Integrin α7β1 antibodies and uses thereof
Patent Information
- Application Number
- AU2025234768
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-07-03
- Filing Date
- 2025-03-14
- Publication Date
- 2026-09-17
Smart Images

Figure 00000000_0000_ABST
Abstract
Description
[101] FIG. 8A is an exemplary crystal structure of the Ab2 heavy chain (orange) and light chain (yellow) in complex with a7 calf-1 (blue). FIG. 8B displays the biomolecular interactions within Ab2 Fab- a7 calf-1 complex. The calf-1 protein is blue and is shown with the Ab2 HCDR1 (pink), HCDR2 (orange), HCDR3 (green), and LCDR1 (yellow). FIG. 8C shows amino acid sequences of a7 protein, with epitope residues highlighted.
[102] FIG. 9 is an exemplary figure depicting a7pi structural model of a7 leg with epitope of Ab2 antibody possible epitope in spheres. The corresponding amino acid residues are highlighted in SEQ ID NO: 180. Residues highlighted in magenta (MAIPQQL, SEQ ID NO: 181; WRGERAMQSERDVGSKVKYEVT, SEQ ID NO: 182; FDRAAVL, SEQ ID NO: 183) illustrates one possible epitope, and the residues highlighted in red (LRTLGSAFL, SEQ ID NO: 184; WFSCPLYS, SEQ ID NO: 185) represents another possible epitope. The epitope residues are determined by hydrogen / deuterium exchange mass spectrometry.
[103] FIG. 10 is an exemplary figure showing the effect of activating conditions (i.e., conditions that stabilize the open conformation of integrin a7pi) on the cell binding of exemplary anti-a7pi antibodies of the present disclosure to human DMD myoblast cells.
[104] FIG. 11 is an exemplary figure showing the effect of activating conditions on the cell binding of exemplary mouse anti-a7pi compared to RefAbl.
[105] FIG. 12 is an exemplary bar graph showing the levels of creatine kinase (CKM), an indicator of muscle damage, after acute treadmill running in a mouse mdx model with and without application of an exemplary anti-a7pi antibody.
[106] FIG. 13 is an exemplary figure showing the dose response of CKM and LDH to application of exemplary anti-a7pi antibody Ab8 .
[107] FIG. 14 displays the biological processes upregulated by application of an exemplary anti-a7pi antibody.
[108] FIG. 15 displays the biological processes downregulated by application of an exemplary anti-a7pi antibody.
[109] FIGs. 16A and 16B are series of exemplary graphs showing the increases in gene expression caused by application of exemplary anti-a7pi antibodies.
[110] FIG. 17 is an exemplary figure showing the running scores and total distance run for BlO.mdx mice after administration of exemplary anti-a7pi antibodies. [Ill] FIG. 18 is an exemplary figure showing the distance traveled, resting time, and horizontal beam break counts for MDX mice administered an exemplary anti-a7pi antibody.
[112] FIG. 19A is an exemplary figure showing the specific tetanus in the extensor digitorum longus of MDX mice treated with an exemplary a7pi antibody and controls. FIG. 19B shows the specific tetanus in the diaphragm of MDX mice treated with an exemplary a701 antibody and controls.
[113] FIG. 20 is an exemplary figure showing the results tracking body weight of MDX mice with or without administration of an exemplary anti-a7pi antibody.
[114] FIG. 21 is an exemplary figure showing the muscle fiber size from MDX mice with and without treatment with an exemplary anti-a7pi antibody.
[115] FIG. 22A is a series of exemplary graphs showing qPCR results tracking fibrosis markers in MDX mice after administration of an exemplary anti-a7pi antibody. FIG. 22B provides exemplary collagen 1 / III immunohistochemistry images of mice treated with PBS or Ab8 and quantitative positive collagen I / III area. Lower collagen is sign of less scar tissue and fibrosis, a visible difference that can be seen in the histology images.
[116] FIG. 23 is an exemplary schematic of a study design to assess attenuation of muscle atrophy by administration of an exemplary anti-a7pi antibody.
[117] FIG. 24 is a series of exemplary graphs showing the muscle weight of the gastrocnemius-soleus complex (Gastroc) after administration of an exemplary anti-a7pi antibody to C57BL / 6j mice in VIM. Disuse atrophy caused by VIM results in a loss of muscle weight in the Gastroc both absolutely and relative to bodyweight.
[118] FIG. 25 is a series of exemplary graphs showing expression of a7 after administration of an exemplary anti-a7pi antibody to C57BL / 6j mice in VIM as compared to an ambulatory control. DEFINITIONS
[119] In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.
[120] ‘‘Alleviate” and “ameliorate” means a process by which the severity of a sign or symptom of a disorder is decreased. Importantly, a sign or symptom can be alleviated without being eliminated. Therapeutically effective dosages are expected to decrease the severity of, and so alleviate and ameliorate, a sign or symptom of disease.
[121] As used herein, the term “affinity” refers to the characteristics of a binding interaction between a binding moiety (e.g., integrin a7pi antibody) and a target (e.g., a7pi) and that indicates the strength of the binding interaction. In some embodiments, the measure of affinity is expressed as a dissociation constant (KD).
[122] As used herein, the term “antibody” refers to a polypeptide that includes at least one immunoglobulin variable region, e.g., an amino acid sequence that provides an immunoglobulin variable domain or immunoglobulin variable domain sequence. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. An antibody typically includes three complementarity determining regions (abbr. CDRs) in the light chain of the immunoglobulin and three complementarity determining regions (CDRs) in the heavy chain of the immunoglobulin. The three CDRs in the light chain of the immunoglobulin are called, from the N-terminal side, CDR1, CDR2 and CDR3, respectively. The three CDRs in the heavy chain of the immunoglobulin are also called, from the N-terminal side, CDR1, CDR2 and CDR3, respectively. A “CDR” may be identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and / or conformational definitions or any method of CDR determination well known in the art. The term “antibody” encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab, F(ab')2, Fd, Fv, and dAb fragments) as well as complete antibodies, e.g., intact immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof). The light chains of the immunoglobulin can be of types kappa or lambda.
[123] As used herein, the term “M3 8 antibody” refers to a mouse anti-a7pi antibody that binds to S977, W978, W979 and P980 on a7 integrin, as described in described in WO2022240833A1, which is hereby incorporated by reference. In the present application “M3 8” is used interchangeably with “RefAb2.”
[124] As used herein, the term “20TFT antibody” refers to an anti-a7pi antibody that binds to S977, W978, W979 and P980 on a7 integrin, as described in described in WO 2021 / 097338 Al, which is hereby incorporated by reference. 20TFT antibody is humanized antibody of M3 8. In the present application “20TFT” is used interchangeably with “RefAbl.”
[125] As used herein, the term “EC50” refers to a half maximal effective concentration. The term EC50 refers to the concentration of a drug, antibody or toxicant which induces a response halfway between the baseline and maximum after a specified exposure time. More simply, EC50 can be defined as the concentration required to obtain a 50% of the desired effect.
[126] As used herein, the term “Fab” refers to an antibody fragment comprising a portion of an intact antibody, comprising the antigen-binding or variable region thereof.
[127] As used herein, the term “Fc region” refers to a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
[128] As used herein, the term “EC50” refers to the concentration needed to inhibit half of the maximum biological response of the ligand binding, and can be determined by celladhesion assay (CAA) or solid phase assay (SP).
[129] As used herein, the term “identity” refers a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules as known in the art, comparing the sequences of these molecules. The relationship determined by doing. In the art, “identity” also means the degree of sequence relatedness between nucleic acid molecules or polypeptides, and in some cases more than one nucleotide sequence or more than one. It may be determined by a match between amino acid sequence strings. “Identity” means between a gap alignment (if any) addressed by a particular mathematical model or computer program (i.e., an “algorithm”) and a smaller sequence of two or more sequences. Measure the percent identity match.
[130] As used herein, the term “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multicellular organism.
[131] As used herein, the term “in vivo” refers to events that occur within a multi cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).
[132] “Integrin activator” or “integrin a701 activator” refers to molecule that can bind to integrin a701 in a way that increases one or more activities associated with the integrin. For example, and without limitation, an integrin a701 activator may increase integrin 0.701 binding with laminin. In some embodiments, an integrin a701 activator is an anti- a701 antibody.
[133] As used herein, the term “treat,” “treatment,” or “treating” refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of reduce severity of and / or reduce incidence of one or more symptoms of features of a particular disease, disorder, and / or condition. Treatment may be administered to a subject who does not exhibit signs of a disease and / or exhibits only early signs of the disease for the purpose of decreasing the risk of developing pathology associated with the disease. DETAILED DESCRIPTION
[134] The present disclosure provides, among other things, integrin a701 antibodies and therapeutic uses of such antibodies in effectively treating diseases or disorders associated with loss of dystrophin, such as Duchenne Muscular Dystrophy (DMD). As described herein, the present disclosure is based, in part, on identification of integrin a701 antibodies that are effective in stabilizing the a701 integrin in an extended-closed or extended-open conformation. As a result, the anti-a701 antibodies of the present disclosure effectively increase adhesion of muscle fibers to the extracellular matrix, restoring some or all the muscle adhesion lost by the absence of functional dystrophin and ultimately improving locomotive ability, increasing muscle force, and reducing fibrosis in patients with dystrophinopathies. Integrin a7pi
[135] The dystrophin-glycoprotein complex maintains the integrity of skeletal muscle by associating laminin in the extracellular matrix with the actin cytoskeleton. Several human muscular dystrophies arise from defects in the components of this complex. The a7pi integrin also binds laminin and links the extracellular matrix with the cytoskeleton. The a7pi integrin complex clearly plays a role in the development of striated muscle and smooth muscle. a7pi integrin promotes the adhesion and motility of myoblasts, and it is likely important in the recruitment of myogenic precursors during muscle differentiation.
