Glycosylated mono(2-hydroxyethyl) terephthalic acid and glycosylated bis(2-hydroxyethyl) terephthalic acid
Patent Information
- Application Number
- CA3018435
- Authority / Receiving Office
- CA · CA
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2016-08-05
- Filing Date
- 2017-03-23
- Publication Date
- 2026-08-25
- Estimated Expiration
- 2037-03-23
Abstract
Description
Title: Glycosylated Mono(2-Hydroxyethyl) Terephthalic Acid and Glycosylated Bis(2-Hydroxyethyl) Terephthalic Acid FIELD OF THE INVENTION The invention concerns a compound containing mono(2-hydroxyethyl) terephthalic acid or bis(2-hydroxyethyl) terephthalic acid, which is used as a fine chemical, active ingredient or starting material for biohybrid polymers. PRIOR ART S. Yoshida et. al reported on the bacterial strain I. sakaiensis. It is able to attach to and degrade polyethylene terephthalate (abbreviation PET), a thermoplastic material from the polyester family produced by polycondensation. The enzyme PETase is released from the bacterial strain, it hydrolyses PET and produces mono(2-hydroxyethyl) terephthalic acid (MHET) (Fig. 1) (Lit. S. Yoshida et. al. Science 351, 1196 (2016); U. Bornscheuer, Science 351, 1154 (2016). In a further step MHET is hydrolysed to the monomers ethylene glycol and terephthalic acid. DESCRIPTION OF THE INVENTION PET is used for the production of plastic bottles (PET bottles), films, textile fibres and the like. Worldwide production is 40 million tons per year. Up to now, it has been difficult to break down PET into usable substances or to use it for synthesis. This object is achieved according to the invention by glycosylation of the substance mono(2-hydroxyethyl) terephthalic acid (MHET) and glycosylation of the substance bis(2- hydroxyethyl) terephthalic acid (BHET). The advantage of this invention is that it makes it possible to produce new chemical compounds from waste and degradation products from PET production. These chemical compounds comprise glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET). These chemical compounds can be used advantageously in various ways, for example as fine chemicals, active ingredients or biopolymers. Thus, the invention makes it possible to produce new chemicals from PET waste and degradation products. Another advantageous aspect of the invention is that the glycosylation of mono(2- hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid (BHET) and the other optional method steps of the invention can be carried out almost completely enzymatically. In addition, glycosylated compounds according to the invention have advantageous surface properties. Due to these properties, the compounds can be used in many ways according to the invention, for example as cell culture substrates. In addition, according to the invention, the glycosylation of the compounds of the present invention promotes their biodegradability and biocompatibility. For this reason the compounds according to the invention can be used advantageously in medical applications, especially in biomedical applications. The present invention thus provides the following preferred embodiments: Preferred embodiments: 1. Compound comprising glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET). 2. The compound according to Embodiment 1, wherein the MHET or BHET and a saccharide are chemically bonded to each other via a glycosidic bond. 3. Compound comprising mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2- hydroxyethyl) terephthalic acid chemically bonded to a saccharide. 4. The compound according to Embodiment 3, wherein the MHET or BHET and the saccharide are chemically bonded to each other via a glycosidic bond. 5. The compound according to at least one of Embodiments 2 to 4, wherein the saccharide is a monosaccharide or disaccharide. 6. The compound according to Embodiment 5, wherein the monosaccharide or disaccharide is selected from the group consisting of hexoses and pentoses. 7. The compound according to Embodiment 5 wherein the monosaccharide or disaccharide is selected from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-mannose, xylose, N- acetylglucosamine, glucosamine and glucuronic acid. 8. The compound according to at least one of Embodiments 1 to 7, wherein the compound is obtained by enzymatic glycosylation of MHET or BHET. 9. The compound according to at least one of Embodiments 1 to 8, wherein the compound is formed by enzymatic glycosylation of MHET or BHET. 10. The compound according to Embodiments 8 or 9, wherein the enzymatic glycosylation is catalysed by a glucosidase, a galactosidase or a fructosidase. 11. The compound according to Embodiment 10, wherein the enzymatic glycosylation is catalysed by a glucosidase. 12. The compound according to Embodiment 11, wherein the glucosidase is an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- glucosidase or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase. 13. The compound according to at least one of Embodiments 8 to 12, wherein the MHET or BHET is obtainable by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). 