXXXXX or XXXXXAbXXXXX D = reads containing indels as described above ... ® . 10 A ? 8 S = (W & ,. .. _ . . .-M Lc a£’ EXAMPLE IX Genotype Screening of Colonized hiPSCs 15 Human iPS cells on feeder-free cultures were pre-treated with mTesr-1 media supplemented with SMC4 (5 uM thiazovivin, 1 uM CHIR99021, 0.4 uM PD0325901, 2 uM SB431542) (see reference 23 hereby incorporated by reference in its entirety for at least 2 hrs prior to FACS sorting. Cultures were dissociated using Accutase (Millipore) and resuspended in mTesr-1 media supplemented with SMC4 and the viability dye ToPro-3 (Invitrogen) at concentration of 20 1~2 XI07 / mL. Live hiPS cells were single-cell sorted using a BD FACSAria II SORP UV (BD Biosciences) with lOOum nozzle under sterile conditions into 96-well plates coated with irradiated CF-1 mouse embryonic fibroblasts (Global Stem). Each well contained hES cell medium (see reference 31 hereby incorporated by reference in its entirety) with 100 ng / ml recombinant human basic Fibroblast Growth Factor (bFGF) (Millipore) supplemented with SMC4 and 5 ug / ml 25 fibronectin (Sigma). After sorting, plates were centrifuged at 70 x g for 3 min. Colony formation was seen 4 days post sorting, and the culture media was replaced with hES cell medium with SMC4. SMC4 can be removed from hES cell medium 8 days after sorting. A few thousand cells were harvested 8 days after Fluorescence-activated cell sorting (FACS) and O.lul prepGEM tissue protease enzyme (ZyGEM) and lul prepGEM gold buffer 30 (ZyGEM) were added to 8.9 pl of cells in the medium. The reactions were then added to 40 pl of PCR mix containing 35.5ml platinum 1.1X Supermix (Invitrogen), 250nM of each dNTP and 400nM primers. Reactions were incubated at 95°C for 3min followed by 30 cycles of 95°C, 20s; 65°C, 30s and 72°C, 20s. Products were Sanger sequenced using either one of the PCR primers in Table 5 and sequences were analyzed using DNASTAR (DNASTAR). 2023248167 13 Oct 2023 EXAMPLE X Immunostaining and Teratoma Assays of hiPSCs Cells were incubated in the KnockOut DMEM / F-12 medium at 37°C for 60 minutes using the following antibody: Anti-SSEA-4 PE (Millipore) (1: 500 diluted); Tra-1-60 (BD Pharmingen) 5 (1:100 diluted). After the incubation, cells were washed three times with KnockOut DMEM / F-12 and imaged on the Axio Observer Z. 1 (ZIESS). To conduct teratoma formation analysis, human iPSCs were harvested using collagenase type IV (Invitrogen) and the cells were resuspended into 200 pl of Matrigel and injected intramuscularly into the hind limbs of Rag2gamma knockout mice. Teratomas were isolated and 10 fixed in formalin between 4-8 weeks after the injection. The teratomas were subsequently analyzed by hematoxylin and eosin staining. EXAMPLE XI Targeting Genomic Loci in Human Somatic Cells and Human Stem Cells Using reTALENS 15 According to certain aspects, TALEs known to those of skill in the art are modified or re coded to eliminate repeat sequences. Such TALEs suitable for modification and use in the genome editing methods in viral delivery vehicles and in various cell lines and organisms described herein are disclosed in references 2, 7-12 hereby incorporated by reference herein in their entireties. Several strategies have been developed to assemble the repetitive TALE RVD array sequences (see 20 references 14 and 32-34 hereby incorporated by reference herein in their entireties. However, once assembled, the TALE sequence repeats remain unstable, which limits the wide utility of this tool, especially for viral gene delivery vehicles (see references 13 and 35 hereby incorporated by reference herein in their entireties. Accordingly, one aspect of the present disclosure is directed to TALEs lacking repeats, such as completely lacking repeats. Such a re-coded TALE is 25 advantageous because it enables faster and simpler synthesis of extended TALE R VD arrays. To eliminate repeats, the nucleotide sequences of TALE RVD arrays were computationally evolved to minimize the number of sequence repeats while maintaining the amino acid composition. Re-coded TALE (Re-TALEs) encoding 16 tandem RVD DNA recognition monomers, plus the final half RVD repeat, are devoid of any 12bp repeats (see Fig. 5a). Notably, 30 this level of recoding is sufficient to allow PCR amplification of any specific monomer or subsection from a full-length re-TALE construct (see Fig. 5b). The improved design of re-TALEs may be synthesized using standard DNA synthesis technology (see reference 36 hereby incorporated by reference in its entirety without incurring the additional costs or procedures associated with repeatheavy sequences. Furthermore, the recoded sequence design allows efficient assembly of re-TALE 35 constructs using a modified isothermal assembly reaction as described in the methods herein and with reference to Fig. 6. 2023248167 13 Oct 2023 Genome editing NGS data was statistically analyzed as follows. For HDR specificity analysis, an exact binomial test was used to compute the probabilities of observing various numbers of sequence reads containing the 2bp mismatch. Based on the sequencing results of 1 Obp windows before and after the targeting site, the maximum base change rates of the two windows 5 (Pl and P2) were estimated. Using the null hypothesis that the changes of each of the two target bp were independent, the expected probability of observing 2bp mismatch at the targeting site by chance as the product of these two probabilities (P1*P2) was computed. Given a dataset containing N numbers of total reads and n number of HDR reads, we calculated the p-value of the observed HDR efficiency was calculated. For HDR sensitivity analysis, the ssODN DNA donors contained 10 a 2bp mismatch against the targeting genome, which made likely the co-presence of the base changes in the two target bp if the ssODN was incorporated into the targeting genome. Other nonintended observed sequence changes would not likely change at the same time. Accordingly, nonintended changes were much less interdependent. Based on these assumptions, mutual information (MI) was used to measure the mutual dependence of simultaneous two base pair changes in all 15 other pairs of positions, and the HDR detection limit was estimated as the smallest HDR where MI of the targeting 2bp site is higher than MI of all the other position pairs. For a given experiment, HDR reads with intended 2bp mismatch from the original fastq file were identified and a set of fastq files with diluted HDR efficiencies were simulated by systematically removing different numbers of HDR reads from the original data set. Mutual information (MI) was computed between 20 all pairs of positions within a 20bp window centered on the targeting site. In these calculations, the mutual information of the base composition between any two positions is computed. Unlike the HDR specificity measure described above, this measure does not assess the tendency of position pairs to change to any particular pairs of target bases, only their tendency to change at the same time, (see Fig. 8A). Table 6 shows HDR and NHEJ efficiency of re-TALEN / ssODN targeting 25 CCR5 and NHEL efficiency of Cas9-gRNA. We coded our analysis in R and MI was computed using the package infotheo. Table 6 # targeting site cell type HDR (reTALEN) (%) NHEJ (reTALE) (%) HDR detection limit based on Information analysis NHEJ (Cas9-gRNA) HDR (Cas9-gRNA) 1 PGPl-iPS 0.06% 0.80% 0.04% 0.58% 0.38% 2 PGPl-iPS 0.48% 0.26% 0.01% 16.02% 3.71% 2023248167 13 Oct 2023 3 PGPl-iPS 1.71% 0.07% 0.03% 3.44% 3.20% 4 PGPl-iPS 0.02% 1.20% 0.02%* 1.50% 0.14% 5 PGPl-iPS ().8()% 0.04% 0.00% 3.70% ().39% 6 PGPl-iPS 0.20% 0.73% 0.00% 1.12% 0.49% 7 PGPl-iPS 0.01% 0.15% 0.01%* 1.98% 1.78% 8 PGPl-iPS 0.03% 0.00% 0.00% 1.85% 0.03% 9 PGPl-iPS 1.60% 0.06% 0.00% 0.50% 0.13% 10 PGPl-iPS 0.68% 1.25% 0.01% 8.77% 1.32% 11 PGPl-iPS 0.06% 0.27% 0.00% 0.62% 0.44% 12 PGPl-iPS 1.60% 0.03% 0.04% 0.18% 0.99% 13 PGPl-iPS 0.00% 1.47% 0.00% 0.65% 0.02% 14 PGPl-iPS 0.47% 0.13% 0.02% 2.50% 0.31% 15 PGPl-iPS 0.8 0.14 0.08% 1.50 1.10% * The group where HDR detection limit exceeds the real HDR detected Correlations between genome editing efficiency and epigenetic state were addressed as 5 follows. Pearson correlation coefficients were computed to study possible associations between epigenetic parameters (DNase I HS or nucleosome occupancy) and genome engineering efficiencies (HDR, NHEJ). Dataset of DNAasel Hypersensitivity was downloaded from UCSC genome browser. hiPSCs DNase I HS: / gbdb / hgl9 / bbi / wgEncodeOpenChromDnaseIpsnihi7Sig.bigWig 10 To compute P-values, the observed correlation was compared to a simulated distribution which was built by randomizing the position of the epigenetic parameter (N=l 00000). Observed correlations higher than the 95th percentile, or lower than the 5th percentile of the simulated distribution were considered as potential associations. The function of reTALEN in comparison with the corresponding non-recoded TALEN in 15 human cells was determined. A HEK. 293 cell line containing a GFP reporter cassette carrying a frame-shifting insertion was used as described in reference 37 hereby incorporated by reference in its entirety. See also Fig. la. Delivery of TALENs or reTALENs targeting the insertion sequence, together with a promoter-less GFP donor construct, leads to DSB-induced HDR repair of the GFP cassette, so that GFP repair efficiency can be used to evaluate the nuclease cutting efficiency. See 20 reference 38 hereby incorporated by reference in its entirety. reTALENs induced GFP repair in 1.4% of the transfected cells, similar to that achieved by TALENs (1.2%) (see Fig. lb). The activity of reTALENs at the AAVS1 locus in PGP1 hiPSCs was tested (see Fig. 1c) and 2023248167 13 Oct 2023 successfully recovered cell clones containing specific insertions (see Fig. ld,e), confirming that reTALENs are active in both somatic and pluripotent human cells. The elimination of repeats enabled generation of functional lentivirus with a re-TALE cargo. Specifically, lentiviral particles were packaged encoding re-TALE-2A-GFP and were tested 5 for activity of the re-TALE-TF encoded by viral particles by transfecting a mCherry reporter into a pool of lenti-reTALE-2A-GFP infected 293T cells. 