[136] Dystrophin-associated protein complex (DAPC) and a7pi integrin maintains sarcolemma integrity. Repeated contraction and relaxation of sarcomere requires efficient handling of mechanical stress by sarcolemma. Disruption of DAPC or a7pi linkage results in compromised association of cell membrane with ECM, leading to membrane damage due to excess load of force. Additionally, loss of function mutation (LOF) of dystrophin causes Duchenne muscular dystrophy (DMD) while LOF mutation of ITGA7 (gene encoding a7pi integrin) leads to congenital muscular dystrophy. Structure and Confirmation of Integrin a7Bl
[137] Integrin structure and conformation are key to each part of its functionality, from adhesion to signaling. a7pi integrins can adopt a range of conformation structures from (FIG. 5A) bent closed conformation and extended closed conformation, that are inactive with a low affinity for laminin (FIG. 5B), and extended open conformation (FIG. 5C) that is active with a high affinity for laminin. a7 subunit has P-propeller, thigh, calf-1, and calf-2 domains as shown in FIG. 5C.
[138] The present disclosure provides, among other things, antibodies that bind to an a7pi integrin in an extended-open or in an extended-closed conformation, enhancing a7pi integrin binding to laminin. In some embodiments, anti-a7pi integrin antibody binds to an a7pi integrin in an extended-closed conformation. In some embodiments, anti-a7pi integrin antibody binds to an a7pi integrin in an extended-open conformation. In some embodiments, anti-a7pi integrin antibody maintains an a7pi integrin in an extended-closed conformation. In some embodiments, anti-a7pi integrin antibody maintains an a7pi integrin in an extended-open conformation.
[139] Human integrin a7 ectodomain can be present in XI or X2 isoform.
[140] In some embodiments, a human integrin a7 ectodomain has the following amino acid sequence (signal peptide underlined):
[141] MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPG SLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDI DQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFV LSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWK GTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDPDQ LVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAWIL RKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY VYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYH GSSLGWAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPI LHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDR RLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIW TLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVR ARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHE AQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTS GISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGWRGERAMQ SERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGP GQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITL DCARGTANCWFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSS IKNLMLRDASTVIPVMVYLDPMAWAEGVPWWVILLAVLAGLLVLALLVLLLWKMGF FKRAKHPEATVPQYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGH PELGPDGHPGPGTA (SEQ ID NO: 122, a7)
[142] In some embodiments, a human integrin a7 ectodomain has the following amino acid sequence:
[143] FNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPG QQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ QGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDL ALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERL TSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLC GSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGWAKPSQVLEGEA VGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPN CAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEP KHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIWTLSYSLQTPRLRRQAPGQG LPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDV DGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRA LDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQ ELHPVSARARVFIELPLSIAGMAIPQQLFFSGWRGERAMQSERDVGSKVKYEVTVSNQ GQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDS RDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCWFSCPLYSF DRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYL DPMAWAE (SEQ ID NO: 123, ITGA7 X2 ectodomain)
[144] In some embodiments, a human integrin a7 ectodomain has the following amino acid sequence:
[145] FNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPG QQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ QGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQD PRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAWILRKDSASRLVPEVML SGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGIS PLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGWAKPSQVL EGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSID LEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSR NLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIWTLSYSLQTPRLRRQ APGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQP LPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHY SGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLL ATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGWRGERAMQSERDVGSKVKYEV TVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILH LDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCWFSC PLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPV MVYLDPMAWAE (SEQ ID NO: 124, ITGA7 XI ectodomain)
[146] Human a7 leg has the following amino acid sequence: QGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTN LPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELG NPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAI PQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANG KWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPS MSWWPVSSAEKKKNITLDCARGTANCWFSCPLYSFDRAAVLHVWGRLWNSTFLEEY SAVI<SLEVIVRANITVI<SSII<NLMLRDASTVIPVMVYLDPMAVVAE (SEQ ID NO: 125, a71eg)
[147] Calf-1 domain of human a7 has the following amino acid sequence: QSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQ ADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQ VTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIE (SEQ ID NO: 126, calfl)
[148] Calf-2 domain of human a7 has the following amino acid sequence: LPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNI MWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQ QEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCWFSCPLYSFDRAAVLHVWGRL WNSTFLEEYSAVI<SLEVIVRANITVI<SSII<NLMLRDASTVIPVMVYLDPMAVVAE (SEQ ID NO: 127, calf!) Integrin a 7pi Antibodies
[149] The present disclosure provides, among other things, an antibody or antigen binding fragment thereof that binds a7pi integrin in an extended-open or an extended-closed conformation, thereby maintaining high affinity of a7pi integrin to laminin. Furthermore, the anti-a7pi integrin antibodies of the present disclosure are effective in promoting muscle cell adhesion to the laminin.
[150] In some embodiments, an anti-a7pi integrin antibody activates the a7pi integrin. In some embodiments, an anti-a7pi integrin antibody stabilizes an active conformation of a7pi integrin. In some embodiments an anti-a7pi integrin antibody increases expression of ITGA7 and / or activity of a7pi integrin. In some embodiments an anti-a7pi integrin antibody increases activity of a7pi integrin.
[151] a7pi integrin contains multiple domains as shown in FIG. 1A and FIG. 5C. In some embodiments, an anti-a7pi integrin antibody binds to the leg of a7. In some embodiments, an anti-a7pi integrin antibody binds to the laminin binding domain. In some embodiments, an anti-a7pi integrin antibody binds to the calf-1 and / or calf-2 domains of a7pi integrin. In some embodiments, an anti-a7pi integrin antibody binds to the calf-1 domain of a7pi integrin. In some embodiments, an anti-a7pi integrin antibody binds to the calf-2 domain of a7pi integrin. Epitope
[152] The present disclosure is based, in part, on the identification of a new epitope of a7 integrin. The anti-a7pi antibodies that bind to the epitope described herein are able to effectively stabilize the extended conformation of the a7pi integrin such that the a7pi integrin binds laminin with high affinity and remains in the active form. Therefore, the agonistic anti-a7pi integrin antibodies of the present disclosure are effective in treating diseases associated with dystrophin such as Duchenne muscular dystrophy (DMD).
[153] In some embodiments, an anti-a7pi integrin antibody binds to calf-2 domain of a7pi integrin. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 856-862, 867-889, 1011-1017, 897-905 or 1002-1010 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 856862 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 867-889 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 1011-1017 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 897-905 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 1002-1010 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids M856, A857,1858, P859, Q860, Q861, L862, V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, T889, L897, R898, T899, L900, G901, S902, A903, F904, L905, V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, S1010, F1011, D1012, R1013, A1014, A1015, V1016, and / or L1017. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids M856, A857,1858, P859, Q860, Q861, and / or L862. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising ammo acids V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, and / or T889. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids L897, R898, T899, L900, G901, S902, A903, F904, and / or L905. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids VI002, VI003, Fl 004, SI005, Cl006, Pl007, LI008, Y1009, SI010. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids F1011, D1012, R1013, A1014, A1015, V1016, and / or L1017.
[154] In some embodiments, an anti-a7pi integrin antibody binds to calf-2 domain of a7pi integrin, but does not compete with the 20TFT antibody. In some embodiments, an anti-a7pi integrin antibody binds to calf-2 domain of a7pi integrin, but does not bind to an epitope comprising amino acids S977, W978, W979, and P980.
[155] In some embodiments, an anti-a7pi integrin antibody binds to calf-1 domain of a7pi integrin. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 771-778 or 793-805 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 771-778 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to a region comprising positions 793-805 of integrin a7. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising ammo acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, N796, P797, M798, K799, R800, G801, A802, Q803, V804, and / or T805. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and / or T805. In some embodiments, an anti-a7pi integrin antibody binds to an epitope comprising amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and T805. Human Anti-a7fil Integrin Antibodies
[156] In some embodiments, the integrin a7pi antibody or antigen binding fragment comprises at least one, two, or three complementary determining regions (CDRs) from a heavy chain variable region having an amino acid sequence as set forth in Table A, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In some embodiments, integrin a7pi antibody or antigen binding fragment thereof comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table A , or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In an embodiment, the integrin a7pi antibody or antigen binding fragment thereof comprises at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table A, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions).
[157] In some embodiments, the antibody or antigen-binding fragment thereof is an anti-human a7pi antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table A. Unless indicated otherwise, the CDR sequences shown in the present application are in the IMGT numbering scheme. Table A. Exemplary CDRs of human anti-a7piantibodies. Ab HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Abi GYTFTGYY (SEQ ID NO: 1, HCDR1A) INPNSGGT (SEQ ID NO: 15, HCDR2A) AREGANWDYYYYG MDV (SEQ ID NO: 31, HCDR3A) SSNIGSKT (SEQ ID NO: 46, LCDR1A) SNN (SEQ ID NO: 58, LCDR2A) AAWDDSLNGPV (SEQ ID NO: 69, LCDR3A) Ab2 GFTFSSYT (SEQ ID NO: 2, HCDR1B) ISIVGNYI (SEQ ID NO: 16, HCDR2B) ARRKWEHDAFDI (SEQ ID NO: 32, HCDR3B) SLRSYY (SEQ ID NO: 47, LCDR1B) GKN (SEQ ID NO: 59, LCDR2B) TSRDNSGNHW (SEQ ID NO: 70, LCDR3B) Ab3 GFTFSSYS (SEQ ID NO: 3, HCDR1C) ISTSSSYI (SEQ ID NO: 17, HCDR2C) ARRAWESDAFAI (SEQ ID NO: 33, HCDR3C) SLRSYY (SEQ ID NO: 47, LCDR1B) GKN (SEQ ID NO: 59, LCDR2B) NSRDSSGNHW (SEQ ID NO: 71, LCDR3C) Ab4 GFTFSSYA (SEQ ID NO: 4, HCDR1D) ISDSGGIA (SEQ ID NO: 18, HCDR2D) VRDGY (SEQ ID NO: 34, HCDR3D) QSLLDSDD GYTY (SEQ ID NO: 48, LCDR1C) TLS (SEQ ID NO: 60, LCDR2C) MQRIEFPLT (SEQ ID NO: 72, LCDR3D) Ab5 GFTFSSYA (SEQ ID NO: 4, HCDR1D) IHYSGGTT (SEQ ID NO: 19, HCDR2E) VKDGY (SEQ ID NO: 35, HCDR3E) QSLLDSDD GYTY (SEQ ID NO:48, LCDR1C) TLS (SEQ ID NO: 60, LCDR2C) MQRIEFPLT (SEQ ID NO: 72, LCDR3D) Ab6 GFTFSRFW (SEQ ID NO: 5, HCDR1E) TKQDGSEK (SEQ ID NO: 2 0, HCDR2F) AREGSGAYWAFDI (SEQ ID NO: 36, HCDR3F) QSLVHNDG NTY (SEQ ID NO: 49, LCDR1D) KIS (SEQ ID NO: 61, LCDR2D) LQATQFPLT (SEQ ID NO: 73, LCDR3E) Ab7 GGSISSYY (SEQ ID NO: 6, HCDR1F) IYTRGST (SEQ ID NO: 21, HCDR2G) ARVFGGNYRFDAF HI (SEQ ID NO: 37, HCDR3G) SSNIGAGY D (SEQ ID NO: 50, LCDR1E) GNN (SEQ ID NO: 62, LCDR2E) QSYDSSLSGYV (SEQ ID NO: 74, LCDR3F)
[158] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), and an HCDR3 of SEQ ID NO: 31 (HCDR3A). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 46 (LCDR1 A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69, LCDR3A. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), an HCDR3 of SEQ ID NO: 31 (HCDR3A), an LCDR1 of SEQ ID NO: 46 (LCDR1A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69 (LCDR3A).