14. The compound according to at least one of Embodiments 8 to 13, wherein the MHET or BHET is formed by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). 15. The compound according to Embodiments 13 or 14, wherein the enzymatic degradation of PET is catalysed by a hydrolase. 16. The compound according to Embodiment 15, wherein the hydrolase PETase is from Idionella sakaiensis. 17. The compound according to Embodiment 15 or 16, wherein the hydrolase comprises the amino acid sequence shown in SEQ ID NO: 1. 18. The compound according to at least one of Embodiments 13 to 17, wherein the enzyme for the enzymatic glycosylation of MHET or BHET and the enzyme for the enzymatic degradation of PET are used together. 19. The compound according to Embodiment 18, wherein a microorganism containing the enzyme for enzymatic glycosylation and the enzyme for enzymatic degradation of PET is used. 20. The compound according to at least one of Embodiments 1 to 19, consisting of MHET or BHET chemically bonded to a saccharide via a glycosidic bond. 21. The compound according to at least one of Embodiments 1 to 20, wherein the compound has one of the following structures (a) or (b): (a) [Image disponible dans le document PDF, Image available in the PDF document] (b) [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond, and R2 comprises a saccharide bound via a glycosidic bond or is H. 22. The compound according to at least one of Embodiments 1 to 19, wherein the compound further comprises at least one methacrylic residue. 23. The compound according to embodiment 22, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond and R2 comprises a methacrylic residue. 24. The compound according to embodiment 23, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] 25. The compound according to embodiment 23, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] 26. Compound according to embodiment 23, said compound having the following structure: [Image disponible dans le document PDF, Image available in the PDF document] 27. The compound according to at least one of Embodiments 1 to 19, wherein the compound comprises a lipophilic side chain. 28. The compound according to Embodiment 27, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond and R2 comprises a lipophilic side chain, preferably a saturated or unsaturated aliphatic hydrocarbon side chain, or a linker. 29. The compound according to Embodiment 28, wherein <semantics>R2<annotation encoding="application / x-tex">R_2< / annotation>< / semantics> is a saturated or unsaturated aliphatic <semantics>C5<annotation encoding="application / x-tex">C_5< / annotation>< / semantics> to <semantics>C20<annotation encoding="application / x-tex">C_{20}< / annotation>< / semantics> hydrocarbon side chain, preferably a saturated or unsaturated aliphatic <semantics>C5<annotation encoding="application / x-tex">C_5< / annotation>< / semantics> to <semantics>C15<annotation encoding="application / x-tex">C_{15}< / annotation>< / semantics> hydrocarbon side chain, more preferably a saturated or unsaturated aliphatic <semantics>C8<annotation encoding="application / x-tex">C_8< / annotation>< / semantics> to <semantics>C12<annotation encoding="application / x-tex">C_{12}< / annotation>< / semantics> hydrocarbon side chain, more preferably a saturated or unsaturated aliphatic C10 hydrocarbon side chain and more particularly preferably a saturated aliphatic C10 hydrocarbon side chain. 30. The compound according to Embodiment 28 selected from a compound having the following structure (a) to (j): OH (a) П, HO 0 [Image disponible dans le document PDF, Image available in the PDF document] (b) [Image disponible dans le document PDF, Image available in the PDF document] (c) (d) • [Image disponible dans le document PDF, Image available in the PDF document] (e) (f) (g) (h) (i) . . (j) [Image disponible dans le document PDF, Image available in the PDF document] wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. 31. The compound according to Embodiments 2 to 24, 26 to 29 or 30(b)-(j), wherein the saccharide chemically bonded to MHET or BHET via a glycosidic bond is methacrylated. 32. A Polymer of a compound according to at least one of Embodiments 1 to 31. 33. The polymer according to Embodiment 32, wherein the polymer is a biohybrid polymer. 34. A method for preparing a compound comprising glycosylated mono(2- hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET), said method comprising the step of enzymatic glycosylation of mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2- hydroxyethyl) terephthalic acid (BHET). 35. The method according to embodiment 34, wherein in the step of enzymatic glycosylation the MHET or BHET and a saccharide are chemically bonded together via a glycosidic bond. 36. The method according to Embodiment 35, wherein the saccharide is a monosaccharide or disaccharide. 