293T cells transduced by lenti-re-TALE-TF showed 36X reporter expression activation compared with the reporter only negative (see Fig. 7a,b,c). The sequence integrity of the re-TALE-TF in the lentiviral infected cells was checked and full-length reTALEs in all 10 of the clones tested were detected, (see Fig. 7d). 10 EXAMPLE XII Comparison of ReTALEs and Cas9-gRNA efficiency in hiPSCs with Genome Editing Assessment System (GEAS) To compare the editing efficiencies of re-TALENs versus Cas9-gRNA in hiPSCs, a next-15 generation sequencing platform (Genome Editing Assessment System) was developed to identify and quantify both NHEJ and HDR gene editing events. A re-TALEN pair and a Cas9-gRNA were designed and constructed, both targeting the upstream region of CCR5 (re-TALEN, Cas9-gRNA pair #3 in Table 3), along with a 90nt ssODN donor identical to the target site except for a 2bp mismatch (see Fig. 2a). The nuclease constructs and donor ssODN were transfected into hiPSCs. 20 To quantitate the gene editing efficiency, paired-end deep sequencing on the target genomic region was conducted 3 days after transfection. HDR efficiency was measured by the percentage of reads containing the precise 2bp mismatch. NHEJ efficiency was measured by the percentage of reads carrying indels. Delivery of the ssODN alone into hiPSCs resulted in minimal HDR and NHEJ rates, while 25 delivery of the re-TALENs and the ssODN led to efficiencies of 1.7% HDR and 1.2% NHEJ (see Fig. 2b). The introduction of the Cas9-gRNA with the ssODN led to 1.2% HDR and 3.4% NHEJ efficiencies. Notably, the rate of genomic deletions and insertions peaked in the middle of the spacer region between the two reTALENs binding site, but peaked 3-4bp upstream of the Protospacer Associated Motif (PAM) sequence of Cas9-gRNA targeting site (see Fig. 2b), as 30 would be expected since double stranded breaks take place in these regions. A median genomic deletion size of 6bp and insertion size of 3bp generated by the re-TALENs was observed and a median deletion size of 7bp and insertion of Ibp by the Cas9-gRNA was observed (see Fig. 2b), consistent with DNA lesion patterns usually generated by NHEJ (see reference 4 hereby incorporated by reference in its entirety.) Several analyses of the next-generation sequencing 35 platform revealed that GEAS can detect HDR detection rates as low as 0.007%, which is both highly reproducible (coefficient of variation between replicates = ± 15% * measured efficiency) 2023248167 13 Oct 2023 and 400X more sensitive than most commonly used mismatch sensitive endonuclease assays (see Fig- 8). re-TALEN pairs and Cas9-gRNAs targeted to fifteen sites at the CCR5 genomic locus were built to determine editing efficiency (see Fig. 2c, see Table 3). These sites were selected to 5 represent a wide range of DNasel sensitivities (see reference 39 hereby incorporated by reference in its entirety. The nuclease constructs were transfected with the corresponding ssODNs donors (see Table 3) into PGP1 hiPSCs. Six days after transfection, the genome editing efficiencies at these sites were profiled (Table 6). For 13 out of 15 re-TALEN pairs with ssODN donors, NHEJ and HDR was detected at levels above statistical detection thresholds, with an average NHEJ 10 efficiency of 0.4% and an average HDR efficiency of 0.6% (see Fig. 2c). In addition, a statistically significant positive correlation (r2 =0.81) was found between HR and NHEJ efficiency at the same targeting loci (P<1 X 10-4) (see Fig. 9a), suggesting that DSB generation, the common upstream step of both HDR and NHEJ, is a rate-limiting step for reTALEN-mediated genome editing. In contrast, all 15 Cas9-gRNA pairs showed significant levels of NHEJ and HR, with an 15 average NHEJ efficiency of 3% and an average HDR efficiency of 1.0% (see Fig. 2c). In addition, a positive correlation was also detected between the NHEJ and HDR efficiency introduced by Cas9-gRNA (see Fig. 9b) (r2=0.52, p=0.003), consistent with observations for reTALENs. The NHEJ efficiency achieved by Cas9-gRNA was significantly higher than that achieved by reTALENs (t-test, paired-end, P=0.02). A moderate but statistically significant correlation between 20 NHEJ efficiency and the melting temperature of the gRNA targeting sequence was observed (see Fig. 9c) (r2=0.28, p=0.04), suggesting that the strength of base-pairing between the gRNA and its genomic target could explain as much as 28% of the variation in the efficiency of Cas9-gRNA-mediated DSB generation. Even though Cas9-gRNA produced NHEJ levels at an average of 7 times higher than the corresponding reTALEN, Cas9-gRNA only achieved HDR levels 25 (average=1.0%) similar to that of the corresponding reTALENs (average = 0.6%). Without wishing to be bound by scientific theory, these results may suggest either that the ssODN concentration at the DSB is the limiting factor for HDR or that the genomic break structure created by the Cas9-gRNA is not favorable for effective HDR. No correlation between DNasel HS and the genome targeting efficiencies was observed for either method, (see Fig. 10). 30 EXAMPLE XIII Optimization of ssODN Donor Design for HDR Highly-performing ssODNs in hiPSCs were designed as follows. A set of ssODNs donors of different lengths (50-170nt), all carrying the same 2bp mismatch in the middle of the spacer 35 region of the CCR5 re-TALEN pair #3 target sites was designed. HDR efficiency was observed to vary with ssODN length, and an optimal HDR efficiency of ~1.8% was observed with a 90 nt 2023248167 13 Oct 2023 ssODN , whereas longer ssODNs decreased HDR efficiency (see Fig. 3a). Since longer homology regions improve HDR rates when dsDNA donors are used with nucleases (see reference 40 hereby incorporated by reference in its entirety), possible reasons for this result may be that ssODNs are used in an alternative genome repair process; longer ssODNs are less available to the genome 5 repair apparatus; or that longer ssODNs incur negative effects that offset any improvements gained by longer homology, compared to dsDNA donors (see reference 41 hereby incorporated by reference in its entirety.) Yet, if either of the first two reasons were the case, then NHEJ rates should either be unaffected or would increase with longer ssODNs because NHEJ repair does not involve the ssODN donor. However, NHEJ rates were observed to decline along with HDR (see 10 Fig. 3a), suggesting that the longer ssODNs present offsetting effects. Possible hypotheses would be that longer ssODNs are toxic to the cell (see reference 42 hereby incorporated by reference in its entirety), or that transfection of longer ssODNs saturates the DNA processing machinery, thereby causing decreased molar DNA uptake, and reducing the capacity of the cells to take up or express re-TALEN plasmids. 15 How rate of incorporation of a mismatch carried by the ssODN donor varies with its distance to the double stranded break (“DSB”) was examined. A series of 90nt ssODNs all possessing the same 2bp mismatch (A) in the center of the spacer region of re-TALEN pair #3 was designed. Each ssODN also contained a second 2bp mismatch (B) at varying distances from the center (see Fig. 3b). A ssODN possessing only the center 2bp mismatch was used as a control. 20 Each of these ssODNs was introduced individually with re-TALEN pair #3 and the outcomes were analyzed with GEAS. We found that overall HDR — as measured by the rate at which the A mismatch was incorporated (A only or A+B) — decreased as the B mismatches became farther from the center (see Fig. 3b, see Fig. Ila). The higher overall HDR rate observed when B is only lObp away from A may reflect a lesser need for annealing of the ssODN against genomic DNA 25 immediately proximal to the dsDNA break. For each distance of B from A, a fraction of HDR events only incorporated the A mismatch, while another fraction incorporated both A and B mismatches (see Fig. 3b (A only and A+B)), These two outcomes may be due to gene conversion tracts (see reference 43 hereby incorporated by reference in its entirety) along the length of the ssDNA oligo, whereby 30 incoporation of A+B mismatches resulted from long conversion tracts that extended beyond the B mismatch, and incorporation of the A-only mismatch resulted from shorter tracts that did not reach B. Under this interpretation, a distribution of gene conversion lengths in both directions along the ssODN were estimated (see Fig. 11b). The estimated distribution implies that gene conversion tracts progressively become less frequent as their lengths increase, a result very similar to gene 35 conversion tract distributions seen with dsDNA donors, but on a highly compressed distance scale of tens of bases for the ssDNA donor vs. hundreds of bases for dsDNA donors. Consistent with 2023248167 13 Oct 2023 this result, an experiment with a ssODN containing three pairs of 2bp mismatches spaced at intervals of lOnt on either side of the central 2bp mismatch “A” gave rise to a pattern in which A alone was incorporated 86% of the time, with multiple B mismatches incorporated at other times (see Fig. 11c). Although the numbers of B only incorporation events were too low to estimate a 5 distribution of tract lengths less than lObp, it is clear that the short tract region within lObp of the nuclease site predominates (see Fig. 11b). Finally, in all experiments with single B mismatches, a small fraction of B-only incorporation events is seen (0.04%~0.12%) that is roughly constant across all B distances from A. Furthermore, analysis was earned out of how far the ssODN donor can be placed from the 10 re-TALEN-induced dsDNA break while still observing incorporation. A set of 90nt ssODNs with central 2bp mismatches targeting a range of larger distances (-600bp to +400bp) away from the re-TALEN-induced dsDNA break site were tested. When the ssODNs matched >40bp away, we observed >30x lower HDR efficiencies compared to the control ssODN positioned centrally over the cut region (see Fig. 3c). The low level of incorporation that was observed may be due to 15 processes unrelated to the dsDNA cut, as seen in experiments in which genomes are altered by a ssDNA donor alone see reference 42 hereby incorporated by reference in its entirety. Meanwhile, the low level of HDR present when the SsODN is ~40bp away may be due to a combination of weakened homology on the mismatch-containing side of the dsDNA cut along with insufficient ssODN oligo length on the other side of the dsDNA break. 