[159] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), an HCDR3 of SEQ ID NO: 31 (HCDR3A), an LCDR1 of SEQ ID NO: 46 (LCDR1 A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69 (LCDR3A).
[160] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), and an HCDR3 of SEQ ID NO: 32(HCDR3B). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), an HCDR3 of SEQ ID NO: 32 (HCDR3B), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B).
[161] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), an HCDR3 of SEQ ID NO: 32 (HCDR3B), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B).
[162] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), and an HCDR3 of SEQ ID NO: 33 (HCDR3C). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), an HCDR3 of SEQ ID NO: 33 (HCDR3C), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C).
[163] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), an HCDR3 of SEQ ID NO: 33 (HCDR3C), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C).
[164] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), and an HCDR3 of SEQ ID NO: 34 (HCDR3D). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), an HCDR3 of SEQ ID NO: 34 (HCDR3D), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).
[165] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), an HCDR3 of SEQ ID NO: 34 (HCDR3D), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).
[166] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), and an HCDR3 of SEQ ID NO: 35 (HCDR3E). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), an HCDR3 of SEQ ID NO: 35 (HCDR3E), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).
[167] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), an HCDR3 of SEQ ID NO: 35 (HCDR3E), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).
[168] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), and an HCDR3 of SEQ ID NO: 36 (HCDR3F). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), an HCDR3 of SEQ ID NO: 36 (HCDR3F), an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E).
[169] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), an HCDR3 of SEQ ID NO: 36 (HCDR3F), an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E).
[170] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G), an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F).
[171] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G), an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F).
[172] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table A. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table A.
[173] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYTFTGYY (SEQ ID NO: 1, HCDR1 A), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from INPNSGGT (SEQ ID NO: 15, HCDR2A), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AREGANWDYYYYGMDV (SEQ ID NO: 31 HCDR3A), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SSNIGSKT (SEQ ID NO: 46, LCDR1 A), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SNN (SEQ ID NO: 58, LCDR2A), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AAWDDSLNGPV (SEQ ID NO: 69, LCDR3A).
[174] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYT (SEQ ID NO: 2, HCDR1B), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISIVGNYI (SEQ ID NO: 16, HCDR2B), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARRKWEHDAFDI (SEQ ID NO: 32, HCDR3B), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TSRDNSGNHVV (SEQ ID NO: 70, LCDR3B).
[175] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYS (SEQ ID NO: 3, HCDR1C), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISTSSSYI (SEQ ID NO: 17, HCDR2C), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARRAWESDAFAI (SEQ ID NO: 33, HCDR3C), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from NSRDSSGNHVV (SEQ ID NO: 71, LCDR3C).
[176] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISDSGGIA (SEQ ID NO: 18, HCDR2D), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRDGY (SEQ ID NO: 34, HCDR3D), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLLDSDD (SEQ ID NO: 48, LCDR1C), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from MQRIEFPLT (SEQ ID NO: 72, LCDR3D).
[177] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IHYSGGTT (SEQ ID NO: 19, HCDR2E), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VKDGY (SEQ ID NO: 35, HCDR3E), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLLDSDDGYTY (SEQ ID NO: 48, LCDR1C), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from MQRIEFPLT (SEQ ID NO: 72, LCDR3D).
[178] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSRFW (SEQ ID NO: 5, HCDR1E), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TKQDGSEK (SEQ ID NO: 20, HCDR2F), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AREGSGAYWAFDI (SEQ ID NO: 36, HCDR3F), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHNDGNTY (SEQ ID NO: 49, LCDR1D), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KIS (SEQ ID NO: 61, LCDR2D), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQATQFPLT (SEQ ID NO: 73, LCDR3E).
[179] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GGSISSYY (SEQ ID NO: 6, HCDR1F), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IYTRGST (SEQ ID NO: 21, HCDR2G), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARVFGGNYRFDAFHI (SEQ ID NO: 37, HCDR3G), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SSNIGAGYD (SEQ ID NO: 50, LCDR1E), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GNN (SEQ ID NO: 62, LCDR2E), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QSYDSSLSGYV (SEQ ID NO: 74, LCDR3F). Table B. Exemplary VH and VL Sequences of Human anti-a7pi Integrin Antibodies. Ab VH Sequence VL Sequence Abi QVQLVQSGAEVKKPGASVKVSCKASGYTFTGY YMHWVRQAPGQGLEWMGWINPNSGGTNYAQKF QGRVTMTRDTSISTAYMELSRLRSDDTAVYYC AREGANWDYYYYGMDVWGQGTTVTVSS (SEQ ID NO: 128, VH1) QSVLTQPPSASGTPGQRVTISCSGSSSNIGS KTVNWYQQLPGTAPKLLIYSNNQRPSGVPDR FSGSKSGTSASLAISGLQSEDEADYYCAAWD DSLNGPVFGGGTKLTVL (SEQ ID NO: 129, VL1) Ab2 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSY TMNWVRQAPGKGLEWVSSISIVGNYIYYADSL KGRFTISRDNAKNSLYLQMNSLRAEDTAVYYC ARRKWEHDAFDIWGQGTMVTVSS (SEQ ID NO: 130, VH2) SSELTQDPAVSVALGQTVRITCQGDSLRSYY ASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS GSSSGNTASLTITGAQAEDEADFYCTSRDNS GNHVVFGGGTKLTVL (SEQ ID NO: 131, VL2) Ab3 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSY SMNWVRQAPGKGLEWVSSISTSSSYIYYADSV KGRFTISRDNAKNSLYLQMNSLRAEDTAVYYC ARRAWESDAFAIWGQGTMVTVSS (SEQ ID NO: 132, VH3) SSELTQDPAVSVALGQTVRITCQGDSLRSYY ASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS GSSSGNTASLTITGAQAEDEADYYCNSRDSS GNHVVFGGGTKLTVL (SEQ ID NO: 133, VL3) Ab4 EVQLLESGGGLEQPGGSLRLSCAASGFTFSSY AMNWVRQGLGKGLEWVSAIS DS GGIAYYADSV KGRFTISRDNSKNTLYLQMDSLRGEDTAVYYC VRDGYWGQGTLVTVSS (SEQ ID NO: 134, VH4) DIVMTQTPLSLPVTPGEPASISCRSSQSLLD SDDGYTYLDWYLQKPGQSPQLLIYTLSYRAS GVPDRFSGSGSGTDFSLKISRVEAEDAGIYY CMQRIEFPLTFGGGTKVEIK (SEQ ID NO: 135, VL4) Ab5 EVQLLESGGGLVQPGGSLRLSCVASGFTFSSY AMTWVRQAPGKGLEWVSAIHYSGGTTNYAASV KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC VRDGYWGQGTLVTVSS (SEQ ID NO: 136, VH5) DIMMTQTPLSLPVSPGEPASISCRSSQSLLD SDDGYTYLDWYLQKPGQSPQLLIYTLSYRAS GVPDRFSGSGSGTDFTLKISRVEAEDVGVYY CMQRIEFPLTFGGGTKVEIK (SEQ ID NO: 137, VL5) Ab6 EVQLVESGGGLVQPGGSLRLSCAASGFTFSRF WMSWVRQAPGKGLEWVANTKQDGSEKYYVDSV KGRFTISRDNAKNSLYLQMNSLRADDTAVYYC AREGSGAYWAFDIWGQGTMVTVSS (SEQ ID NO: 138, VH6) DIVMTQTPLSSPVTLGQPASISCRSSQSLVH NDGNTYLSWLQQRPGQPPRLLIYKISNRFSG VPDRFSGSGAGTDFTLKISRVEAEDVGVYYC LQATQFPLTFGGGTKVEIK (SEQ ID NO: 139, VL6) Ab7 QVQLQESGPGLVKPSETLSLTCTVSGGSISSY YWSWIRQPAGKGLEWIGRIYTRGSTNYNPSLK SRVTMSVDTSKNQFSLKLSSVTAADTAVYYCA RVFGGNYRFDAFHIWSQGTMVTVSS (SEQ ID NO: 140, VH7) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGA GYDVHWYQQLPGTAPKLLIYGNNNRPSGVPD RFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGYVFGTGTKVTVL (SEQ ID NO: 141, VL7)
[180] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 128 (VH1).
[181] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a701 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 130 (VH2).
[182] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 132 (VH3).
[183] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 134 (VH4).
[184] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 136 (VH5).
[185] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 138 (VH6).
[186] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 140 (VH7).
[187] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 129 (VL1).
[188] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 131 (VL2).
[189] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 133 (VL3).
[190] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 135 (VL4).
[191] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 137 (VL5).
[192] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a701 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 139 (VL6).
[193] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a701 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 141 (VL7).
[194] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 128 (VH1) and a light variable region comprising an amino acid sequence of SEQ ID NO: 129 (VL1).
[195] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 130 (VH2) and a light variable region comprising an amino acid sequence of SEQ ID NO: VL2.
[196] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 132 (VH3) and a light variable region comprising an amino acid sequence of SEQ ID NO: 133 (VL3).