37. The method according to Embodiment 36, wherein the monosaccharide or disaccharide is selected from a group containing hexoses and pentoses. 38. The method according to Embodiment 37 wherein the monosaccharide or disaccharide is selected from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-mannose, xylose, N- acetylglucosamine, glucosamine and glucuronic acid. 39. The method according to at least one of Embodiments 34 to 38, wherein the enzymatic glycosylation is catalysed by a glucosidase, a galactosidase or a fructosidase. 40. The method according to Embodiment 39, wherein the enzymatic glycosylation is catalysed by a glucosidase. 41. The method according to Embodiment 40, wherein the glucosidase is an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- glucosidase or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase. 42. The method according to at least one of the Embodiments 34 to 41, wherein the MHET or BHET is obtainable by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). 43. The method according to at least one of the Embodiments 34 to 42, wherein the method preferably comprises a step of bacterial degradation or enzymatic degradation of polyethylene terephthalate (PET) to MHET or BHET before the step of enzymatic glycosylation. 44. The method according to Embodiment 42 or 43, wherein the enzymatic degradation of PET is catalysed by a hydrolase. 45. The method according to Embodiment 44, wherein the hydrolase PETase is from Idionella sakaiensis. 46. The method according to Embodiment 44 or 45, wherein the hydrolase comprises the amino acid sequence shown in SEQ ID NO: 1. 47. The method according to at least one of Embodiments 42 to 46, wherein the enzyme for the enzymatic glycosylation of MHET or BHET and the enzyme for the enzymatic degradation of PET are used together. 48. The method according to Embodiment 47, wherein a microorganism containing the enzyme for enzymatic glycosylation and the enzyme for enzymatic degradation of PET is used. 49. The method according to one of Embodiments 34 to 48, wherein a methacrylic residue is chemically bonded to the glycosylated MHET or BHET in a further step, wherein the methacrylic residue is preferably chemically bonded to the glycosylated MHET or BHET by enzymatic esterification, wherein the enzymatic esterification is preferably catalysed by a lipase. 50. The method according to Embodiment 49, wherein the methacrylic residue is chemically bonded to the glycosylated MHET or BHET by addition of vinylmethyl methacrylate. 51. The method according to at least one of Embodiments 34 to 48, wherein a lipophilic side chain, preferably a saturated or unsaturated aliphatic hydrocarbon side chain, is chemically bonded to the glycosylated MHET or BHET in a further step. 52. The method according to claim 51, wherein the lipophilic side chain is a saturated or unsaturated C5 to C20 hydrocarbon side chain, preferably a saturated or unsaturated C5 to C15 hydrocarbon side chain, more preferably a saturated or unsaturated C8 to C12 hydrocarbon side chain, more preferably a saturated or unsaturated <semantics>C10<annotation encoding="application / x-tex">C_{10}< / annotation>< / semantics> hydrocarbon side chain and especially preferably a saturated <semantics>C10<annotation encoding="application / x-tex">C_{10}< / annotation>< / semantics> hydrocarbon side chain. 53. The method according to Embodiment 52, wherein the lipophilic side chain is a saturated C10 hydrocarbon side chain. 54. The method according to one of Embodiments 51 to 53, wherein the lipophilic side chain is bound by addition of decanol. 55. The method according to at least one of Embodiments 34 to 54, wherein a step of polymerisation follows after the step of enzymatic glycosylation. 56. A Polymer obtainable by the method according to one of Embodiments 34 to 55. 57. The polymer according to Embodiment 56, wherein the polymer is a biohybrid polymer. 58. A Microorganism containing at least one enzyme for the enzymatic glycosylation of MHET and / or BHET and at least one enzyme for the enzymatic degradation of PET. 59. The microorganism according to Embodiment 58, wherein the microorganism is a recombinant microorganism and the enzyme for enzymatic glycosylation of MHET and / or BHET and / or the enzyme for enzymatic degradation of PET is a recombinant enzyme. 60. The microorganism according to Embodiment 58 or 59, wherein the enzyme for enzymatic glycosylation is a glucosidase, a galactosidase or a fructosidase. 61. The microorganism according to Embodiment 60, wherein the enzyme for the enzymatic glycosylation is a glucosidase. 62. The microorganism according to Embodiment 61, wherein the glucosidase is an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- glucosidase or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase. 63. The microorganism according to at least one of the Embodiments 58 to 62, wherein the enzyme for the enzymatic degradation of PET is a hydrolase. 64. The microorganism according to Embodiment 63, wherein the hydrolase PETase is from Idionella sakaiensis. 