20 The ssODNs DNA donor design for Cas9-gRNA mediated targeting was tested. Cas9- gRNA (C2) targeting the AAVS1 locus was constructed and ssODN donors of variable orientations (Oc: complementary to the gRNA and On: non-complementary to the gRNA) and lengths (30, 50, 70, 90, 110 nt) were designed. Oc achieved better efficiency than On, with a 70mer Oc achieving an optimal HDR rate of 1.5%. (see Fig. 3d) The same ssODN strand bias was detected using a 25 Cas9-derived nickase (Cc: Cas9_D10A), despite the fact that the F1DR efficiencies mediated by Cc with ssODN were significantly less than C2 (t-test, paired-end, P=0.02). (see Fig. 12). EXAMPLE XIV hiPSC Clonal Isolation of Corrected Cells 30 GEAS revealed that re-TALEN pair #3 achieved precise genome editing with an efficiency of ~1% in hiPSCs, a level at which correctly edited cells can usually be isolated by screening clones. HiPSCs have poor viability as single cells. Optimized protocols described in reference 23 hereby incorporated by reference in its entirety along with a single-cell FACS sorting procedure was used to establish a robust platform for single hiPSCs sorting and maintenance, where hiPSC 35 clones can be recovered with survival rates of >25%. This method was combined with a rapid and efficient genotyping system to conduct chromosomal DNA extraction and targeted genome 2023248167 13 Oct 2023 amplification in 1-hour single tube reactions, enabling large scale genotyping of edited hiPSCs. Together, these methods comprise a pipeline for robustly obtaining genome-edited hiPSCs without selection. To demonstrate this system (see Fig. 4a), PGP1 hiPSCs were transfected with a pair of re-5 TALENs and an ssODN targeting CCR5 at site #3 (see Table 3). GEAS was performed with a portion of the transfected cells, finding an HDR frequency of 1.7% (see Fig. 4b). This information, along with the 25% recovery of sorted single-cell clones, allow estimation of obtaining at least one correctly-edited clone from five 96-well plates with Poisson probability 98% (assuming p=' & » % * 5 * six days after transfection, hiPSCs were FACS-sorted and eight days 10 after sorting, 100 hiPSC clones were screened. Sanger sequencing revealed that 2 out of 100 of these unselected hiPSC colonies contained a heterozygous genotype possessing the 2bp mutation introduced by the ssODN donor see (Fig. 4c). The targeting efficiency of 1% (l%=2 / 2*100, 2 mono-allelic corrected clones out of 100 cell screened) was consistent with the next-generation sequencing analysis (1.7%) (see Fig. 4b). The pluripotency of the resulting hiPSCs was confirmed 15 with immunostaining for SSEA4 and TRA-1-60 (see Fig. 4d). The successfully targeted hiPSCs clones were able to generate mature teratomas with features of all three germ layers (see Fig. 4e). EXAMPLE XV Method for Continuous Cell Genome Editing 20 According to certain aspects, a method is provided for genome editing in cells, including a human cell, for example a human stem cell, wherein the cell is genetically modified to include a nucleic acid encoding an enzyme that forms a co-localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner. Such an enzyme includes an RNA guided DNA binding protein, such as an RNA-guided DNA binding protein of a 25 Type II CRISPR system. An exemplary enzyme is Cas9. According to this aspect, the cell expresses the enzyme and guide RNA is provided to the cell from the media surrounding the cell. The guide RNA and the enzyme form a co-localization complex at target DNA where the enzyme cuts the DNA. Optionally, a donor nucleic acid may be present for insertion into the DNA at the cut site, for example by nonhomologous end joining or homologous recombination. According to 30 one aspect, the nucleic acid encoding an enzyme that forms a co-localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner, such as Cas9, is under the influence of a promoter, such as the nucleic acid can be activated and silenced. Such promoters are well known to those of skill in the art. One exemplary promoter is the dox inducible promoter. According to one aspect, the cell is genetically modified by having 35 reversibly inserted into its genome the nucleic acid encoding an enzyme that forms a colocalization complex with RNA complementary to the target DNA and that cleaves the target DNA 2023248167 13 Oct 2023 in a site specific manner. Once inserted, the nucleic acid can be removed by use of a reagent, such as a transposase. In this manner, the nucleic acid can be easily removed after use. According to one aspect, a continuous genome editing system in human induced pluripotent stem cells (hiPSCs) using a CRISPR system is provided. According to an exemplary 5 aspect, the method includes use of a hiPSC line with Cas9 reversibly inserted in the genome (Cas9-hiPSCs); and gRNAs which have been modified from their native form to allow their passage from media surrounding the cells into the cells for use with the Cas9. Such gRNA has been treated with a phosphatase in a manner to remove phosphate groups. Genome editing in the cell is carried out with Cas9 by supplementing phosphatase treated gRNA in the tissue culture media. This approach 10 enables scarless genome editing in HiPSCs with up to 50% efficiencies with single days of treatment, 2-1 OX times more efficient than the best efficiencies reported so far. Further, the method is easy to use and with significantly lower cellular toxicity. Embodiments of the present disclosure include single editing of hiPSCs for biological research and therapeutic applications, multiplex editing of hiPSCs for biological research and therapeutic applications, directional hiPSCs evolution 15 and phenotype screening of hiPSCs and its derivative cells. According to certain aspects, other cell lines and organisms described herein can be used in addition to stem cells. For example, the method described herein can be used to animal cells such as mouse or rat cells so that stable Cas9 integrated mouse cells and rat cells can be generated and tissue specific genome editing can be conducted by locally introducing phosphatase treated gRNA 20 from media surrounding the cells. Moreover, other Cas9 derivatives can be inserted into many cell lines and organisms, and targeted genomic manipulations, such as sequence specific nicking, gene activation, suppression and epigenetic modification can be conducted. Aspects of the present disclosure are directed to making stable hiPSCs with Cas9 inserted into the genome. Aspects of the present disclosure are directed to modifying RNA to enable entry 25 into a cell through the cell wall and co-localization with Cas9 while avoiding the immune response of the cell. Such modified guide RNA can achieve optimal transfection efficiencies with minimal toxicity. Aspects of the present disclosure are directed to optimzied genome editing in Cas9-hiPSCs using phosphatase treated gRNA. Aspects of the present disclosure include eliminating Cas9 from hiPSCs to achieve scarleSs genome editing, where the nucleic acid encoding Cas9 has 30 been reversibly placed into the cell genome. Aspects of the present disclosure include biomedical engineering using hiPSCs with Cas9 inserted into the genome to create desired genetic mutations. Such engineered hiPSCs maintain pluripotency and can be successfully differentiated into various cell types, including cardiomyocyte, which fully recapitulate the phenotype of patient cell lines. Aspects of the present disclosure include libraries of phosphatase treated gRNAs for 35 multiplex genome editing. Aspects of the present disclosure include generating a library of PGP cell lines with each one carrying 1 to a few designated mutations in the genome, which can serve as 2023248167 13 Oct 2023 resource for drag screening. Aspects of the present disclosure include generating PGP1 cell lines with all the retrotranselements barcoded with different sequences to track the location and activity of this element. 5 EXAMPLE XVI Generating Stable hiPSCs with Cas9 inserted into the Genome Cas9 was encoded under the dox inducible promoter and the construct was placed into a Piggybac vector which can be inserted into and removed out of the genome with the help of Piggybac transposase. PCR reaction validated the stable insertion of the vector (see Fig. 14). The 10 inducible Cas9 expression was deteimined via RT-QPCR. The mRNA level of Cas9 increased 1000X after 8 hours of lug / mL DOX supplementation in the culture media and the level of Cas 9 mRNA dropped to normal level ~ 20 hours after withdrawal of the DOX. (See Fig. 15). According to one aspect, the Cas9-hiPSC system based genome editing bypasses the transfection procedure of Cas9 plasmid / RNA, a large construct usually with < 1% transfection 15 efficiency in hiPSCs. The present Cas9-hiPSC system can serve as a platform to perform high efficient genomic engineering in human stem cells. In addition, the Cas9 cassette introduced into the hiPSCs using Piggybac system can be removed out from the genome easily upon introducing of transposases. 20 EXAMPLE XVII Phosphatase Treated Guide RNA To enable continuous genome editing on Cas9-hiPSCs, a series of modified RNA encoding gRNA were generated and supplemented into Cas9-iPS culture medium in complex with liposome. Phosphatase treated native RNA without any capping achieved the optimal HDR efficiency of 25 13%, 30X more than previously reported 5’Cap-Mod RNA (see Fig. 16). According to one aspect, guide RNA is physically attached to the donor DNA. In this manner, a method is provided of coupling Cas9 mediated genomic cutting and ssODN-mediated HDR, thus stimulating sequence specific genomic editing. gRNA linked with DNA ssODN donor with optimized concentration achieved 44% HDR and unspecific NH EJ 2% (see Fig. 17). Of note, 30 this procedure does not incurred visible toxicity as observed with nucleofection or electroporation. According to one aspect, the present disclosure provides an in vitro engineered RNA structure encoding gRNA, which achieved high transfection efficiency, genome editing efficiency in collaboration with genomically inserted Cas9. In addition, the present disclosure provides a gRNA-DNA chimeric construct to couple a genomic cutting event with the homology directed 35 recombination reaction. 