[197] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 134 (VH4) and a light variable region comprising an amino acid sequence of SEQ ID NO: 135 (VL4).
[198] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 136 (VH5) and a light variable region comprising an amino acid sequence of SEQ ID NO: 137 (VL5).
[199] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 138 (VH6) and a light variable region comprising an amino acid sequence of SEQ ID NO: 139 (VL6).
[200] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 140 (VH7) and a light variable region comprising an amino acid sequence of SEQ ID NO: 141 (VL7). Table H. Exemplary Heavy Chain and Light Chain Sequences of Human anti-a7pi Integrin Antibodies. Ab Heavy Chain Sequence Light Chain Sequence Ab28 EVQLVESGGGLVKPGGSLRLSCAASGFTFSS Y TMNWVRQAPGKGLEWVS SISIVGNYIY YAD SLKGRFTISRDNAKNSLYLQMNSLRAEDTAV YYCARRKWEHDAFDIWGQGTMVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPK PKDTLMISRTPEVTCVWDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRWSVLTV LHQDWLNGKEYKCKVSNKALAAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVLHEAL HSHYTQKSLSLSPG (SEQ ID NO: 118) SSELTQDPAVSVALGQTVRITCQGDSLRSYY ASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS GSSSGNTASLTITGAQAEDEADFYCTSRDNS GNHVVFGGGTKLTVLGQPKAAPSVTLFPPSS EELQANKATLVCLISDFYPGAVTVAWKADSS PVKAGVETTTPSKQSNNKYAASSYLSLTPEQ WKSHKSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 119) Ab29 EVQLVESGGGLVKPGGSLRLSCAASGFTFSS Y TMNWVRQAPGKGLEWVS SISIVGNYIY YAD SLKGRFTISRDNAKNSLYLQMNSLRAEDTAV YYCARRKWEHDAFDIWGQGTMVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPK PKDTLYITREPEVTCVWDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRWSVLTV LHQDWLNGKEYKCKVSNKALAAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPG (SEQ ID NO: 120) SSELTQDPAVSVALGQTVRITCQGDSLRSYY ASWYQQKPGQAPVLVIYGKNNRPSGIPDRFS GSSSGNTASLTITGAQAEDEADFYCTSRDNS GNHVVFGGGTKLTVLGQPKAAPSVTLFPPSS EELQANKATLVCLISDFYPGAVTVAWKADSS PVKAGVETTTPSKQSNNKYAASSYLSLTPEQ WKSHKSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 121)
[201] In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 118. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence identical to SEQ ID NO: 118.
[202] In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 120. In some embodiments, the integrin a7pi antibody comprises a heavy chain comprising an amino acid sequence identical to SEQ ID NO: 120.
[203] In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 119. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence identical to SEQ ID NO: 119.
[204] In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 121. In some embodiments, the integrin a7pi antibody comprises a light chain comprising an amino acid sequence identical to SEQ ID NO: 121.
[205] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 118 and a light chain comprising an amino acid sequence of SEQ ID NO: 119.
[206] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 120 and a light chain comprising an amino acid sequence of SEQ ID NO: 121. Anti-Mouse a7fl 1 Antibodies
[207] In some embodiments, the antibody or antigen-binding fragment thereof is an anti-mouse a7pi antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table C. Table C. Exemplary CDRs of mouse anti-a7pi antibodies. Ab HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Ab8 GYSFTRYW (SEQ ID NO: 7, HCDR1G) IDPSDSET (SEQ ID NO: 22, HCDR2H) ARGGYFGEGWYFD V (SEQ ID NO: 38, HCDR3H) QSLVHRNGN TY (SEQ ID NO: 51, LCDR1F) KVS (SEQ ID NO: 63, LCDR2F) SQSTHVPWT (SEQ ID NO : 7 5, LCDR3G) Ab9 GYTFTSYW (SEQ ID NO: 8, HCDR1H) IYPSDSYT (SEQ ID NO: 23, HCDR2I) TRRANYVGAMDY (SEQ ID NO: 39, HCDR3I) SSVSY (SEQ ID NO: 52, LCDR1G) ATS (SEQ ID NO: 64, LCDR2G) QQWSSNPLT (SEQ ID NO: 76, LCDR3H) AblO GFSLTSYG (SEQ ID NO: 9, HCDR1I) IWVGGIT (SEQ ID NO: 24, HCDR2J) ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J) QDINKF (SEQ ID NO: 53, LCDR1H) YTS (SEQ ID NO: 65, LCDR2H) LQYDNLRT (SEQ ID NO : 7 7, LCDR3I) Abll GFSLTSYG (SEQ ID NO: 9, HCDR1I) IWAGGIT (SEQ ID NO: 25, HCDR2K) ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J) QDINKY (SEQ ID NO: 54, LCDR1I) YTS (SEQ ID NO: 65, LCDR2H) LQYDNLRT (SEQ ID NO : 7 7, LCDR3I) Abl2 GFSLTSYG (SEQ ID NO: 9, HCDR1I) IWAGGIT (SEQ ID NO: 25, HCDR2K) ARDGYYGHFDV (SEQ ID NO: 41, HCDR3K) QDINKY (SEQ ID NO: 54, LCDR1I) YTS (SEQ ID NO: 65, LCDR2H) LQYDNLRA (SEQ ID NO : 7 8, LCDR3J) Abl3 GFTFSSDA (SEQ ID NO: 10, HCDR1J) ISIGGSA (SEQ ID NO : 2 6, HCDR2L) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDL (SEQ ID NO: 55, LCDR1J) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHNFPFT (SEQ ID NO : 7 9, LCDR3K) Abl4 GFTFSSSA (SEQ ID NO: 11, HCDR1K) ISVGGST (SEQ ID NO: 27, HCDR2M) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDY (SEQ ID NO: 56, LCDR1K) YAS (SEQ ID NO:66, LCDR2I) QNGHSFPFT (SEQ ID NO : 8 0, LCDR3L) Abi 5 GFTFSSSA (SEQ ID NO: 11, HCDR1K) ISVGGST (SEQ ID NO: 27, HCDR2M) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDY (SEQ ID NO: 56, LCDR1K) YSS (SEQ ID NO: 67, LCDR2J) QNGHSFPFT (SEQ ID NO : 8 0, LCDR3L) Abl6 GFTFSSSA (SEQ ID NO: 11, HCDR1K) ISVGGST (SEQ ID NO: 27, HCDR2M) ARGGDYDPMDY (SEQ ID NO: 43, HCDR3M) QSISDY (SEQ ID NO: 56, LCDR1K) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHSFPFT (SEQ ID NO : 8 0, LCDR3L) Abl7 GFTFSSDA (SEQ ID NO: 10, HCDR1J) ISIGGST (SEQ ID NO : 2 8, HCDR2N) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDL (SEQ ID NO: 55, LCDR1J) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHNFPFT (SEQ ID NO : 7 9, LCDR3K) Abi 8 GFTFSSSA (SEQ ID NO: 11, HCDR1K) ISVGGST (SEQ ID NO : 2 9, HCDR2O) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDY (SEQ ID NO: 56, LCDR1K) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHSFPFT (SEQ ID NO : 8 0, LCDR3L) Ab20 GFTFSNCA (SEQ ID NO: 12, HCDR1L) ISIGGST (SEQ ID NO : 2 8, HCDR2N) ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L) QSISDL (SEQ ID NO: 55, LCDR1J) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHSFPFT (SEQ ID NO : 8 0, LCDR3L) Ab21 GFTFSSDA (SEQ ID NO: 10, HCDR1J) ISIGGST (SEQ ID NO : 2 8, HCDR2N) TRGGDYDAMDY (SEQ ID NO: 44, HCDR3N) QSISDL (SEQ ID NO: 55, LCDR1J) YAS (SEQ ID NO : 6 6, LCDR2I) QNGHNFPFT (SEQ ID NO : 7 9, LCDR3K) Ab22 GFSLSTSDMG (SEQ ID NO: 13, HCDR1M) IYWDDDK (SEQ ID NO: 30, HCDR2P) VRGTAWAFYWYF DV (SEQ ID NO: 45, HCDR3O) QDINNY (SEQ ID NO: 57, LCDR1L) RAN (SEQ ID NO: 68, LCDR2K) LHYDDFPLT (SEQ ID NO : 81, LCDR3M) Ab23 GFSLSTSDLG (SEQ ID NO: 14, HCDR1N) IYWDDDK (SEQ ID NO: 30, HCDR2P) VRGTAWAFYWYF DV (SEQ ID NO: 45, HCDR3O) QDINNY (SEQ ID NO: 57, LCDR1L) RAN (SEQ ID NO: 68, LCDR2K) LQYDDFPLT (SEQ ID NO: 82, LCDR3N)
[208] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 7 (HCDR1G), an HCDR2 of SEQ ID NO: 22 (HCDR2H), and an HCDR3 of SEQ ID NO: 38 (HCDR3H). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 51 (LCDR1F), an LCDR2 of SEQ ID NO: 63 (LCDR2F), and an LCDR3 of SEQ ID NO: 75 (LCDR3G).
[209] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 7 (HCDR1G), an HCDR2 of SEQ ID NO: 22 (HCDR2H), an HCDR3 of SEQ ID NO: 38 (HCDR3H), an LCDR1 of SEQ ID NO: 51 (LCDR1F), an LCDR2 of SEQ ID NO: 63 (LCDR2F), and an LCDR3 of SEQ ID NO: 75 (LCDR3G).
[210] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 8 (HCDR1H), an HCDR2 of SEQ ID NO: 23 (HCDR2I), and an HCDR3 of SEQ ID NO: 39 (HCDR3I). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 52 (LCDR1G), an LCDR2 of SEQ ID NO: 64 (LCDR2G), and an LCDR3 of SEQ ID NO: 76 (LCDR3H).
[211] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 8 (HCDR1H), an HCDR2 of SEQ ID NO: 23 (HCDR2I), an HCDR3 of SEQ ID NO: 39 (HCDR3I), an LCDR1 of SEQ ID NO: 52 (LCDR1G), an LCDR2 of SEQ ID NO: 64 (LCDR2G), and an LCDR3 of SEQ ID NO: 76 (LCDR3H).