65. The microorganism according to Embodiment 63 or 64, wherein the hydrolase comprises the amino acid sequence shown in SEQ ID NO: 1. 66. A Compound produced by enzymatic glycosylation of mono(2-hydroxyethyl) terephthalic acid (MHET) or bis( 2-hydroxyethyl) terephthalic acid, wherein MHET or bis(2-hydroxyethyl) terephthalic acid is produced by bacterial or enzymatic degradation from PET. 67. A compound characterised by a mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid chemically bound to a saccharide. 68. The compound according to Embodiments 66 and 67, wherein the MHET or bis(2- hydroxyethyl) terephthalic acid and the saccharide are chemically bonded to each other via a glycoside bond. 69. A compound, which can be polymerised after glycosylation of mono(2- hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid. 70. The compound according to Embodiment 66 or 67, wherein the saccharide is a monosaccharide or disaccharide. 71. The compound according to Embodiment 70, said monosaccharide or disaccharide being selected from the group consisting of hexoses and pentoses (<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- mannose, xylose, N-acetylglucosamine, glucosamine, glucuronic acid). BRIEF DESCRIPTION OF THE DRAWINGS Fig. 1: Figure from: U. Bornscheuer, Science 351, 1154 (2016); Decomposition of PET by I. sakaiensis. Fig. 2: Exemplary representation of the MHET obtained from PET using microorganisms. Fig. 3: A biohybrid polymer made of glycosylated MHET. Fig. 4: Glycosylated MHET is used as active ingredient, fine chemical or for the synthesis of polymers. Fig. 5: Exemplary structure of a biohybrid polymer of glucosylated MHET or bis(2- hydroxyethyl) terephthalic acid. Fig. 6: Glycosylated MHET and glycosylated bis(2-hydroxyethyl) terephthalic acid can be combined with methacrylate. For this purpose, methacrylate is esterified enzymatically with one or more alcohol functions of MHET or bis(2-hydroxyethyl) terephthalic acid. Fig. 7: Glycosylated MHET and glycosylated bis(2-hydroxyethyl) terephthalic acid can be combined with methacrylate. For this purpose, methacrylate is esterified enzymatically with one or more alcohol functions of MHET or bis(2-hydroxyethyl) terephthalic acid. Fig. 8: Synthesized glycosylated BHET methacrylates and glycosylated MHET methacrylates can be polymerised using a radical initiator, e.g. potassium peroxodisulfate. Fig. 9: Synthetized glycosylated BHET methacrylates and glycosylated MHET methacrylates can be polymerised with the aid of a radical initiator, e.g. potassium peroxodisulfate. Fig. 10: Synthesized glycosylated BHET methacrylates and glycosylated MHET methacrylates can be polymerised with the aid of a radical initiator, e.g. potassium peroxodisulfate. Fig. 11: Glycosylated MHET and glycosylated bis(2-hydroxyethyl) terephthalic acid can also be linked to aliphatic alcohols. For this e.g. dodecanol esterified enzymatically with BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 12: Instead of decanol, thiols, amines and other alcohols can also be conjugated with glycosylated BHET. Fig. 13: Exemplary representation of the structure of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated MHET. Fig. 14: Exemplary representation of the structure of MHET. Fig. 15: Exemplary representation of the structure of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glycosylated MHET. Fig. 16: 1H-NMR spectrum of β-glycosylated MHET. Fig. 17: 13C-NMR spectrum of β-glycosylated MHET. Fig. 18: Exemplary representation of the structure of Di-1,3-β-glucosylated MHET. Fig. 19: Exemplary representation of the structure of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosylated MHET. Fig. 20: 1H-NMR spectrum of β-galactosylated MHET. Fig. 21: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosylated MHET. Fig. 22: Example of the structure of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 23: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 24: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 25: Exemplary representation of the structure of <semantics>di−α−1,6<annotation encoding="application / x-tex">di-\alpha-1,6< / annotation>< / semantics>-glucosylated bis(2- hydroxyethyl)terephthalate. Fig. 26: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of di-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-1,6-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 27: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of di-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-1,6-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 28: Example of the structure of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 29: 1H-NMR spectrum of β-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 30: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 31: Example of the structure of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosylated bis(2-hydroxyethyl)terephthalate. Fig. 32: 1H-NMR spectrum of β-galactosylated bis(2-hydroxyethyl)terephthalate. Fig. 