2023248167 13 Oct 2023 EXAMPLE XVIII Eliminating Reversibly Engineered Cas9 from hiPSCs to Achieve Scarless Genome Editing According to certain aspects, a Cas9 cassette is inserted into the genome of hiPSC cells using a reversible vector. Accordingly, a Cas9 cassette was reversibly inserted into the genome of 5 hiPSC cells using a PiggyBac vector. The Cas9 cassette was removed from the genome edited hiPSCs by transfecting the cell with transposase-encoding plasmid. Accordingly, aspects of the present disclosure include use of a reversible vector, which is known to those of skill in the art. A reversible vector is one which can be inserted into a genome, for example, and then removed with a corresponding vector removal enzyme. Such vectors and corresponding vector removal enzymes 10 are known to those of skill in the art. A screen was performed on colonized iPS cells and colonies devoid of Cas9-cassette were recovered as confirmed by PCR reaction. Accordingly, the present disclosure provides method of genome editing without affecting the rest of the genome by having a permanent Cas9 cassette present in the cell. 15 EXAMPLE XIX Genome Editing in iPGP 1 Cells Research into the pathogenesis of cardiomyopathy has historically been hindered by the lack of suitable model systems. Cardiomyocyte differentiation of patient-derived induced pluripotent stem cells (iPSCs) offers one promising avenue to surmount this barrier, and reports of 20 iPSC modeling of cardiomyopathy have begun to emerge. However, realization of this promise will require approaches to overcome genetic heterogeneity of patient-derived iPSC lines. Cas9-iPGPl cell lines and phosphatase treated guide RNA bound to DNA were used to generated three iPSC lines that are isogenic except for the sequence at TAZ exon 6, which was identified to carry single nucleotide deletion in Barth syndrome patients. Single round of RNA 25 transfection achieved ~30% HDR efficiency. Modified Cas9-iPGPl cells with desired mutations were colonized (see Fig. 18) and the cell lines were differentiated into cardiomyocyte. Cardiomyocyte derived from the engineered Cas9-iPGPl fully recapitulated the cardiolipin, mitochondrial, and ATP deficits observed in patient-derived iPSCs and in the neonatal rat TAZ knockdown model (see Fig. 19). Accordingly, methods are provided for correcting mutations 30 causing diseases in pluripotent cells followed by differentiation of the cells into desired cell types. EXAMPLE XX Materials and Methods 1. Establishment of PiggyBac Cas9 dox inducible stable human iPS / ES lines 35 i. After cells reached 70% confluence pretreat the culture with ROCK inhibitor Y27632 at final concentration of lOuM for overnight. 2023248167 13 Oct 2023 2. The next day prepare the nucleofection solution by combine the 82 pl of human stem cell nucleofector solution and 18ul supplement 1 in a sterile 1.5 ml eppendorf tube. Mix well. Incubate solution at 37°C for 5 mins. 3. Aspirate mTeSRl; gently rinse the cells with DPBS at 2 mL / well of a six-well plate. 5 4. Aspirate the DPBS, add 2 mL / well of Versene, and put the culture back to incubator at 37°C until they become rounded up and loosely adherent, but not detached. This requires 3-7 min. 5. Gently aspirate the Versene and add mTeSR 1. Add 1ml mTeSRl and dislodge the cells by gently flowing mTeSRl over them with a 1,000 uL micropipette. 10 6. Collect the dislodged cells, gently triturate them into a single-cell suspension, and quantitate by hemacytometer and adjust cell density to Imillion cells per ml. 7. Add 1ml cell suspension to 1.5ml eppendorf tube and centrifuge at 1100 RPM for 5 min in a bench top centrifuge. 8. Resuspend cells in 100 pl of human stem cell nucleofector solution from Step 2. 15 9. Transfer cells to a nucleofector cuvette using a 1 ml pipette tip. Add 1 pg of plasmid Transposonase and 5ug PB Cas9 plasmids into the cell suspension in the cuvette. Mix cells and DNA by gentle swirling. io. Put the cuvette into the nucleofector. Programs B-016 was selected and nucleofect cells by pressing button X. 20 ii. Add 500ul mTeSRl medium with ROCK inhibitor in the cuvette after nucleofection. 12. Asperate the nucleofected cells from the cuvette using the provided Pasteur plastic pipette. And transfer cells drop-wise into matrigel coated well of 6 well plate mTeSRl mediun with ROCK inhibitor. Incubate the cells at 37°C overnight. 13. Change the medium to mTesrl the next day and after 72 hours of transfection;add 25 puromycin at final concentration at lug / ml.And the line will be set up within 7 days. 2. RN A preparation 1. Prepare DNA template with T7 promoter upstream of gRNA coding sequence. 2. Purify the DNA using Mega Clear Purification and normalize the concentration. 30 3. Prepare Custom NTPS mixtures for different gRNA production. #1 Native RNA Mix [Final] (mM) GTP 7.5 ATP 7.5 CTP 7.5 UTP 7.5 2023248167 13 Oct 2023 | Total volume 1 #2 Capped Native RNA Mix [Final] (mM) 3 ’-O-Me-m7G Cap structure analog (NEB) 6 GTP 1.5 ATP 7.5 CTP 7.5 UTP 7.5 Total volume #3 Modified RNA Mix [Final] (mM) GTP 7.5 ATP 7.5 5-Me-CTP (Tri-Link) 7.5 Pseudo-UTP (Tri-Link) 7.5 Total volume #4 Capped / Modified RNA Mix [Final] (mM) 3’-O-Me-m7G Cap structure analog (NEB) 6 GTP 1.5 ATP 7.5 5-Me-CTP (Tri-Link) 7.5 Pseudo-UTP (Tri-Link) 7.5 Total volume 5 4. Prepare the in vitro transcription mix at room temperature. Amt (ul) Custom NTPS (*Add NA 2023248167 13 Oct 2023 vol / TVT rxn as indicated above) on ice PCR product (lOOng / ul) = 1600ng total ([ final ]-40ng / iil) 16 Buffer XI0 (MEGAscript kit from Ambion) @ RT 4 T7 Enzyme (MEGAscript kit from Ambion) 4 5. Incubate for 4 hours (3-6hrs ok) at 37°C (thermocycler). 6. Add 2pl Turbo DNAse (MEGAscript kit from Ambion) to each sample. Mix gently and incubate at 37°C for 15'. 5 7. Purify DNAse treated reaction using MegaClear from Ambion according to the manufacturer’s instructions. 8. Purify RNA using MEGAclear. (Purified RNA can be stored at -80 for several months). 9. To remove phosphate groups to avoid Toll 2 immune reaction from the host cell. RNA Phosphatase treatment IX 12 For each RNA sample ~100ul NA 1 OX Antarctic Phosphatase buffer 1 lul 132 Antarctic Phosphatase 2ul 24 Gently mix sample and incubate at 37°C for 30' (3O'-lhr ok) 10 3. RNA transfection 1. Plate 10K-20K cells per 48 well without antibiotics. Cells should be 30-50% confluent for transfection. 2. Change the cell media to with B18R (200ng / ml), DOX (lug / ml), Puromycin (2ug / ml) at least two hours before the transfection. 3. Prepare the transfection reagent containing gRNA (0.5ug~2ug), donor DNA (0.5ug~2ug)and RNAiMax, incubate the mixture in rm temperature for 15 minutes and transfer to the cell. 20 4. Single human iPS cells seed and single clone pickup 1. After 4 days of dox induction and 1 day dox withdraw,asperate the medium,rinse gently 2023248167 13 Oct 2023 with the DPBS.add 2 mL / well of Versene, and put the culture back to incubator at 37°C until they become rounded up and loosely adherent, but not detached. This requires 3-7 min. 2. Gently aspirate the Versene and add mTeSRl .Add 1ml mTeSRl and dislodge the cells by gently flowing mTeSRl over them with a 1,000 uL micropipette. 5 3. Collect the dislodged cells, gently triturate them into a single-cell suspension, and quantitate by hemacytometer and adjust cell density to 100K cells per ml. 4. Seeding the cells into matrigel coated 10 cm dishes with mTeSRl plus ROCK inhibitor at cell density of 50K,100K and 400K per 10 cm dish. 10 5. Single cell formed Clones screening 1. After 12 days culture in 10 cm dish and clones are big enough to be identified by naked eyes and labeled by colon marker. Do not allow clones become too big and adhere to each other. 2. Put the 10 cm dish to the culture hood and using a P20 pipette(set at lOul) with filter 15 tips. Aspirate lOul medium for one well of 24 well plates. Pick up clone by scratching the clone into small pieces and transfer to one well of 24 well plate. Each filter tip for each clone. 3. After 4-5 days the clones inside one well of 24 well plate become big enough to split. 4. Aspirate the medium and rinse with 2 mL / well DPBS. 20 5. Aspirate DPBS, replace with 250ul / well dispase (0.1 U / mL). and incubate the cells in dispase at 37°C for 7 min. 6. Replace the dispase with 2ml DPBS. 7. Add 250ul mTeSRl. Using a cell scraper to lodge off the cells and collect the cells. 8. Tranfer 125ul cell suspension into a well of matrigel coated 24 wells plates. 25 9. Transfer 125ul cell suspension into 1.5ml eppendorf tube for genomic DNA extraction. 6. Clone screening 1. Centrifuge the tube from step7.7 2. Aspirate the medium and add 250ul lysis buffer per well (10mM+TrispH7.5+(or+8.0), 1 OmMEDTA, 1 OmM. 30 3. NaCl,+10%SDS,40ug / mL+proteinase K(added fresh before using the buffer). 4. Incubate at 55 overnight. 5. PrecipitateDNA by adding 250ul Isopropanol. 6. Spin for 30 minutes at highest speed. Wash with 70% ethanol. 7. Gently remove ethanoLAir dry for 5 min. 35 8. Resuspend gDNA withl00-200ul dH2O. 2023248167 13 Oct 2023 9. PCR amplification of the targeted genomic region with specific primers. 10. Sanger sequencing the PCR product with respective primer. 11. Analysis of Sanger sequence data and expansion of targeted clones. 7. Piggybac vector remove 1. Repeat the step 2.1-2.9 2. Transfer cells to a nucleofector cuvette using a 1 ml pipette tip.Add 2 pg plasmid of Transposonase into the cell suspension in the cuvette. Mix cells and DNA by gentle swirling. 3. Repeat the step 2.10-2.11 4. Asperate the nucleofected cells from the cuvette using the provided Pasteur plastic pipette. And transfer cells drop-wise into matrigel coated well of 10 cm dish with mTeSRl medium plus ROCK inhibitor. Incubate the cells at 37°C overnight. 5. The next day change the medium to mTesrl and change the medium every day for 4 following days. 6. After the clones became big enough pick up 20-50 clones and seeding into 24 well. 7. Genotype the clones with PB Cas9 PiggyBac vector primers and expansion negative clones. Throughout this specification and the claims which follow, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps. The reference in this specification to any prior publication (or information derived from it), or to any matter which is known, is not, and should not be taken as an acknowledgment or admission or any form of suggestion that that prior publication (or information derived from it) or known matter forms part of the common general knowledge in the field of endeavour to which this specification relates. References References are designated throughout the specification by their number below and are incorporated into the specification as if fully set forth therein. Each of the following references is hereby incorporated by reference in its entirety. 