[212] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 24 (HCDR2J), and an HCDR3 of SEQ ID NO: 40 (HCDR3J). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 53 (LCDR1H), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).
[213] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 24 (HCDR2J), an HCDR3 of SEQ ID NO: 40 (HCDR3J), an LCDR1 of SEQ ID NO: 53 (LCDR1H), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).
[214] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), and an HCDR3 of SEQ ID NO: 40 (HCDR3J). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: LCDR3I.
[215] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), an HCDR3 of SEQ ID NO: 40 (HCDR3J), an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).
[216] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), and an HCDR3 of SEQ ID NO: 41 (HCDR3K). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 78 (LCDR3J).
[217] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), an HCDR3 of SEQ ID NO: 41 (HCDR3K), an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 78 (LCDR3J).
[218] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: HCDR2L, and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[219] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 26 (HCDR2L), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[220] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80, LCDR3L.
[221] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[222] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 67 (LCDR2J), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[223] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 67 (LCDR2J), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[224] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 43 (HCDR3M). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[225] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 43 (HCDR3M), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[226] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[227] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[228] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 29 (HCDR20), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[229] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 29 (HCDR2O), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[230] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[231] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[232] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 12 (HCDR1L), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[233] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 12 (HCDR1L), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).
[234] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 44 (HCDR3N). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[235] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1 J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 44 (HCDR3N), an LCDR1 of SEQ ID NO: 55 (LCDR1 J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).
[236] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 13 (HCDR1M), an HCDR2 of SEQ ID NO: 30, HCDR2P, and an HCDR3 of SEQ ID NO: 45 (HCDR3O). In some embodiments, the antibody or antigenbinding fragment thereof comprises an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 81 (LCDR3M).
[237] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 13 (HCDR1M), an HCDR2 of SEQ ID NO: 30 (HCDR2P), an HCDR3 of SEQ ID NO: 45 (HCDR3O), an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 81 (LCDR3M).
[238] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 14 (HCDR1N), an HCDR2 of SEQ ID NO: 30 (HCDR2P), and an HCDR3 of SEQ ID NO: 29 (HCDR2O). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 82 (LCDR3N).
[239] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 14 (HCDR1N), an HCDR2 of SEQ ID NO: 30 (HCDR2P), an HCDR3 of SEQ ID NO: 29 (HCDR2O), an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 82 (LCDR3N).In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table C. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table C.
[240] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO: 75, LCDR3G).
[241] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYTFTSYW (SEQ ID NO: 8, HCDR1H), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYPSDSYT (SEQ ID NO: 23, HCDR2I), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TRRANYVGAMDY (SEQ ID NO: 39, HCDR3I), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from SSVSY (SEQ ID NO: 52, LCDR1G), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ATS (SEQ ID NO: 64, LCDR2G), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QQWSSNPLT (SEQ ID NO: 76, LCDR3H).
[242] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWVGGIT (SEQ ID NO: 24, HCDR2J), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from QDINKF (SEQ ID NO: 53, LCDR1H), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRT (SEQ ID NO: 77, LCDR3I).
[243] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWAGGIT (SEQ ID NO: 25, HCDR2K), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRT (SEQ ID NO: 77, LCDR3I).
[244] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWAGGIT (SEQ ID NO: 25, HCDR2K), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGHFDV (SEQ ID NO: 41, HCDR3K), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRA (SEQ ID NO: 78, LCDR3J).
[245] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1 J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGSA (SEQ ID NO: 26, HCDR2L), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1 J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).
[246] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).
[247] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YSS (SEQ ID NO: 67, LCDR2J), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).
[248] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDPMDY (SEQ ID NO: 43, HCDR3M), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).
[249] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1 J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1 J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).
[250] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGSI (SEQ ID NO: 29, HCDR2O), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).
[251] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO: 75, LCDR3G).
[252] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1 J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1 J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).
[253] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSNCA (SEQ ID NO: 12, HCDR1L), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1 J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).
[254] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1 J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TRGGDYDAMDY (SEQ ID NO: 44, HCDR3N), a LCDR1 comprising an ammo acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1 J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).
[255] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLSTSDMG (SEQ ID NO: 13, HCDR1M), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYWDDDK (SEQ ID NO: 30, HCDR2P), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRGTAWAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LHYDDFPLT (SEQ ID NO: 81,LCDR3M).
[256] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLSTSDLG (SEQ ID NO: 14, HCDR1N), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYWDDDK (SEQ ID NO: 30, HCDR2P), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRGTAWAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDDFPLT (SEQ ID NO: 82, LCDR3N). Table D. Exemplary VH and VL Sequences of Mouse anti-a7pi Integrin Antibodies. Ab VH Sequence VL Sequence Ab8 QVPLQQSGPQLVRPGASVKISCKASGYSF TRYWMHWVKQRPGQGLDWIGKIDPSDSET RLNQEFRDKATLTVDKSSSTAYLQLSSPT SEDSAVYYCARGGYFGEGWYFDVWGAGTT VTVSS (SEQ ID NO: 142, VH8) DWMTQIPLSLPVSLGDQASISCRSSQSL VHRNGNTYLHWYLQKPGQSPKLLIYKVSN RFSGVPDRFSGSGSGTDFTLKISRVEAED LGVYFCSQSTHVPWTFGGGTKLEIK (SEQ ID NO: 143, VL8) Ab22 QVTLKESGPGILQPSQTLSLTCSFSGFSL STSDMGVSWIRQPSGKGLEWLAHIYWDDD KRYSPSLKSRLTISKDTSRNQVFLKITSV DTADTATYYCVRGTAVVAFYWYFDVWGAG TTVTVSS (SEQ ID NO: 144, VH2 2) DIKMTQSPSSMYASLGERVTITCKASQDI NNYLNWFQQKPGKS PKTLIYRANRLVDGV PSRFSGSGSGQDYSLTISSLEYEDMGIYY CLHYDDFPLTFGAGTKVELK (SEQ ID NO: 145, VL22) Ab23 QVTLKESGPGILQPSQTLSLTCSCSGFSL STSDLGVSWIRQPSGKGLEWLAHIYWDDD KRYSPSLKSRLTISKDTSRNQVFLKITSV DTADTATYYCVRGTAVVAFYWYFDVWGAG TTVTVSS (SEQ ID NO: 146, VH2 3) DIKMTQSPSSMYASLGERVTITCKASQDI NNYLNWFQQKPGKS PKTLIYRANRLVDGV PSRFSGSGSGQDYSLTISSLEYEDMGIYY CLQYDDFPLTFGAGTKVELK (SEQ ID NO: 147, VL23) AblO QVQLKESGPGLVAPSQSLSITCTVSGFSL TSYGVHWVRQPPGKGLEWLGVIWVGGITH YNSALMSRLSISKDNSKS QVFLKMNSLQT DDIAMYYCARDGYYGDFDVWGAGTTVTVS S (SEQ ID NO: 148, VH10) DIQMTQSPSSLSASLGGKVTITCTASQDI NKFIAWYQHKPGKGPRLLIHYTSTLQPGI PSRFSGSGSGRDYSFSISNLEPEDIATYY CLQYDNLRTFGGGTKLEIK (SEQ ID NO: 149, VL10) Abll QVQLKESGPGLVAPSQSLSITCTVSGFSL TSYGVHWVRQPPGKGLEWLGVIWAGGITH YNSALMSRLSISKDNSKSQVFLKMNSPQT DDIAMYYCARDGYYGDFDVWGAGTTVTVS S (SEQ ID NO: 150, VH11) DIQMTQSPSSLSASLGGKVTITCKASQDI NKYIAWYQHKPGKGPRLLIHYTSTLQPGI PSRFSGSGSGRDYSFSISNLVPEDIATYY CLQYDNLRTFGGGTKLEIK (SEQ ID NO: 151, VL11) Abl2 QVQLKESGPGLVAPSQSLSITCTVSGFSL TSYGVHWVRQPPGKGLEWLGVIWAGGITH YNSALMSRLSISKDNSKS QVFLKMNSLQT DDTAMFYCARDGYYGHFDVWGAGTTVTVS S (SEQ ID NO: 152, VH12) DIQMTQSPSSLSASLGGKVTITCKASQDI NKYIAWYQHKPGQGPRLLIDYTSTLQPGI PSRFSGSGSGRDYSFTISNLEPEDIATYF CLQYDNLRAFGGGTKLEIK (SEQ ID NO: 153, VL12) Ab9 QVQLQQPGAELVRPGASVKLSCKASGYTF TSYWINWVKQRPGQGLEWIGNIYPSDSYT NYNQKFKDKATLTVDKSSSTAYMQLSSPT SEDSAVYYCTRRANYVGAMDYWGQGTSVT VSS (SEQ ID NO: 154, VH9) QIVLSQSPAILSASPGEKVTMTCRASSSV SYMYWYQQKPGSSPKPWIYATSNLASGVP ARFSGSGSGTSYSLTISRVEAEDAATYYC QQWSSNPLTFGAGTKLELK (SEQ ID NO: 155, VL9) Abl3 EVKLVESGGGLVKPGGSLKLSCAASGFTF SSDAMSWVRQTPEKSLEWVASISIGGSAF YPE SVRGRFTISRDNARNILYLQMS S LRS EDTAMYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 156, VH13) DIVMTQSPATLSVTPGDRVSLSCRASQSI S DL LHWYQQKS HE S PRLLIKYAS QSIS GI PSRFSGSGSGSDFTLSINSVEPEDVGVYF CQNGHNFPFTFGSGTKLEIK (SEQ ID NO: 157, VL13) Ab 14 EVKLVESGGGLVKPGGSLKLSCAASGFTF S S SAMSWVRQT PEKRLEWVASISVGGS T F YPDSVKGRFTISRDNARKILYLQMSSLRS EDTAMYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 158, VH14) DIVMTQSPATLSVTPGDRVSLSCRASQSI SDYLHWFQQKSHESPRLLIKYASQSISGI PSRFSGSGSGSDFTLSINSVEPEDVGVYY CQNGHSFPFTFGSGTKLEIK (SEQ ID NO: 159, VL14) Abl5 EVKLVESGGGLVKPGGSLKLSCAASGFTF S S SAMSWVRQT PEKRLEWVASISVGGS T F YPDSVKGRFTISRDNARNILYLQMSSLRS EDTAMYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 160, VH15) DIVMTQSPATLSVTPGDRVSLSCRASQSI SDYLHWFQQKSHESPRLLIKYSSQSISGI PSRFSGSGSGSDFTLSINSVEPEDVGVYY CQNGHSFPFTFGSGTKLEIK (SEQ ID NO: 161, VL15) Abl6 EVKLVESGGGLVKPGGSLKLSCAASGFTF S S SAMSWVRQT PEKRLEWVASISVGGS T F YADSVKGRFTISRDNARNILYLQMSSLRS EDTAMYYCARGGDYDPMDYWGQGTSVTVS S (SEQ ID NO: 162, VH16) DIVMTQSPATLSVTPGDRVSLSCRASQS! SDYLHWFQQKSHESPRLLIKYASQSISGI PSRFSGSGSGSDFTLSINSVEPEDVGVYY CQNGHSFPFTFGSGTKLEIK (SEQ ID NO: 163, VL16) Abl7 EVKLVESGGGLVKPGGSLKLSCAASGFTF S S DAMSWVRQT PEKRLEWVASISIGGSTF YPE SVKGRFTISRDNARNILYLQMS S LRS EDTAMYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 164, VH17) DIVMTQSPATLSVTPGDRVSLSCRASQS! S DL LHWYQQKS HE S PRLLIKYAS QSIS GI PSRFSGSGSGSDFTLSINSVEPEDVGVYF CQNGHNFPFTFGSGTKLEIK (SEQ ID NO: 165, VL17) Abl8 EVKWESGGGLVKPGGSLKLSCATSGFTF S S SAMSWVRQT PERRLEWVASISVGGSIF YPDSVKGRFTISRENARNILYLQMSSLRS EDTAMYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 166, VH18) DIVMTQSPATLSVTPGDRVSLSCRASQS! SDYLHWFQQKSHESPRLLIKYASQSISGI PSRFSGSGSGSDFTLSINSVEPEDVGVYY CQNGHSFPFTFGSGTKLEIK (SEQ ID NO: 167, VL18) Ab20 EVKLVESGGGLVKPGGSLKLSCAASGFTF SNCAMSWVRQT PEKRLEWVASISIGGSTF YPDSVKGRFTISRDNGRNILYLQMSSLRS EDTALYYCARGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 170, VH20) DIVMTQFPDTLSVTPGDRVSLSCRASQSI SDLLHWYQQKSHESPRLLIKYASQSISEI PSRFSGSGSGSDFTLSINSVEPEDVGVYY CQNGHSFPFTFGSGTKLEIK (SEQ ID NO: 171, VL20) Ab21 EVKLVESGGGLVKPGGSLKLSCEASGFTF S S DAMSWVRQTPEKRLEWVASISIGGSTF YPE SVKGRFTISRDNARNILYLQMS S LRS EDTAMYYCTRGGDYDAMDYWGQGTSVTVS S (SEQ ID NO: 172, VH21) DIVMTQSPATLSVTPGDRVSLSCRASQS! S DL LHWYQQKS HE S PRLLIKYAS QSIS GI PSRFSGSGSGSDFTLSINSVEPEDVGVYF CQNGHNFPFTFGSGTKLEIK (SEQ ID NO: 173, VL21)