33: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosylated bis(2-hydroxyethyl)terephthalate. Fig. 34: Exemplary representation of the structure of Di-β-glucosylated bis(2- hydroxyethyl)terephthalate. Fig. 35: 1H-NMR spectrum of Di-β-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 36: 13C-NMR spectrum of Di-β-glucosylated bis(2-hydroxyethyl)terephthalate. Fig. 37: Exemplary representation of the structure of glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 38: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 39: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 40: Exemplary representation of the structure of glycosylated MA2-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 41: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of glycosylated MA2-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 42: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated MA2-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc. Fig. 43: Exemplary representation of the structure of glycosylated <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET decanol. Fig. 44: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of glycosylated <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET decanol. Fig. 45: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET decanol. Fig. 46: Exemplary representation of the structure of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET. Fig. 47: <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET. Fig. 48: <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET. Fig. 49: Detection of the polymer; the 1H-NMR spectrum of the polymer is shown. Fig. 50: Exemplary 13C-NMR spectrum of MHET shown DETAILED DESCRIPTION OF THE INVENTION Definitions and general techniques Unless otherwise indicated, the terms used in this invention are to be understood in their usual meaning for the skilled person. Terms such as "comprise" or "comprising" are used here in such a way that any occurrence of these terms can optionally be replaced by "consist of" or "consisting of". Terms such as "contain" or "containing" are used here in their usual meaning for the skilled person. Optionally, each occurrence of these terms can be replaced by "consist of" or "consisting of". The term "compound" is used here in such a way as it would be understood by the skilled person, i.e. meaning "chemical compound" in particular. The term "compound comprising glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET)" should be understood to mean that with the respective mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid (BHET) optional also esters, amides, thioesters and ethers of the respective mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid (BHET) are meant. In one embodiment esters, amides, thioesters and ethers of the respective mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid (BHET) are not comprised under the term "compound comprising glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET)". The glycosidic bond is the chemical bond between the anomeric carbon atom of a glycon, i.e. a saccharide, and the hetero or less common carbon atom of an aglycon, a "non- sugar". A glycosidic bond can be both an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosidic bond and a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glycosidic bond. The prefixes <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> define the anomeric configuration. A glycosidic bond can be formed by enzymatic glycosylation. Enzymatic glycosylation can be catalysed by a glycosidase, glycosidases belonging to the enzyme class of hydrolases and being classified under EC 3.2.1.. Glycosidases can reversibly hydrolyse <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- or <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glycosidic bonds. Examples of glycosidases comprise glucosidases, galactosidases, sialidases, mannosidases, fucosidases, xylosidases, glucuronidase, α-L- arabinofuranosidase, exo-β-glucosaminidase, galacturonase, glucosaminidase, N- acetylglucosaminidase and fructosidases. Specifically, a glycosidase can be an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucosidase. Furthermore, a glycosidase can be a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosidase. Lipophilic can particularly mean hydrophobic. Lipophilic side chains comprise, for example, hydrocarbons, and in particular aliphatic hydrocarbons. A hydrocarbon side chain is a side chain consisting of carbon and hydrogen. The hydrocarbon side chain can be saturated or unsaturated. An unsaturated hydrocarbon side chain includes both a monounsaturated and a polyunsaturated hydrocarbon side chain. The hydrocarbon side chain may contain double bonds and triple bonds between two carbon atoms. Furthermore, individual carbon atoms in the hydrocarbon chain can optionally be replaced by heteroatoms. The hydrocarbon chain can be unbranched or branched. The hydrocarbon chain can be acyclic or cyclic. In multiple glycosylations, the acceptor