2023248167 13 Oct 2023 1. Carroll,D. (2011) Genome engineering with zine-finger nucleases. Genetics, 188, 773-82. 2. Wood,A.J., Lo,T.-W., Zeitler,B., Pickle,C.S., Ralston,E.J., Lee,A.H., Amora,R., Miller,J.C., Leung,E., Meng,X., et al. (2011) Targeted genome editing across species using ZFNs and TALENs. Science (New York, N.Y.), 333, 307. 3. Perez-Pinera,P., Ousterout,D.G. and Gersbach,C.A. (2012) Advances in targeted genome editing. Current opinion in chemical biology, 16, 268-77. 4. Symington,L.S. and Gautier,J. (2011) Double-strand break end resection and repair pathway choice. Annual review of genetics, 45, 247-71. 2023248167 13 Oct 2023 5. Umov,F.D., Miller,J.C., Lee,Y.-L., Beausejour,C.M., Rock,J.M., Augustus,S., Jamieson,A.C., Porteus,M.H., Gregory,P.D. and Holmes,M.C. (2005) Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature, 435, 646-51. 6. Boch,J., Scholze,H., Schomack,S., Landgraf,A., Hahn,S., Kay,S., Lahaye,T., Nickstadt,A. and 5 Bonas,U. (2009) Breaking the code of DNA binding specificity of TAL-type III effectors. Science (New York, N.Y.), 326, 1509-12. 7. Cell,P., Replacement,K.S., Talens,A., Type,A., Collection,C., Ccl-,A. and Quickextract,E. Genetic engineering of human pluripotent cells using TALE nucleases. 8. Mussolino,C., Morbitzer,R., Liitge,F., Dannemann,N., Lahaye,T. and Cathomen,T. (2011) A 10 novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic acids research, 39, 9283-93. 9. Ding,Q., Lee,Y., Schaefer,E.A.K., Peters,D.T., Veres,A., Kim,K., Kuperwasser,N., Motola,D.L., Meissner,T.B., Hendriks,W.T., et al. (2013) Resource A TALEN Genome-Editing System for Generating Human Stem Cell-Based Disease Models. 15 10. Hockemeyer,D., Wang,H., Kiani,S., Lai,C.S., Gao,Q., Cassady,J.P., Cost,G.J., Zhang,L., Santiago, Y., Miller, J.C., et al. (2011) Genetic engineering of human pluripotent cells using TALE nucleases. Nature biotechnology, 29, 731-4. 11. Bedell,V.M., Wang,Y., Campbell, J.M., Poshusta,T.L., Starker,C.G., Krug Ii,R.G., Tan,W., Penheiter,S.G., Ma,A.C., Leung,A.Y.H., et al. (2012) In vivo genome editing using a high- 20 efficiency TALEN system. Nature, 490, 114-118. 12. Miller,J.C., Tan,S., Qiao,G., Barlow,K. a, Wang,J., Xia,D.F., Meng,X., Paschon,D.E., Leung,E., Hinkley,S. J., et al. (2011) A TALE nuclease architecture for efficient genome editing. Nature biotechnology, 29, 143-8. 13. Holkers,M., Maggio,!., Liu,J., Janssen,J.M., Miselli,F., Mussolino,C., Recchia,A., Cathomen,T. 25 and Goncalves,M. a F. V (2012 ) Differential integrity of TALE nuclease genes following adenoviral and lentiviral vector gene transfer into human cells. Nucleic acids research, 10.1093 / nar / gksl446. 2023248167 13 Oct 2023 14. Reyon,D., Tsai,S.Q., Khayter,C., Foden,J. a, Sander,J.D. and JoungJ.K. (2012) FLASH assembly of TALENs for high-throughput genome editing. Nature Biotechnology, 30, 460465. 15. Qiu,P., Shandilya,H., D’Alessio,J.M., O’Connor,K., Durocher,J. and Gerard,G.F. (2004) 5 Mutation detection using Surveyor nuclease. BioTechniques, 36, 702-7. 16. Mali,P., Yang,L., Esvelt,K.M., Aach,J., Guell,M., DiCarlo,J.E., Norville,J.E. and Church,G.M. (2013) RNA-guided human genome engineering via Cas9. Science (New York, N.Y.), 339, 823-6. 17. Ding,Q., Regan,S.N., Xia,Y., Oostrom,L.A., Cowan,C.A. and Musunuru,K. (2013) Enhanced 10 Efficiency of Human Pluripotent Stem Cell Genome Editing through Replacing TALENs with CRISPRs. Cell Stem Cell, 12, 393-394. 18. Cong,L., Ran,F.A., Cox,D., Lin,S., Barretto,R., Habib,N., Hsu,P.D., Wu,X., Jiang,W., Marraffini,L. a, et al. (2013) Multiplex genome engineering using CRISPR / Cas systems. Science (New York, N.Y.), 339, 819-23. 15 19. Cho,S.W„ Kim,S., Kim,J.M. and Kim,J.-S. (2013) Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nature biotechnology, 31, 230-232. 20. Hwang,W.Y., Fu,Y., Reyon,D., Maeder,M.L., Tsai,S.Q., Sander,J.D., Peterson,R.T., Yeh,L-R.J. and JoungJ.K. (2013) Efficient genome editing in zebrafish using a CRISPR-Cas system. Nature biotechnology, 31, 227-229. 20 21. Chen,F., Pruett-Miller,S.M., Huang,Y., Gjoka,M., Duda,K., Taunton,J., Collingwood,T.N., Frodin,M. and Davis,G.D. (2011) High-frequency genome editing using ssDNA oligonucleotides with zinc-finger nucleases. Nature methods, 8, 753-5. 22. Soldner,F., LaganiereJ., Cheng,A.W., Hockemeyer,D., Gao,Q., Alagappan,R., Khurana,V., Golbe,L.L, Myers,R.H., Lindquist,S., et al. (2011) Generation of isogenic pluripotent stem 25 cells differing exclusively at two early onset Parkinson point mutations. Cell, 146, 318-31. 23. Valamehr,B., Abujarour,R., Robinson,M., Le,T., Robbins,D., Shoemaker,D. and Flynn,P. (2012) A novel platform to enable the high-throughput derivation and characterization of feeder-free human iPSCs. Scientific reports, 2, 213. 2023248167 13 Oct 2023 24. Sanjana,N.E., Cong,L., Zhou,Y., Cunniff,M.M., Feng,G. and Zhang,F. (2012) A transcription activator-like effector toolbox for genome engineering. Nature protocols, 7, 171-92. 25. Gibson,D.G., Young,L., Chuang,R., Venter,J.C., Iii,C.A.H., Smith,H.O. and America,N. (2009) Enzymatic assembly of DNA molecules up to several hundred kilobases. 6, 12-16. 5 26. Zou,J., Maeder,M.L., Mali,P., Pruett-Miller,S.M., Thibodeau-Beganny,S., Chou,B.-K., Chen,G., Ye,Z., Park,I.-H., Daley,G.Q., et al. (2009) Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells. Cell stem cell, 5, 97-110. 27. Perez,E.E., Wang,J., Miller,J.C., Jouvenot,Y., Kim,K. a, Liu,0., Wang,N., Lee,G., Bartsevich,V. V, Lee,Y.-L., et al. (2008) Establishment of HIV-1 resistance in CD4+ T cells 10 by genome editing using zinc-finger nucleases. Nature biotechnology, 26, 808-16. 28. Bhakta,M.S., Henry,I.M., Ousterout,D.G., Das,K.T., Lockwood,S.H., Meckler,J.F., Wallen,M.C., Zykovich,A„ Yu,Y., L.co,H., et al. (2013) Highly active zinc-finger nucleases by extended modular assembly. Genome research, 10.1101 / gr. 143693.112. 29. Kim,E., Kim,S., Kim,D.H., Choi,B.-S., Choi,I.-Y. and Kirn,J.-S. (2012) Precision genome 15 engineering with programmable DNA-nicking enzymes. Genome research, 22, 1327-33. 30. Gupta,A,rMeng,X., Zhu,L.L, Lawson,N.D. and Wolfe,S. a (2011) Zinc finger proteindependent and -independent contributions to the in vivo off-target activity of zinc finger nucleases. Nucleic acids research, 39, 381-92. 31. Park,I.-H., Lerou,P.H., Zhao,R., Huo,H. and Daley,G.Q. (2008) Generation of human-induced 20 pluripotent stem cells. Nature protocols, 3, 1180-6. 32. Cennak,T., Doyle,E.L., Christian,M., Wang,L., Zhang,Y., Schmidt,C., Baller,J.A., Somia,N. V, Bogdanove,A.J. and Voytas,D.F. (2011) Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic acids research, 39, e82. 33. Briggs,A.W., Rios,X., Chari,R., Yang,L., Zhang,F., Mali,P. and Church,G.M. (2012) Iterative 25 capped assembly: rapid and scalable synthesis of repeat-module DNA such as TAL effectors from individual monomers. Nucleic acids research, 10.1093 / nar / gks624. 34. Zhang,F., Cong,L., Lodato,S., Kosuri,S., Church,G.M. and Arlotta,P. (2011) LETTErs Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. 29, 149-154. 2023248167 13 Oct 2023 35. Pathak,V.K. and Temin,H.M. (1990) Broad spectrum of in vivo forward mutations, hypemiutations, and mutational hotspots in a retroviral shuttle vector after a single replication cycle: substitutions, frameshifts, and hypermutations. Proceedings of the National Academy of Sciences of the United States of America, 87, 6019-23. 5 36. Tian,J., Ma,K. and SaaemJ. (2009) Advancing high-throughput gene synthesis technology. Molecular bioSystems, 5, 714-22. 37. Zou,J., Mali,P., Huang,X., Dowey,S.N. and Cheng,L. (2011) Site-specific gene correction of a point mutation in human iPS cells derived from an adult patient with sickle cell disease. Blood, 118, 4599-608. 10 38. Mali,P., Yang,L., Esvelt,K.M., Aach,J., Guell,M., Dicarlo,J.E., Norville,J.E. and Church,G.M. (2013) RNA-Guided Human Genome. 39. Boyle,A.P., Davis,S., Shulha,H.P., Meltzer,P., Margulies,E.H., Weng,Z., Furey,T.S. and Crawford,G.E. (2008) High-resolution mapping and characterization of open chromatin across the genome. Cell, 132, 311-22. 15 40. Orlando,S.J., Santiago,Y., DeKeiver,R.C., Freyvert,Y., Boydston,E. a, Moehle,E. a, Choi,V.M., GopalamS.M., LouJ.F., Li,J., et al. (2010) Zinc-finger nuclease-driven targeted integration into mammalian genomes using donors with limited chromosomal homology. Nucleic acids research, 38, el52. 41. Wang,Z., Zhou,Z.-J., Liu,D.-P. and Huang,J.-D. (2008) Double-stranded break can be repaired 20 by single-stranded oligonucleotides via the ATM / ATR pathway in mammalian cells. Oligonucleotides, 18,21-32. 42. Rios,X., Briggs,A.W., Christodoulou,D., Gorham,J.M., Seidman,J.G. and Church,G.M. (2012) Stable gene targeting in human cells using single-strand oligonucleotides with modified bases. PloS one, 7, e36697. 25 43. Elliott,B., Richardson,C., WinderbaumJ., Jac,A., Jasin,M. andNickoloff,J.A.C.A. (1998) Gene Conversion Tracts from Double-Strand Break Repair in Mammalian Cells Gene Conversion Tracts from Double-Strand Break Repair in Mammalian Cells. 18. 44. Lombardo,A., Genovese,P., Beausejour,C.M., Colleoni,S., Lee,Y.-L., Kim,K. a, Ando,D., Umov,F.D., Galli,C., Gregory,P.D., et al. (2007) Gene editing in human stem cells using zinc 2023248167 13 Oct 2023 finger nucleases and integrase-defective lentiviral vector delivery. Nature biotechnology, 25, 1298-306. 45. Jinek,M., Chylinski,K., Fonfara,!., Hauer,M., DoudnaJ. a and Charpentier,E. (2012) A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 5 (New York, N.Y.), 337, 816-21. 46. Shrivastav,M., De Haro,L.P. and Nickoloff,J. a (2008) Regulation of DNA double-strand break repair pathway choice. Cell research, 18, 134-47. 47. Kim,Y.G., Cha,J. and Chandrasegaran,S. (1996) Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain. Proceedings of the National Academy of Sciences of the 10 United States of America, 93, 1156-60. 48. Mimitou,E.P. and Symington,L.S. (2008) Sae2, Exol and Sgsl collaborate in DNA doublestrand break processing. Nature, 455, 770—4. 49. Doyon,Y., Choi,V.M., Xia,D.F., Vo,T.D., Gregory,P.D. and Holmes,M.C. (2010) Transient cold shock enhances zinc-finger nuclease-mediated gene disruption. Nature methods, 7, 459 15 60.