[257] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a701 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 142 (VH8).
[258] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 154 (VH9).
[259] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 148 (VH10).
[260] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 150(VHll).
[261] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 152(VH12).
[262] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 156(VH13).
[263] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 158(VH14).
[264] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 160(VH15).
[265] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 162(VH16).
[266] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 164(VH17).
[267] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 166(VH18).
[268] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 170(VH20).
[269] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 172(VH21).
[270] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 144 (VH22).
[271] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 146 (VH23).
[272] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 134 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 143 (VL8).
[273] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 155 (VL9).
[274] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 149 (VL10).
[275] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 151 (VL11).
[276] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 153 (VL12).
[277] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 157 (VLB).
[278] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 159 (VL14).
[279] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 161 (VL15).
[280] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 163 (VL16).
[281] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 165 (VL17).
[282] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 167 (VL18).
[283] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 167 (VL18).
[284] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 169 (VL19).
[285] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 171 (VL20).
[286] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 73 (VL21). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 173 (VL21).
[287] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 145 (VL22).
[288] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 147 (VL23).
[289] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 142 (VH8) and a light variable region comprising an amino acid sequence of SEQ ID NO: 143 (VL8).
[290] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 154 (VH9) and a light variable region comprising an amino acid sequence of SEQ ID NO: 155 (VL9).
[291] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 149 (VH10) and a light variable region comprising an amino acid sequence of SEQ ID NO: 149 (VL10).
[292] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 150 (VH11) and a light variable region comprising an amino acid sequence of SEQ ID NO: 151 (VL11).
[293] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 152 (VH12) and a light variable region comprising an amino acid sequence of SEQ ID NO: 153 (VL12).
[294] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 156 (VH13) and a light variable region comprising an amino acid sequence of SEQ ID NO: 157 (VLB).
[295] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 158 (VH14) and a light variable region comprising an amino acid sequence of SEQ ID NO: 159 (VL14).
[296] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 160 (VH15) and a light variable region comprising an amino acid sequence of SEQ ID NO: 161 (VL15).
[297] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 162 (VH16) and a light variable region comprising an amino acid sequence of SEQ ID NO: 163 (VL16).
[298] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 164 (VH17) and a light variable region comprising an amino acid sequence of SEQ ID NO: 165 (VL17).
[299] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 166 (VH18) and a light variable region comprising an amino acid sequence of SEQ ID NO: 167 (VL18).
[300] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 170 (VH20) and a light variable region comprising an amino acid sequence of SEQ ID NO: 171 (VL20).
[301] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 172 (VH21) and a light variable region comprising an amino acid sequence of SEQ ID NO: 173 (VL21).
[302] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 144 (VH22) and a light variable region comprising an amino acid sequence of SEQ ID NO: 145 (VL22).
[303] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 146 (VH23) and a light variable region comprising an amino acid sequence of SEQ ID NO: 147 (VL23). Humanized, Affinity-Optimized Anti-a7fl Integrin Antibodies
[304] In some embodiments, the integrin a7pi antibody or antigen binding fragment comprises at least one, two, or three complementary determining regions (CDRs) from a heavy chain variable region having an amino acid sequence as set forth in Table E, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In some embodiments, integrin a7pi antibody or antigen binding fragment thereof comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table E, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In an embodiment, the integrin a7pi antibody or antigen binding fragment thereof comprises at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table E, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions).
[305] In some embodiments, the antibody or antigen-binding fragment thereof is a humanized a7pi antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table E. Unless indicated otherwise, the CDR sequences shown in the present application are in the IMGT numbering scheme. Table E. Exemplary CDRs of humanized, affinity optimized anti-a7piantibodies. Ab HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 Ab-P GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 27) ARGGYFGEGWYF DV (SEQ ID NO: 38) QSLVHRNG NTY (SEQ ID NO: 105) KVS (SEQ ID NO: 63) SQSTHVPWT (SEQ ID NO: 75) Ab24 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGREWYY DV (SEQ ID NO: 103) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO:75, LCDR3G) Ab25 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGREWYY DV (SEQ ID NO: 103) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO: 75, LCDR3G) Ab26 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEEWYH DV (SEQ ID NO: 104) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID No: 106) AQSTQLPYT (SEQ ID NO: 107) Ab27 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEEWYH DV (SEQ ID NO: 104) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) AQSTQLPYT (SEQ ID NO: 107) Ab30 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEGWYH DV (SEQ ID NO : 18 8) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) AQSIQVPWT (SEQ ID NO: 198) Ab31 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGRQWYF DV (SEQ ID NO : 18 9) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO: 75) Ab32 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEQWYH DV (SEQ ID NO: 190) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO: 75) Ab33 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGVGWYN DV (SEQ ID NO: 191) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO: 75) Ab34 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGETWYH DV (SEQ ID NO: 192) QSLVHRNG NTY (SEQ EVS (SEQ ID NO: 106) SQSTHVPWT (SEQ ID NO: 75) ID NO: 105) Ab35 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGENWYH DV (SEQ ID NO: 193) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) AQSIQVPWT (SEQ ID NO: 198) Ab36 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEKWYH DV (SEQ ID NO: 194) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) AQSTQLPYT (SEQ ID NO: 107) Ab37 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEKWYH DV (SEQ ID NO: 194) QSLVHRNG NTY (SEQ ID NO: 105) GVS (SEQ ID NO: 196) AQSTQLPYT (SEQ ID NO: 107) Ab38 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEEWYN DV (SEQ ID NO: 195) QSLVHRNG NTY (SEQ ID NO: 105) KVS (SEQ ID NO: 63) SQSTHVPWT (SEQ ID NO: 75) Ab39 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEEWYH DV (SEQ ID NO: 104) QSLVHRNG NTY (SEQ ID NO: 105) KVS (SEQ ID NO: 63) SQSTHVPWT (SEQ ID NO: 75) Ab40 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEEWYH DV (SEQ ID NO: 104) QSLVHRNG NTY (SEQ ID NO: 105) EGS (SEQ ID NO: 197) SQSTHVPWT (SEQ ID NO: 75) Ab41 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGEQWYH DV (SEQ ID NO: 190) QSLVHRNG NTY (SEQ ID NO: 105) EVS (SEQ ID NO: 106) AQSIQVPWT (SEQ ID NO: 198) Ab42 GYSFTRYW (SEQ ID NO: 101) IDPSDSET (SEQ ID NO: 102) ARGGYFGRQWYF DV (SEQ ID NO : 18 9) QSLVHRNG NTY (SEQ ID NO: 105) EGS (SEQ ID NO: 197) AQSTQLPYT (SEQ ID NO: 107)
[306] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, and an HCDR3 of SEQ ID NO: 38. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, an HCDR3 of SEQ ID NO: 38, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[307] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, an HCDR3 of SEQ ID NO: 38, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[308] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 103. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 103, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[309] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 103, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[310] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.
[311] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.
[312] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 188. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQIDNO: 198.