is typically glycosylated first. If sufficient monoglycosylated acceptor is present in the reaction mixture, multiple glycosylations may occur. As glycosidases for enzymatic syntheses can be used, for example: α glucosidase (sucrose isomerase): in suspension of microorganisms (Protaminobacter rubrum Z 12 (CBD 574.77)). It can preferably be used for monoglucosylation. The optimal pH value for the enzymatic reaction is pH = 6. α glucosidase, GTFR from Streptococcus oralis first transfers glucose to the acceptor. After a longer reaction time, another glucose unit is transferred to the glucose of the glucosylated acceptor, as demonstrated in example (6). The optimal pH value for the enzymatic reaction is pH = 6. GTFR can be purified from S. oralis as in Fujiwara et al. (Fujiwara et al., Infect Immun., 2000; 68(5):2475-83 2000). β glucosidase from almonds EC.3.2.1.21, CAS 9001-22-3 (BioChemika 49290, WA10531). The optimal pH value for the enzymatic reaction is <semantics>pH=5.2<annotation encoding="application / x-tex">pH = 5.2< / annotation>< / semantics>. β galactosidase from Aspergillus oryzae, CAS 9031-11-2 (Sigma G5160-25KU). The optimal pH value for the enzymatic reaction is <semantics>pH=5.2<annotation encoding="application / x-tex">pH = 5.2< / annotation>< / semantics>. β fructosidase from yeast (Boehringer Mannheim GmbH, order number 104914). The optimal pH value for the enzymatic reaction is <semantics>pH=5.2<annotation encoding="application / x-tex">pH = 5.2< / annotation>< / semantics>. Lipase Novozymes 435 can be used for enzymatic esterification or transesterification. The optimal pH value for the enzymatic reaction is <semantics>pH=7.5<annotation encoding="application / x-tex">pH = 7.5< / annotation>< / semantics>. General description of the separation of reaction mixtures and isolation of reaction products according to the invention: All compounds of the invention can be isolated. Accordingly, all methods according to the invention preferably include the isolation of the respective compound. This can preferably be done as follows: The reaction mixtures are distilled off from solvents or lyophilized. Glycosylated MHET or glycosylated BHET is separated by column chromatography. The chromatography material is silica gel 60 (Macherey Nagel, 0.044-0.063 mm). For each gram of reaction mixture to be separated, 100 g silica gel are used. The separation vessels are glass columns. Preferably columns with a diameter to length of 1:20 are used. The silica gel is sponged in a solvent mixture of ethyl acetate: isopropanol: water (volume ratio 6:3:1), for non-polar substances a mixture of ethyl acetate: methanol (volume ratio 12:1) is used, and the column is filled. Then the reaction mixture is dissolved in as little solvent as possible (preferably 1g in 1ml) and placed on the column. Separation takes place by elution with the solvent. The eluate is collected in vessels (a 10ml) and determined by HPLC in which vessels the product is contained. The vessels are combined with the product and the solvents are evaporated. A solid is obtained. Embodiments In the invention, MHET or bis(2-hydroxyethyl) terephthalic acid is glycosylated using an enzyme and a glycose substrate. Disaccharides (e.g. sucrose, lactose, maltose), oligosaccharides (maltooligosaccharides) or polysaccharides (dextran, fructooligosaccharides, chitin, mannan, cellulose) are used as glycosubstrates. The preparation of glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid can be carried out from MHET or bis(2-hydroxyethyl) terephthalic acid. MHET or bis(2-hydroxyethyl) terephthalic acid can be produced from PET using a hydrolase, e.g. with the PETase from 1. sakaiensis, e.g. having the amino acid sequence shown in SEQ ID NO: 1: MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGA GTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALR QVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVP TLIFACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSHSCANSGNSNQALIGKKGVAWMKRFMDN DTRYSTFACENPNSTRVSDFRTANCS (SEQ ID NO: 1). Both enzymes can be used together. A microorganism containing both enzymes can also be used for production (see Fig. 2). The compound of the invention is characterised by a MHET or bis(2-hydroxyethyl) terephthalic acid chemically bonded to a saccharide. Glycosylated MHET or bis(2- hydroxyethyl) terephthalic acid can be used as an active ingredient. Glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid can also be polymerised to biohybrid polymers (see Fig. 3). Especially preferred, MHET or bis(2-hydroxyethyl) terephthalic acid and the saccharide are chemically bonded to each other via a glycosidic bond. The glycosidic bond is the chemical bond between the anomeric carbon atom of a glycon, i.e. a saccharide, and the hetero or less common carbon atom of an aglycon, a "non-sugar". Compounds containing a glycosidic bond are commonly referred to as glycosides. The hydrolysis of a glycosidic bond in a glycoside is reversibly catalysed in particular by