Claims
1. A method of altering target DNA in a cell comprisingintroducing into a cell a TALEN lacking repeat sequences 100 bp or longer wherein the 5 TALEN cleaves the target DNA and the cell undergoes nonhomologous end joining to produce altered DNA in the cell.
2. The method of claim 1 wherein the TALEN lacks repeat sequences 90 bp or longer.10 3. The method of claim 1 wherein the TALEN lacks repeat sequences 80 bp or longer.
4. The method of claim 1 wherein the TALEN lacks repeat sequences 70 bp or longer.
5. The method of claim 1 wherein the TALEN lacks repeat sequences 60 bp or longer.
156. The method of claim 1 wherein the TALEN lacks repeat sequences 50 bp or longer.
7. The method of claim 1 wherein the TALEN lacks repeat sequences 40 bp or longer.20 8. The method of claim 1 wherein the TALEN lacks repeat sequences 30 bp or longer.
9. The method of claim 1 wherein the TALEN lacks repeat sequences 20 bp or longer.
10. The method of claim 1 wherein the TALEN lacks repeat sequences 19 bp or longer.2511. The method of claim 1 wherein the TALEN lacks repeat sequences 18 bp or longer.
12. The method of claim 1 wherein the TALEN lacks repeat sequences 17 bp or longer.30 13. The method of claim 1 wherein the TALEN lacks repeat sequences 16 bp or longer.
14. The method of claim 1 wherein the TALEN lacks repeat sequences 15 bp or longer.
15. The method of claim 1 wherein the TALEN lacks repeat sequences 14 bp or longer.3516. The method of claim 1 wherein the TALEN lacks repeat sequences 13 bp or longer.2023248167 13 Oct 202317. The method of claim 1 wherein the TALEN lacks repeat sequences 12 bp or longer.
18. The method of claim 1 wherein the TALEN lacks repeat sequences 11 bp or longer.5 19. The method of claim 1 wherein the TALEN lacks repeat sequences 10 bp or longer.
20. The method of claim 1 wherein the cell is a eukaryotic cell.
21. The method of claim 1 wherein the cell is a yeast cell, a plant cell or an animal cell. 1022. The method of claim 1 wherein the cell is a somatic cell.
23. The method of claim 1 wherein the cell is a stem cell.15 24. The method of claim 1 wherein the cell is a human stem cell.
25. The method of claim 1 comprisingintroducing into the cell a first foreign nucleic acid encoding the TALEN, wherein the TALEN is expressed, and20 wherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
26. The method of claim 1 comprising introducing into the cell a virus including a first foreign nucleic acid encoding the TALEN, wherein the TALEN is expressed, and25 wherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
27. The method of claim 1 comprisingintroducing into the cell a first foreign nucleic acid encoding the TALEN having a TALE sequence30 CTAACCCCTGAACAGGTAGTCGCTATAGCTTCAAATATCGGGGGCAAGCAAGCACTTGAGACCGTTCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCG GAGCAAGTCGTCGCGATCGCGAGCAACGGCGGGGGGAAGCAGGCGCTGGAAACTGTT CAGAGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAGGTTGTCG CAATAGCAAGTAATATAGGCGGTAAGCAAGCCCTAGAGACTGTGCAACGCCTGCTCC35 CCGTGCTGTGTCAGGCTCACGGTCTGACACCTGAACAAGTTGTCGCGATAGCCAGTCACGACGGGGGAAAACAAGCTCTAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAA2023248167 13 Oct 2023GCACATGGGTTAACACCCGAACAAGTAGTAGCGATAGCGTCAAATAACGGGGGTAAA CAGGCTTTGGAGACGGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTA CGCCAGAACAGGTGGTTGCAATTGCCTCCAACATCGGCGGGAAACAAGCGTTGGAAA CTGTGCAGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAGGTT5 GTGGCCATCGCTAGCCACGACGGAGGGAAGCAGGCTCTTGAAACCGTACAGCGACTTCTCCCAGTTTTGTGCCAAGCTCACGGGCTAACCCCCGAGCAAGTAGTTGCCATAGCAA GCAACGGAGGAGGAAAACAGGCATTAGAAACAGTTCAGCGCTTGCTCCCGGTACTCT GTCAGGCACACGGTCTAACTCCGGAACAGGTCGTAGCCATTGCTTCCCATGATGGCGG CAAACAGGCGCTAGAGACAGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGC 10 CTCACCCCGGAGCAGGTCGTTGCCATCGCCAGTAATATCGGCGGAAAGCAAGCTCTCGAAACAGTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCA GGTAGTGGCAATCGCATCTCACGATGGAGGTAAACAAGCACTCGAGACTGTCCAAAG ATTGTTACCCGTACTATGCCAAGCGCATGGTTTAACCCCAGAGCAAGTTGTGGCTATT GCATCTAACGGCGGTGGCAAACAAGCCTTGGAGACAGTGCAACGATTACTGCCTGTCT15 TATGTCAGGCCCATGGCCTTACTCCTGAGCAAGTCGTAGCTATCGCCAGCAACATAGGTGGGAAACAGGCCCTGGAAACCGTACAACGTCTCCTCCCAGTACTTTGTCAAGCACAC GGGTTGACACCGGAACAAGTGGTGGCGATTGCGTCCAACGGCGGAGGCAAGCAGGCA CTGGAGACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAG AGCAGGTGGTAGCAATAGCGTCGAACATCGGTGGTAAGCAAGCGCTTGAAACGGTCC20 AGCGTCTTCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACCAGAACAAGTGGTTGCTATTGCTAGTAACAACGGTGGAAAGCAGGCCCTCGAGACGGTGCAGAGGTTACTTCCC GTCCTCTGTCAAGCGCACGGCCTCACTCCAGAGCAAGTGGTTGCGATCGCTTCAAACA ATGGTGGAAGACCTGCCCTGGAA,or a sequence having at least 90% sequence identity to the TALE sequence,25 wherein the TALEN is expressed, andwherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
28. The method of claim 1 comprisingintroducing into the cell a virus including a first foreign nucleic acid encoding the TALEN30 having a TALE sequenceCTAACCCCTGAACAGGTAGTCGCTATAGCTTCAAATATCGGGGGCAAGCAAGCACTTGAGACCGTTCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCGGAGCAAGTCGTCGCGATCGCGAGCAACGGCGGGGGGAAGCAGGCGCTGGAAACTGTTCAGAGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAGGTTGTCG35 CAATAGCAAGTAATATAGGCGGTAAGCAAGCCCTAGAGACTGTGCAACGCCTGCTCCCCGTGCTGTGTCAGGCTCACGGTCTGACACCTGAACAAGTTGTCGCGATAGCCAGTCA2023248167 13 Oct 2023CGACGGGGGAAAACAAGCTCTAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAA GCACATGGGTTAACACCCGAACAAGTAGTAGCGATAGCGTCAAATAACGGGGGTAAA CAGGCTTTGGAGACGGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTA CGCCAGAACAGGTGGTTGCAATTGCCTCCAACATCGGCGGGAAACAAGCGTTGGAAA5 CTGTGCAGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAGGTTGTGGCCATCGCTAGCCACGACGGAGGGAAGCAGGCTCTTGAAACCGTACAGCGACTT CTCCCAGTTTTGTGCCAAGCTCACGGGCTAACCCCCGAGCAAGTAGTTGCCATAGCAA GCAACGGAGGAGGAAAACAGGCATTAGAAACAGTTCAGCGCTTGCTCCCGGTACTCT GTCAGGCACACGGTCTAACTCCGGAACAGGTCGTAGCCATTGCTTCCCATGATGGCGG10 CAAACAGGCGCTAGAGACAGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGCCTCACCCCGGAGCAGGTCGTTGCCATCGCCAGTAATATCGGCGGAAAGCAAGCTCTCG AAACAGTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCA GGTAGTGGCAATCGCATCTCACGATGGAGGTAAACAAGCACTCGAGACTGTCCAAAG ATTGTTACCCGTACTATGCCAAGCGCATGGTTTAACCCCAGAGCAAGTTGTGGCTATT15 GCATCTAACGGCGGTGGCAAACAAGCCTTGGAGACAGTGCAACGATTACTGCCTGTCTTATGTCAGGCCCATGGCCTTACTCCTGAGCAAGTCGTAGCTATCGCCAGCAACATAGG TGGGAAACAGGCCCTGGAAACCGTACAACGTCTCCTCCCAGTACTTTGTCAAGCACAC GGGTTGACACCGGAACAAGTGGTGGCGATTGCGTCCAACGGCGGAGGCAAGCAGGCA CTGGAGACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAG20 AGCAGGTGGTAGCAATAGCGTCGAACATCGGTGGTAAGCAAGCGCTTGAAACGGTCCAGCGTCTTCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACCAGAACAAGTGGTTGC TATTGCTAGTAACAACGGTGGAAAGCAGGCCCTCGAGACGGTGCAGAGGTTACTTCCC GTCCTCTGTCAAGCGCACGGCCTCACTCCAGAGCAAGTGGTTGCGATCGCTTCAAACA ATGGTGGAAGACCTGCCCTGGAA,25 or a sequence having at least 90% sequence identity to the TALE sequence,wherein the TALEN is expressed, and wherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
29. A method of altering target DNA in a cell comprising30 combining within a cell a TALEN lacking repeat sequences 100 bp or longer and a donornucleic acid sequence wherein the TALEN cleaves the target DNA and the donor nucleic acid sequence is inserted into the DNA in the cell.
30. The method of claim 29 wherein the cell undergoes nonhomologous end joining to produce35 altered DNA in the cell.2023248167 13 Oct 202331. The method of claim 29 wherein the cell undergoes homologous recombination to produced altered DNA in the cell.
32. The method of claim 29 wherein the TALEN lacks repeat sequences 90 bp or longer.
533. The method of claim 29 wherein the TALEN lacks repeat sequences 80 bp or longer.
34. The method of claim 29 wherein the TALEN lacks repeat sequences 70 bp or longer.10 35. The method of claim 29 wherein the TALEN lacks repeat sequences 60 bp or longer.