[313] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
[314] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 189. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[315] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[316] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 190. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[317] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[318] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 191. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[319] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[320] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 192. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
[321] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75
[322] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 193. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQIDNO: 198.
[323] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
[324] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 194. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQIDNO: 107.
[325] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.
[326] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 194. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQIDNO: 107.
[327] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107.
[328] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 195. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[329] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[330] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[331] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
[332] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.
[333] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.
[334] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 190. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
[335] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
[336] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 189. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107.
[337] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107.
[338] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table E. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table E.
[339] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 101), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IDPSDSET (SEQ ID O: 102), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGREWYYDV (SEQ ID NO: 103), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from EVS (SEQ ID NO: 106), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO:75, LCDR3G).
[340] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 101), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IDPSDSET (SEQ ID NO: 102), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEEWYHDV (SEQ ID NO: 104), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from EVS (SEQ ID No: 106), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AQSTQLPYT (SEQ ID NO: 107).
[341] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 188, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.
[342] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 189, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[343] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 190, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[344] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 191, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[345] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 192, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[346] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 193, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.
[347] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 194, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107.
[348] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 194, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 196, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107.
[349] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 195, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 63, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[350] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 104, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 63, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[351] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 104, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 197, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.
[352] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 190, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.
[353] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 189, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 197, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107. Table F. Exemplary VH and VL Sequences of Humanized anti-a7pi Integrin Antibodies. Ab VH Sequence VL Sequence AB-P QVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGEGWYFDVWGQGTLVTVSS (SEQ ID NO: 186) DVVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYKVSNRFSG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 187) Ab24 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGREWYYDVWGQGTLVTVSS (SEQ ID NO: 108) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRAAG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 109) Ab25 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGREWYYDVWGQGTLVTVSS (SEQ ID NO: 108) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRAAG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 109) Ab26 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGEEWYHDVWGQGTLVTVSS (SEQ ID NO: 110) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRFTG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC AQSTQLPYTFGGGTKLEIK (SEQ ID NO: 111) Ab27 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGEEWYHDVWGQGTLVTVSS (SEQ ID NO: 110) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRFTG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC AQSTQLPYTFGGGTKLEIK (SEQ ID NO: 111) Ab30 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGEGWYHDVWGQGTLVTVSS (SEQ ID NO: 199) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSKRASG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC AQSIQVPWTFGGGTKLEIK (SEQ ID NO: 200) Ab31 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGRQWYFDVWGQGTLVTVSS (SEQ ID NO: 201) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRASG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 202) Ab32 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGEQWYHDVWGQGTLVTVSS (SEQ ID NO: 203) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRASG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 204) Ab33 EVQLVQSGAEVKKPGSSVKVSCKASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGVGWYNDVWGQGTLVTVSS (SEQ ID NO: 205) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQKPGQSPQLLIYEVSNRVPG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFC SQSTHVPWTFGGGTKLEIK (SEQ ID NO: 206) Ab34 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGETWYHDVWGQGTLVTVSS (SEQ ID NO: 207) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEVSHRASG VPDRFSGSGSGTDFTLRISRVEAEDVGVYFC SQSTHVPWTFGGGTRLEIR (SEQ ID NO: 208) Ab35 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGENWYHDVWGQGTLVTVSS (SEQ ID NO: 209) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEVSNRYSG VPDRFSGSGSGTDFTLNISRVEAEDVGVYFC AQSIQVPWTFGGGTRLEIR (SEQ ID NO: 210) Ab36 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGENWYHDVWGQGTLVTVSS (SEQ ID NO: 211) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEVSHRFPG VPDRFSGSGSGTDFTLNISRVEAEDVGVYFC AQSTQLPYTFGGGTRLEIR (SEQ ID NO: 212) Ab37 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGKIDPSDSETRLNQ EFRDRATLTVDKSTSTAYMELSSLRSEDTAV YYCARGGYFGENWYHDVWGQGTLVTVSS (SEQ ID NO: 213) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYGVSNRFAG VPDRFSGSGSGTDFTLNISRVEAEDVGVYFC AQSTQLPYTFGGGTNLEIR (SEQ ID NO: 214) Ab38 EVQLVQSGAEVEEPGSSVEVSCEASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGEEWYNDVWGQGTLVTVSS (SEQ ID NO: 215) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQEPGQSPQLLIYEVSNRASG VPDRFSGSGSGTDFTLNISRVEAEDVGVYFC SQSTHVPWTFGGGTNLEIR (SEQ ID NO: 216) Ab39 EVQLVQSGAEVNNPGSSVNVSCNASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGEEWYHDVWGQGTLVTVSS (SEQ ID NO: 217) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYRVSNRASG VPDRFSGSGSGTDFTLRISRVEAEDVGVYFC SQSTHVPWTFGGGTNLEIR (SEQ ID NO: 218) Ab40 EVQLVQSGAEVEEPGSSVEVSCEASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGEEWYHDVWGQGTLVTVSS (SEQ ID NO: 219) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEGSRRFSG VPDRFSGSGSGTDFTLRISRVEAEDVGVYFC SQSTHVPWTFGGGTRLEIR (SEQ ID NO: 220) Ab41 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGEQWYHDVWGQGTLVTVSS (SEQ ID NO: 221) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEVSRRFSG VPDRFSGSGSGTDFTLRISRVEAEDVGVYFC AQSIQVPWTFGGGTRLEIR (SEQ ID NO: 222) Ab42 EVQLVQSGAEVRRPGSSVRVSCRASGYSFTR YWMHWVRQAPGQGLEWIGRIDPSDSETRLNQ EFRDRATLTVDRSTSTAYMELSSLRSEDTAV YYCARGGYFGRQWYFDVWGQGTLVTVSS (SEQ ID NO: 223) DIVMTQSPLSLPVTPGEPASISCRSSQSLVH RNGNTYLHWYLQRPGQSPQLLIYEGSRRFSG VPDRFSGSGSGTDFTLRISRVEAEDVGVYFC AQSTQLPYTFGGGTRLEIR (SEQ ID NO: 224)
[354] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 186. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 186.
[355] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 108. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 108.
[356] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID No: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 110. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 110.
[357] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 199. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 199.
[358] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 201. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 201.
[359] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 203. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 203.
[360] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 205. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 205.
[361] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 207. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 207.
[362] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 9. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 209. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 209.
[363] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 211. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 211.
[364] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 213. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 213.
[365] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 215. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 215.
[366] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 217. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 217.
[367] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 219. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 219.
[368] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 221. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 221.
[369] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 223. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 223.
[370] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 187. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 187.
[371] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 109. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 109.
[372] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 111. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 111.
[373] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 200. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 200.
[374] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 202. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 202.
[375] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 204. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 204.
[376] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 206. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 206.
[377] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 208. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 208.
[378] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 210. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 210.
[379] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 212. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 212.
[380] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 214. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 214.
[381] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 216. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 216.
[382] In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 218. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 218. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 218. In some embodiments, the integrin a7pi antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 218. In some embodiments, the integrin a7pi antibod...
Claims
1. An antibody or an antigen-binding fragment that binds to calf-2 domain of (1701 integrin but does not compete with the 20TFT antibody, wherein the antibody stabilizes the extended conformations of a701 integrin.
2. An antibody or an antigen-binding fragment that binds a701 integrin and competes for binding with a reference antibody for binding to a701 integrin,wherein the reference antibody comprises a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32), a LCDR1 of sequence SLRS YY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHW (SEQ ID NO: 70).
3. An antibody or an antigen-binding fragment that binds a701 integrin comprising: (a) a means for stabilizing the extended conformations of the a701 integrin; and optionally,(b) an Fc domain.
4. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody binds to region comprising positions 856-862, 867-889, 1011-1017, 897-905 or 1002-1010 of the amino acid sequence of integrin a7, wherein the antibody stabilizes the extended conformations of a701 integrin.
5. An antibody or an antigen-binding fragment that binds to calf-1 domain of a701 integrin, wherein the antibody stabilizes the extended conformations of a701 integrin.
6. An antibody or an antigen-binding fragment that binds a701 integrin and competes with a reference antibody for binding to a701 integrin, wherein the reference antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38), aLCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).
7. An antibody or an antigen-binding fragment that binds a7pi integrin and competes with a reference antibody for binding to a7pi integrin, wherein the reference antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40), a LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).
8. An antibody or an antigen-binding fragment that binds a7pi integrin comprising: (a) a means for binding to calf-1 domain of a7pi integrin; and (b) an Fc domain.
9. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody binds to a region comprising positions 771-778, 793-805 of the amino acid sequence of integrin a7, wherein the antibody stabilizes the extended conformations of a7pi integrin.
10. The antibody or an antigen-binding fragment of claim 9, wherein the region comprises amino acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, N796, P797, M798, K799, R800, G801, A802, Q803, V804, and / or T805.
11. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), and a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32); anda LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHW (SEQ ID NO: 70).
12. An antibody or an antigen-binding fragment that binds (1701 integrin, wherein the antibody comprises:a HCDR1 of sequence GYTFTGYY (SEQ ID NO: 1), a HCDR2 of sequence INPNSGGT (SEQ ID NO: 15), and a HCDR3 of sequence AREGANWDYYYYGMDV (SEQ ID NO: 31); anda LCDR1 of sequence SSNIGSKT (SEQ ID NO: 46), a LCDR2 of sequence SNN (SEQ ID NO: 58), and a LCDR3 of sequence AAWDDSLNGPV (SEQ ID NO: 69).
13. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); anda LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHW (SEQ ID NO: 71).
14. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence ISDSGGIA (SEQ ID NO: 18), and a HCDR3 of sequence VRDGY (SEQ ID NO: 34); anda LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).
15. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); anda LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).
16. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSRFW (SEQ ID NO: 5), a HCDR2 of sequence TKQDGSEK (SEQ ID NO: 20), and a HCDR3 of sequence AREGSGAYWAFDI (SEQ ID NO: 36); anda LCDR1 of sequence QSLVHNDGNTY (SEQ ID NO: 49), a LCDR2 of sequence KIS (SEQ ID NO: 61), and a LCDR3 of sequence LQATQFPLT (SEQ ID NO: 73).
17. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GGSISSYY (SEQ ID NO: 6), a HCDR2 of sequence IYTRGST (SEQ ID NO: 21), and a HCDR3 of sequence ARVFGGNYRFDAFHI (SEQ ID NO: 37); and a LCDR1 of sequence SSNIGAGYD (SEQ ID NO: 50), a LCDR2 of sequence GNN (SEQ ID NO: 62), and a LCDR3 of sequence QSYDSSLSGYV (SEQ ID NO: 74).
18. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), and a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).
19. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GYTFTSYW (SEQ ID NO: 8), a HCDR2 of sequence IYPSDSYT (SEQ ID NO: 23), and a HCDR3 of sequence TRRANYVGAMDY (SEQ ID NO: 39); anda LCDR1 of sequence SSVSY (SEQ ID NO: 52), a LCDR2 of sequence ATS (SEQ ID NO: 64), and a LCDR3 of sequence QQWSSNPLT (SEQ ID NO: 76).
20. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), and a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40); anda LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).
21. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT(SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGDFDV(SEQ ID NO: 40); anda LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).
22. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGHFDV (SEQ ID NO: 41); anda LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRA (SEQ ID NO: 78).
23. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGSA (SEQ ID NO: 26), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 178); anda LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).
24. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibodycomprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); anda LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).
25. An antibody or an antigen-binding fragment that binds (1701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST(SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); anda LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YSS (SEQ ID NO: 67), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).
26. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST(SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDPMDY (SEQ ID NO: 43); anda LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).
27. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST(SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); anda LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).
28. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGSI(SEQ ID NO: 29), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); anda LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).
29. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHW (SEQ ID NO: 71); ora HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).
30. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSNCA (SEQ ID NO: 12), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); anda LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).
31. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence TRGGDYDAMDY (SEQ ID NO: 44); anda LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).
32. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLSTSDMG (SEQ ID NO: 13), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAWAFYWYFDV (SEQ ID NO: 45); anda LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LHYDDFPLT (SEQ ID NO: 81).
33. An antibody or an antigen-binding fragment that binds 0(701 integrin, wherein the antibody comprises:a HCDR1 of sequence GFSLSTSDLG (SEQ ID NO: 14), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAWAFYWYFDV (SEQ ID NO: 45); anda LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LQYDDFPLT (SEQ ID NO: 82).
34. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody or antigen-binding fragment comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGREWYYDV (SEQ ID NO: 103); anda LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO:75).
35. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody or antigen-binding fragment comprises:a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGEEWYHDV (SEQ ID NO: 104); anda LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence AQSTQLPYT (SEQ ID NO: 107).
36. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
37. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 ofSEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
38. An antibody or an antigen-binding fragment that binds 0(701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
39. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
40. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.
41. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
42. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.
43. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107.
44. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 ofSEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
45. An antibody or an antigen-binding fragment that binds 0(701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.
46. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.
47. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.
48. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107.
49. An antibody or an antigen-binding fragment that binds a701 integrin, wherein the antibody or antigen binding fragment comprises:i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 128, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 129;ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 131;iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 132, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 133;iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 134, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 135;v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 136, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 137;vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 138, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 139; orvii)a variable heavy region comprising an amino acid sequence of SEQ ID NO: 140, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 141.
50. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, anda variable light chain region comprising an amino acid sequence of SEQ ID NO: 131.
51. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 118, and a light chain comprising an amino acid sequence of SEQ ID NO: 119; orii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 120, and a light chain comprising an amino acid sequence of SEQ ID NO: 121.
52. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 143;ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 144, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 145;iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 146, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 147;iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 148, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 149;v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 150, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 151;vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 152, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 153;vii)a variable heavy region comprising an amino acid sequence of SEQ ID NO: 154, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 155;viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 156, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 157;ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 158, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 159;x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 160, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 161;xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 162, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 163;xii)a variable heavy region comprising an amino acid sequence of SEQ ID NO: 164, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 165;xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 166, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 167;xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 170, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 171; orxv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 172, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 173; orxvi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 186, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 187.
53. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, anda variable light chain region comprising an amino acid sequence of SEQ ID NO: 143.
54. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 108, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 109;ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 110, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 111;iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 199, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 200;iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 201, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 202;v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 203, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 204;vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 205, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 206;vii)a variable heavy region comprising an amino acid sequence of SEQ ID NO: 207, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 208;viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 209, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 210;ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 211, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 212;x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 213, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 214;xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 215, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 216;xii)a variable heavy region comprising an amino acid sequence of SEQ ID NO: 217, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 218;xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 219, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 220;xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 221, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 222; orxv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 223, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 224.
55. An antibody or an antigen-binding fragment that binds a7pi integrin, wherein the antibody or antigen binding fragment comprises:i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 112, and a light chain comprising an amino acid sequence of SEQ ID NO: 113;ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 114, and a light chain comprising an amino acid sequence of SEQ ID NO: 113;iii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 115, and a light chain comprising an amino acid sequence of SEQ ID NO: 116; oriv) a heavy chain comprising an amino acid sequence of SEQ ID NO: 117, and a light chain comprising an amino acid sequence of SEQ ID NO: 116.
56. The antibody or antigen-binding fragment of any one of the preceding claims, wherein the antibody or antigen binding fragment has an affinity (Kd) to a7pi integrin or a fragment thereof of between about 0.1 to 300 nM.
57. The antibody or antigen-binding fragment of claim 56, wherein the a7pi integrin or a fragment thereof is a7pi ectodomain, pi ectodomain, a7 leg, calf-1 domain, calf-2 domain, or calf-1 and calf-2 domains.
58. The antibody or antigen-binding fragment of claim 56, wherein the a7pi integrin is a human a7pi integrin.
59. The antibody or antigen-binding fragment of claim 58, wherein the antibody has an affinity to a human a7pi ectodomain of about 3 to 6 nM.
60. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof activates a7pi integrin with a maximal efficacy or Emax of between about 100% to 300% as compared to the 20TFT or TS2 / 16 antibody.
61. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof has EC50 value of between 0.3 nM to 50 nM.
62. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof specifically binds a7pi integrin and does not bind a6pi integrin or a3piintegrin.
63. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a Fab, a single chain Fv (scFv), a single domain antibody (sdAb), a VHH, a variable heavy chain (VH), a variable light chain (VL), a Fab-like bispecific antibody (bsFab), a single- domain antibody-linked Fab (s-Fab), or a combination thereof.
64. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a humanized antibody.
65. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a human antibody.
66. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a chimeric antibody.
67. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is an IgG.
68. The antibody or antigen binding fragment thereof of claim 54, wherein the antibody or antigen binding fragment thereof is derived from IgGl, IgG2, IgG3, or IgG4.
69. The antibody or antigen binding fragment thereof of any one of preceding claims, wherein the antibody or antigen binding fragment thereof contains a Fc region.
70. The antibody or antigen binding fragment thereof of claim 69, wherein the Fc region contains one or more mutations.
71. A method of treating a disease or disorder in a subject associated with a a7pi integrin defect, comprising administering to the subject the antibody or antigen binding fragment thereof of any one of the preceding claims.
72. The method of claim 71, wherein the disease or disorder associated with a a7pi integrin defect is selected from a list comprising cardiomyopathy, congestive heart failure and muscular dystrophy.
73. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscular dystrophy.
74. The method of any one of claims 71-73, wherein the administration is to a muscle cell, wherein the muscle cell comprises a mutation in a dystrophin gene.
75. The method of claim 74, wherein the muscle cell lacks dystrophin or comprises a nonfunctional dystrophin.
76. The method of any one of claims 73-75, wherein the muscular dystrophy is Duchenne muscular dystrophy, Becker muscular dystrophy, limb girdle muscular dystrophy, Fukuyama congenital muscular dystrophy (FCMD) or merosin deficient congenital muscular dystrophy type 1A (MDC1A).
77. The method of claim 76, wherein the muscular dystrophy is Duchenne muscular dystrophy.
78. The method of claim 76, wherein the muscular dystrophy is Becker muscular dystrophy.
79. The method of any one of claims 73-78, wherein the administration reduces one or more serum biomarkers of muscle fiber damage.
80. The method of claim 79, wherein the one or more biomarkers is creatine kinase, LDH cytotox, and / or IL-6.
81. The method of any one of claims 73-80, wherein the administration reduces muscle damage, inflammation, fibrosis, necrosis and / or atrophy.
82. The method of any one of claim 73-81, wherein the administration increases muscle cell adhesion.
83. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in an increase in expression of a7.
84. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscle atrophy.
85. The method of claim 84, wherein the subject has reduced muscle loss as compared to a control upon administration of the antibody or the binding fragment thereof.
86. The method of claim 84, wherein the subject has less than 20% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof.
87. The method of claim 85 or 86, wherein the control is a baseline value prior to administration of the antibody or the binding fragment thereof.
88. The method of claim 85 or 86, wherein the control is historical data.
89. The method of claim 85 or 86, wherein the control is a comparable subject to which the antibody or antigen binding fragment thereof was not administered.
90. A pharmaceutical composition comprising the antibody or antigen binding fragment thereof of any one of claims 1-70, and a pharmaceutically acceptable carrier.
91. The pharmaceutical composition of claim 90, wherein the composition is for parenteral or oral administration.
92. The pharmaceutical composition of claim 90, wherein the composition is for administration by a route selected from intravenous, intradermal, transdermal, intraocular, intranasal, intramuscular, subcutaneous, and transmucosal.
93. A method of treating cardiomyopathy, congestive heart failure or other cardiac muscle disorder by administering to a subject in need thereof the antibody or antigen binding fragment thereof of any one of claims 1-70.
94. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for stabilizing the extended conformations of the a7pi integrin; andb) one or more physiologically acceptable carriers, excipients or diluents.
95. The antibody or antigen binding fragment thereof of any one of claims 1-70, wherein the antibody or the antigen-binding fragment binds to the (1701 integrin as measured by the Surface Plasmon Resonance (SPR) assay as described in Example 4.
96. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for stabilizing the extended conformations of the a701 integrin; andb) one or more physiologically acceptable carriers, excipients or diluents.
97. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising:a) an antibody means for increasing a7 expression; andb) one or more physiologically acceptable carriers, excipients or diluents.