36. The method of claim 29 wherein the TALEN lacks repeat sequences 50 bp or longer.
37. The method of claim 29 wherein the TALEN lacks repeat sequences 40 bp or longer.1538. The method of claim 29 wherein the TALEN lacks repeat sequences 30 bp or longer.
39. The method of claim 29 wherein the TALEN lacks repeat sequences 20 bp or longer.20 40. The method of claim 29 wherein the TALEN lacks repeat sequences 19 bp or longer.
41. The method of claim 29 wherein the TALEN lacks repeat sequences 18 bp or longer.
42. The method of claim 29 wherein the TALEN lacks repeat sequences 17 bp or longer.2543. The method of claim 29 wherein the TALEN lacks repeat sequences 16 bp or longer.
44. The method of claim 29 wherein the TALEN lacks repeat sequences 15 bp or longer.30 45. The method of claim 29 wherein the TALEN lacks repeat sequences 14 bp or longer.
46. The method of claim 29 wherein the TALEN lacks repeat sequences 13 bp or longer.
47. The method of claim 29 wherein the TALEN lacks repeat sequences 12 bp or longer.3548. The method of claim 29 wherein the TALEN lacks repeat sequences 11 bp or longer.2023248167 13 Oct 202348. The method of claim 29 wherein the TALEN lacks repeat sequences 10 bp or longer.
50. The method of claim 29 wherein the cell is a eukaryotic cell.5 51. The method of claim 29 wherein the cell is a yeast cell, a plant cell or an animal cell.
52. The method of claim 29 wherein the cell is a somatic cell.
53. The method of claim 29 wherein the cell is a stem cell.1054. The method of claim 29 wherein the cell is a human stem cell.
55. The method of claim 29 comprisingintroducing into the cell a first foreign nucleic acid encoding the TALEN,15 wherein the TALEN is expressed, andwherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
56. The method of claim 29 comprisingintroducing into the cell a virus including a first foreign nucleic acid encoding the TALEN, 20 wherein the TALEN is expressed, andwherein the TALEN cleaves the target DNA to produce altered DNA in the cell.
57. The method of claim 29 comprisingintroducing into the cell a first foreign nucleic acid encoding the TALEN having a TALE25 sequenceCTAACCCCTGAACAGGTAGTCGCTATAGCTTCAAATATCGGGGGCAAGCAAGC ACTTGAGACCGTTCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCG GAGCAAGTCGTCGCGATCGCGAGCAACGGCGGGGGGAAGCAGGCGCTGGAAACTGTT CAGAGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAGGTTGTCG 30 CAATAGCAAGTAATATAGGCGGTAAGCAAGCCCTAGAGACTGTGCAACGCCTGCTCC CCGTGCTGTGTCAGGCTCACGGTCTGACACCTGAACAAGTTGTCGCGATAGCCAGTCA CGACGGGGGAAAACAAGCTCTAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAA GCACATGGGTTAACACCCGAACAAGTAGTAGCGATAGCGTCAAATAACGGGGGTAAA CAGGCTTTGGAGACGGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTA 35 CGCCAGAACAGGTGGTTGCAATTGCCTCCAACATCGGCGGGAAACAAGCGTTGGAAA2023248167 13 Oct 2023CTGTGCAGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAGGTT GTGGCCATCGCTAGCCACGACGGAGGGAAGCAGGCTCTTGAAACCGTACAGCGACTT CTCCCAGTTTTGTGCCAAGCTCACGGGCTAACCCCCGAGCAAGTAGTTGCCATAGCAA GCAACGGAGGAGGAAAACAGGCATTAGAAACAGTTCAGCGCTTGCTCCCGGTACTCT5 GTCAGGCACACGGTCTAACTCCGGAACAGGTCGTAGCCATTGCTTCCCATGATGGCGGCAAACAGGCGCTAGAGACAGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGC CTCACCCCGGAGCAGGTCGTTGCCATCGCCAGTAATATCGGCGGAAAGCAAGCTCTCG AAACAGTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCA GGTAGTGGCAATCGCATCTCACGATGGAGGTAAACAAGCACTCGAGACTGTCCAAAG10 ATTGTTACCCGTACTATGCCAAGCGCATGGTTTAACCCCAGAGCAAGTTGTGGCTATTGCATCTAACGGCGGTGGCAAACAAGCCTTGGAGACAGTGCAACGATTACTGCCTGTCT TATGTCAGGCCCATGGCCTTACTCCTGAGCAAGTCGTAGCTATCGCCAGCAACATAGG TGGGAAACAGGCCCTGGAAACCGTACAACGTCTCCTCCCAGTACTTTGTCAAGCACAC GGGTTGACACCGGAACAAGTGGTGGCGATTGCGTCCAACGGCGGAGGCAAGCAGGCA15 CTGGAGACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAG AGCAGGTGGTAGCAATAGCGTCGAACATCGGTGGTAAGCAAGCGCTTGAAACGGTCC AGCGTCTTCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACCAGAACAAGTGGTTGCTATTGCTAGTAACAACGGTGGAAAGCAGGCCCTCGAGACGGTGCAGAGGTTACTTCCC GTCCTCTGTCAAGCGCACGGCCTCACTCCAGAGCAAGTGGTTGCGATCGCTTCAAACA20 ATGGTGGAAGACCTGCCCTGGAA,or a sequence having at least 90% sequence identity to the TALE sequence, wherein the TALEN is expressed, and wherein the TALEN cleaves the target DNA to produce altered DNA in the cell.25 58. The method of claim 29 comprisingintroducing into the cell a virus including a first foreign nucleic acid encoding the TALEN having a TALE sequenceCTAACCCCTGAACAGGTAGTCGCTATAGCTTCAAATATCGGGGGCAAGCAAGC ACTTGAGACCGTTCAACGACTCCTGCCAGTGCTCTGCCAAGCCCATGGATTGACTCCG30 GAGCAAGTCGTCGCGATCGCGAGCAACGGCGGGGGGAAGCAGGCGCTGGAAACTGTTCAGAGACTGCTGCCTGTACTTTGTCAGGCGCATGGTCTCACCCCCGAACAGGTTGTCG CAATAGCAAGTAATATAGGCGGTAAGCAAGCCCTAGAGACTGTGCAACGCCTGCTCC CCGTGCTGTGTCAGGCTCACGGTCTGACACCTGAACAAGTTGTCGCGATAGCCAGTCA CGACGGGGGAAAACAAGCTCTAGAAACGGTTCAAAGGTTGTTGCCCGTTCTGTGCCAA 35 GCACATGGGTTAACACCCGAACAAGTAGTAGCGATAGCGTCAAATAACGGGGGTAAACAGGCTTTGGAGACGGTACAGCGGTTATTGCCGGTCCTCTGCCAGGCCCACGGACTTA2023248167 13 Oct 2023CGCCAGAACAGGTGGTTGCAATTGCCTCCAACATCGGCGGGAAACAAGCGTTGGAAA CTGTGCAGAGACTCCTTCCTGTTTTGTGTCAAGCCCACGGCTTGACGCCTGAGCAGGTT GTGGCCATCGCTAGCCACGACGGAGGGAAGCAGGCTCTTGAAACCGTACAGCGACTT CTCCCAGTTTTGTGCCAAGCTCACGGGCTAACCCCCGAGCAAGTAGTTGCCATAGCAA5 GCAACGGAGGAGGAAAACAGGCATTAGAAACAGTTCAGCGCTTGCTCCCGGTACTCTGTCAGGCACACGGTCTAACTCCGGAACAGGTCGTAGCCATTGCTTCCCATGATGGCGG CAAACAGGCGCTAGAGACAGTCCAGAGGCTCTTGCCTGTGTTATGCCAGGCACATGGC CTCACCCCGGAGCAGGTCGTTGCCATCGCCAGTAATATCGGCGGAAAGCAAGCTCTCG AAACAGTACAACGGCTGTTGCCAGTCCTATGTCAAGCTCATGGACTGACGCCCGAGCA 10 GGTAGTGGCAATCGCATCTCACGATGGAGGTAAACAAGCACTCGAGACTGTCCAAAGATTGTTACCCGTACTATGCCAAGCGCATGGTTTAACCCCAGAGCAAGTTGTGGCTATT GCATCTAACGGCGGTGGCAAACAAGCCTTGGAGACAGTGCAACGATTACTGCCTGTCT TATGTCAGGCCCATGGCCTTACTCCTGAGCAAGTCGTAGCTATCGCCAGCAACATAGG TGGGAAACAGGCCCTGGAAACCGTACAACGTCTCCTCCCAGTACTTTGTCAAGCACAC15 GGGTTGACACCGGAACAAGTGGTGGCGATTGCGTCCAACGGCGGAGGCAAGCAGGCACTGGAGACCGTCCAACGGCTTCTTCCGGTTCTTTGCCAGGCTCATGGGCTCACGCCAG AGCAGGTGGTAGCAATAGCGTCGAACATCGGTGGTAAGCAAGCGCTTGAAACGGTCC AGCGTCTTCTGCCGGTGTTGTGCCAGGCGCACGGACTCACACCAGAACAAGTGGTTGC TATTGCTAGTAACAACGGTGGAAAGCAGGCCCTCGAGACGGTGCAGAGGTTACTTCCC20 GTCCTCTGTCAAGCGCACGGCCTCACTCCAGAGCAAGTGGTTGCGATCGCTTCAAACAATGGTGGAAGACCTGCCCTGGAA,or a sequence having at least 90% sequence identity to the TALE sequence, wherein the TALEN is expressed, and wherein the TALEN cleaves the target DNA to produce altered DNA in the cell.2559. A virus including a nucleic acid sequence encoding a TALEN lacking repeat sequences 100 bp or longer.
60. The virus of claim 59 wherein the TALEN lacks repeat sequences 90 bp or longer.3061. The virus of claim 59 wherein the TALEN lacks repeat sequences 80 bp or longer.
62. The virus of claim 59 wherein the TALEN lacks repeat sequences 70 bp or longer.35 63. The virus of claim 59 wherein the TALEN lacks repeat sequences 60 bp or longer.2023248167 13 Oct 202364. The virus of claim 59 wherein the TALEN lacks repeat sequences 50 bp or longer.
65. The virus of claim 59 wherein the TALEN lacks repeat sequences 40 bp or longer.5 66. The virus of claim 59 wherein the TALEN lacks repeat sequences 30 bp or longer.
67. The virus of claim 59 wherein the TALEN lacks repeat sequences 20 bp or longer.
68. The virus of claim 59 wherein the TALEN lacks repeat sequences 19 bp or longer.1069. The virus of claim 59 wherein the TALEN lacks repeat sequences 18 bp or longer.
70. The virus of claim 59 wherein the TALEN lacks repeat sequences 17 bp or longer.15 71. The virus of claim 59 wherein the TALEN lacks repeat sequences 16 bp or longer.
72. The virus of claim 59 wherein the TALEN lacks repeat sequences 15 bp or longer.
73. The virus of claim 59 wherein the TALEN lacks repeat sequences 14 bp or longer.2074. The virus of claim 59 wherein the TALEN lacks repeat sequences 13 bp or longer.
75. The virus of claim 59 wherein the TALEN lacks repeat sequences 12 bp or longer.25 76. The virus of claim 59 wherein the TALEN lacks repeat sequences 11 bp or longer.
77. The virus of claim 59 wherein the TALEN lacks repeat sequences 10 bp or longer.
78. The virus of claim 59 being a lentivirus.3079. A cell including a nucleic acid sequence encoding a TALEN lacking repeat sequences 100 bp or longer.
80. The cell of claim 70 wherein the TALEN lacks repeat sequences 90 bp or longer.3581. The cell of claim 70 wherein the TALEN lacks repeat sequences 80 bp or longer.2023248167 13 Oct 202382. The cell of claim 70 wherein the TALEN lacks repeat sequences 70 bp or longer.
83. The cell of claim 70 wherein the TALEN lacks repeat sequences 60 bp or longer.5 84. The cell of claim 70 wherein the TALEN lacks repeat sequences 50 bp or longer.
85. The cell of claim 70 wherein the TALEN lacks repeat sequences 40 bp or longer.
86. The cell of claim 70 wherein the TALEN lacks repeat sequences 30 bp or longer.
87. The cell of claim 70 wherein the TALEN lacks repeat sequences 20 bp or longer.
88. The cell of claim 70 wherein the TALEN lacks repeat sequences 19 bp or longer.15 89. The cell of claim 70 wherein the TALEN lacks repeat sequences 18 bp or longer.
90. The cell of claim 70 wherein the TALEN lacks repeat sequences 17 bp or longer.
91. The cell of claim 70 wherein the TALEN lacks repeat sequences 16 bp or longer.
92. The cell of claim 70 wherein the TALEN lacks repeat sequences 15 bp or longer.
93. The cell of claim 70 wherein the TALEN lacks repeat sequences 14 bp or longer.25 94. The cell of claim 70 wherein the TALEN lacks repeat sequences 13 bp or longer.
95. The cell of claim 70 wherein the TALEN lacks repeat sequences 12 bp or longer.
96. The cell of claim 70 wherein the TALEN lacks repeat sequences 11 bp or longer.
97. The cell of claim 70 wherein the TALEN lacks repeat sequences 10 bp or longer98. The cell of claim 70 being a eukaryotic cell.35 99. The cell of claim 70 being a yeast cell, a plant cell or an animal cell.2023248167 13 Oct 2023100. The cell of claim 70 being a somatic cell.
101. The cell of claim 70 being a stem cell.5 102. The cell of claim 70 being a human stem cell.
103. A method of making a TALE comprisingcombining an endonuclease, a DNA polymerase, a DNA ligase, an exonuclease, a plurality of nucleic acid dimer blocks encoding repeat variable diresidue domains and a TALE-N / TF 10 backbone vector including an endonuclease cutting site,activating the endonuclease to cut the TALE-N / TF backbone vector at the endonuclease cutting site to produce a first end and a second end,activating the exonuclease to create a 3’ and a 5’ overhang on the TALE-N / TF backbone vector and the plurality of nucleic acid dimer blocks and to anneal the TALE-N / TF backbone 15 vector and the plurality of nucleic acid dimer blocks in a desired order,activating the DNA polymerase and the DNA ligase to connect the TALE-N / TF backbone vector and the plurality of nucleic acid dimer blocks.
104. A method of altering target DNA in a stem cell expressing an enzyme that forms a co-20 localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner comprising(a) introducing into the stem cell a first foreign nucleic acid encoding an RNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA,25 introducing into the stem cell a second foreign nucleic acid encoding a donor nucleic acidsequence,wherein the RNA and the donor nucleic acid sequences are expressed,wherein the RNA and the enzyme co-localize to the target DNA, the enzyme cleaves the target DNA and the donor nucleic acid is inserted into the target DNA to produce altered DNA in 30 the stem cell.
105. The method of claim 104 wherein the enzyme is an RNA-guided DNA binding protein.
106. The method of claim 104 wherein the enzyme is an RNA-guided DNA binding protein of a35 Type IICRISPR system.2023248167 13 Oct 2023107. The method of claim 104 wherein the enzyme is Cas9.
108. The method of claim 104 wherein the RNA is between about 10 to about 500 nucleotides.5 109. The method of claim 104 wherein the RNA is between about 20 to about 100 nucleotides.
110. The method of claim 104 wherein the RNA is a guide RNA.
111. The method of claim 104 wherein the RNA is a tracrRNA-crRNA fusion.10112. The method of claim 104 wherein the DNA is genomic DNA, mitochondrial DNA, viral DNA, or exogenous DNA.
113. The method of claim 104 wherein the donor nucleic acid sequence is inserted by 15 recombination.
114. The method of claim 104 wherein the donor nucleic acid sequence is inserted by homologous recombination.20 115. The method of claim 104 wherein the donor nucleic acid sequence is inserted bynonhomologous end joining.
116. The method of claim 104 wherein the RNA and the donor nucleic acid sequences are present on one or more plasmids.25117. The method of claim 104 further comprising repeating step (a) multiple times to produce multiple alterations to the DNA in the cell.
118. The method of claim 104 wherein after producing altered DNA in a stem cell, a nucleic 30 acid encoding the enzyme that forms a co-localization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner is removed from the stem cell genome.
119. The method of claim 104 wherein the RNA and the donor nucleic acid sequences are 35 expressed as a bound nucleic acid sequence.2023248167 13 Oct 2023120. A stem cell including a first foreign nucleic acid encoding for an enzyme that forms a colocalization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner.5 121. The stem cell of claim 120 further including a second foreign nucleic acid encoding for anRNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA.
122. The stem cell of claim 121 further including a third foreign nucleic acid encoding a donor 10 nucleic acid sequence.
123. The stem cell of claim 120 further including an inducible promoter for promoting expression of the enzyme.15 124. The stem cell of claim 120 wherein the first foreign nucleic acid is removable fromgenomic DNA of the cell using a transposase.
125. The stem cell of claim 120 wherein the enzyme is an RNA-guided DNA binding protein.20 126. The stem cell of claim 120 wherein the enzyme is an RNA-guided DNA binding protein ofa Type IICRISPR system.
127. The stem cell of claim 120 wherein the enzyme is Cas9.25 128. The stem cell of claim 120 wherein the RNA is between about 10 to about 500 nucleotides.
129. The stem cell of claim 120 wherein the RNA is between about 20 to about 100 nucleotides.
130. The stem cell of claim 120 wherein the RNA is a guide RNA.30131. The stem cell of claim 120 wherein the RNA is a tracrRNA-crRNA fusion.
132. The stem cell of claim 120 wherein the target DNA is genomic DNA, mitochondrial DNA,viral DNA, or exogenous DNA.2023248167 13 Oct 2023133. A cell including a first foreign nucleic acid encoding for an enzyme that forms a colocalization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner and including an inducible promoter for promoting expression of the enzyme.5134. The cell of claim 133 further including a second foreign nucleic acid encoding for an RNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA.
135. The stem cell of claim 134 further including a third foreign nucleic acid encoding a donor 10 nucleic acid sequence.
136. A cell including a first foreign nucleic acid encoding for an enzyme that forms a colocalization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner, wherein the first foreign nucleic acid is removable from genomic DNA of 15 the cell using a transposase.
137. The cell of claim 136 further including a second foreign nucleic acid encoding for an RNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA.20138. The stem cell of claim 137 further including a third foreign nucleic acid encoding a donor nucleic acid sequence.
139. A cell including a first foreign nucleic acid encoding for an enzyme that forms a co-25 localization complex with RNA complementary to target DNA and that cleaves the target DNA in a site specific manner, wherein the first foreign nucleic acid is reversibly inserted into genomic DNA of the cell.
140. The cell of claim 139 further including a second foreign nucleic acid encoding for an RNA 30 complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA.
141. The stem cell of claim 140 further including a third foreign nucleic acid encoding a donor nucleic acid sequence.352023248167 13 Oct 2023142. A method of altering target DNA in a cell expressing an enzyme that forms a colocalization complex with RNA complementary to the target DNA and that cleaves the target DNA in a site specific manner comprising(a) introducing into the cell a first foreign nucleic acid encoding a donor nucleic acid 5 sequence,introducing into the cell from media surrounding the cell an RNA complementary to the target DNA and which guides the enzyme to the target DNA, wherein the RNA and the enzyme are members of a co-localization complex for the target DNA,wherein the donor nucleic acid sequence is expressed,10 wherein the RNA and the enzyme co-localize to the target DNA, the enzyme cleaves thetarget DNA and the donor nucleic acid is inserted into the target DNA to produce altered DNA in the cell.
143. The method of claim 142 wherein the RNA includes a 5’ Cap structure.15144. The method of claim 142 wherein the RNA lacks phosphate groups.
145. The method of claim 142 wherein the enzyme is an RNA-guided DNA binding protein.20 146. The method of claim 142 wherein the enzyme is an RNA-guided DNA binding protein of aType IICRISPR system.
147. The method of claim 142 wherein the enzyme is Cas9.25 148. The method of claim 142 wherein the RNA is between about 10 to about 500 nucleotides.
149. The method of claim 142 wherein the RNA is between about 20 to about 100 nucleotides.
150. The method of claim 142 wherein the RNA is a guide RNA.30151. The method of claim 142 wherein the RNA is a tracrRNA-crRNA fusion.
152. The method of claim 142 wherein the DNA is genomic DNA, mitochondrial DNA, viral DNA, or exogenous DNA.2023248167 13 Oct 2023153.The method of claim142recombination.wherein the donor nucleic acid sequence is inserted by154. The method of claim 142 wherein the donor nucleic acid sequence is inserted by 5 homologous recombination.
155. The method of claim 142 wherein the donor nucleic acid sequence is inserted by nonhomologous end joining.10 156. The method of claim 142 further comprising repeating step (a) multiple times to producemultiple alterations to the DNA in the cell.
157. The method of claim 142 wherein after producing altered DNA in a cell, a nucleic acid encoding the enzyme that forms a co-localization complex with RNA complementary to the target 15 DNA and that cleaves the target DNA in a site specific manner is removed from the cell genome.
158. The method of claim 142 wherein the RNA and the donor nucleic acid sequences are expressed as a bound nucleic acid sequence.