glucosidases, wherein the glycon, i.e. the saccharide present, and the aglycon, here MHET or bis(2-hydroxyethyl) terephthalic acid, are released using a water molecule. Preferably the saccharide is a monosaccharide. Monosaccharides are simple sugars with a basic structure of at least three linked carbon atoms which have a carbonyl group (-C=O) and at least one hydroxyl group (-OH). Glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid serves as a fine chemical, active ingredient or starting material for biohybrid polymers (see Fig. 4). By polycondensation of glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid a thermoplastic polymer of the polyester family can be formed. By polycondensation of glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid a thermoplastic from the polyester family is formed. Furthermore, a polyester can be prepared by transesterification of di- and monoglucosylated bis(2-hydroxyethyl) terephthalic acid with ethanediol. Since this is an equilibrium reaction, split-off ethanediol is distilled in albumin. The glycosylated bis(2- hydroxyethyl) terephthalic acid is enriched. Likewise, mono- and diglycosylated bis(2- hydroxyethyl) terephthalic acid is esterified directly with terephthalic acid to a polyester. Antimony(III) oxide, for example, can be used as a catalyst. A biohybrid polymer of glucosylated MHET or bis(2-hydroxyethyl) terephthalic acid can assume the structure from Fig. 5. Glycosylated MHET and BHET methacrylates Similarly, glycosylated MHET and glycosylated bis(2-hydroxyethyl) terephthalic acid can be combined with methacrylate. For this purpose, methacrylate is esterified enzymatically with one or more alcohol functions of MHET or bis(2-hydroxyethyl) terephthalic acid. When BHET-α-Glc is reacted with vinyl methyl acrylate at 50°C and Lipase Novozymes 435, when tert-butyl alcohol is used as the solvent, the double esterified product MA2- BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc and the single glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc (Fig. 6) is formed. Polymerisation of glycosylated BHET methacrylates and glycosylated MHET methacrylates The synthesized glycosylated BHET methacrylates and glycosylated MHET methacrylates can be polymerised using a radical initiator, e.g. potassium peroxodisulfate (Fig. 8, Fig.9, Fig. 10). It is also possible to mix various methacrylates in different ratios and polymerise the mixtures. In this way, block polymers can also be produced. Glycosylated MHET and BHET lipids Glycosylated MHET and glycosylated bis(2-hydroxyethyl) terephthalic acid can also be linked to aliphatic alcohols. For this purpose, e.g. decanol is enzymatically esterified with BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc (Fig. 11). When BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc is reacted with decanol at 50°C and Lipase Novozymes 435, when using the solvent tert-Butanol, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET-Decanol is preferably produced (Fig.11). Instead of decanol, thiols, amines and other alcohols can also be conjugated with glycosylated BHET. This allows the introduction of different linkers that contain biotin or can be used for bioorthogonal click reactions to build cell culture scaffolds (Fig. 12). It is particularly preferable that the monosaccharide is selected from a group containing pentoses and hexoses. Hexoses (<semantics>C6H12O6<annotation encoding="application / x-tex">C_6H_{12}O_6< / annotation>< / semantics>) have a carbon backbone with six carbon atoms and differ fundamentally in the type of carbonyl function. With a non-terminal carbonyl function <semantics>(R1−C(O)−R2)<annotation encoding="application / x-tex">(R_1-C(O)-R_2)< / annotation>< / semantics>, a ketogroup, a ketohexose is meant. A terminal carbonyl function, an aldehyde group, is aldohexose. Pentoses (<semantics>C5H10O5<annotation encoding="application / x-tex">C_5H_{10}O_5< / annotation>< / semantics>) have a carbon backbone with five carbon atoms. The hexoses are preferably selected from a group containing <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-mannose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, N-acetyl glucosamine, glucosamine, glucuronic acid. Depending on which saccharide is chemically bound to the MHET or bis(2-hydroxyethyl) terephthalic acid, the nomenclature of the compound also differs. In an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> glucose chemically bound to MHET or bis(2- hydroxyethyl) terephthalic acid, the compound is <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> glucosylated MHET or bis (2- hydroxyethyl) terephthalic acid. An <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> galactose as chemically bound saccharide is called <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> galactosylated MHET or bis(2-hydroxyethyl) terephthalic acid. If an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> fructose is bound to the MHET as saccharide, it is <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> or <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics> fructosylated MHET or bis(2- hydroxyethyl) terephthalic acid. Advantageously, the pentoses are selected from a group containing xylose, arabinose or xylose. In a particularly advantageous embodiment of the invention <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics> glucose is connected via a glycosidic bond with MHET or bis(2-hydroxyethyl) terephthalic acid. Synthesis of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>- glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid is carried out with water separation from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose and MHET or bis(2-hydroxyethyl) terephthalic acid. This produces <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated MHET or bis(2-hydroxyethyl) terephthalic acid. The compound <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated MHET is preferably characterised by the structural formula shown in Fig. 13. In the synthesis of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated MHET, a glycosidic bond is formed between <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose and MHET. Bonding is particularly advantageous selectively via the hydroxyl group of the MHET bonded to the 1' carbon atom. The oxygen atom bridging the <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose with the MHET comes from the MHET. In principle, this bond linkage - independent of the saccharide used - preferably occurs selectively via the hydroxyl group of the MHET bonded to the 1' carbon atom. The enzyme used is responsible for the selectivity of the bond linkage at the 1'C atom. In the following, exemplary embodiments of the invention will be explained in more detail with reference to the manufacturing methods of the compound. EXAMPLES All following exemplary embodiments were carried out experimentally. MHET is shown as an example in Fig. 14. NaHCO3 (3.05g, 36 mmol) was added to a solution of terephthalic acid (2.00g, 12.04 mmol) in DMF (15ml). The mixture was stirred for 50 minutes at 85°C. Then 2-bromo-1-ethanol (0.75g, 426 µl, 6 mmol) was added and stirred for another 4h at 85°C. The course of the reaction is monitored by thin-layer chromatography (MeOH / CH2Cl2, 1:4). The reaction mixture is then filtered over silica and separated after concentration in silica (MeOH / CH2Cl2, 1:4). For the spectroscopic detection of MHET, 1H-NMR spectra and 13C-NMR spectra were recorded. The 1H-NMR spectrum 1 was recorded at 400 MHz in deuterated dimethyl sulfoxide, the assignment of the signals is shown in Table 1. Table 1: Signal assignment 1H-NMR spectrum of MHET [Image disponible dans le document PDF, Image available in the PDF document] Fig. 50 shows an example 13C-NMR spectrum of MHET. The 13C-NMR spectrum 11 was also recorded at 100 MHz in deuterated dimethyl sulfoxide. The assignment of the signals is listed in Table 2. Table 2: Signal assignment of the 13C-NMR spectrum of MHET [Image disponible dans le document PDF, Image available in the PDF document] MHET is clearly determined by the chemical shifts of the signals of the H or C atoms and the integral values (in the case of the H atoms), which can be taken from the tables. A mass spectrum was also measured. This also confirms MHET. MS (ESI, negative): calculated for <semantics>C10H9O5<annotation encoding="application / x-tex">C_{10}H_9O_5< / annotation>< / semantics> (M-H)- 209.045; gem. 209.045 (2) Production of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET MHET (0.05 mol / l) and sucrose (0.4 mol / l) are dissolved in 0.05 M phosphate buffer (0.05 mol / l, pH = 6) and a suspension of microorganisms (Protaminobacter rubrum Z 12 (CBS 574.77)) is added. In an alternative embodiment, an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosidase solution (100 U in phosphate buffer) is added. Sucrose consists of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose, which are linked via an <semantics>α,β<annotation encoding="application / x-tex">\alpha,\beta< / annotation>< / semantics>-1,2- glycosidic bond. The microorganism Protaminobacter rubrum Z 12 contains an enzyme, an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosidase. It catalyses the cleavage of the sucrose used into <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D- fructose. The <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose chemically binds to the MHET during the reaction. For this purpose, the reaction mixture is shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. The product <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated MHET is obtained. Optimal product formation is determined by continuous sampling and thin-layer chromatography. <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET is shown in Fig. 13 as an example. The test results of the embodiment with a suspension of microorganisms (Protaminobacter rubrum Z 12 (CBS 574.77)) are as follows. The product is confirmed by mass spectrometry (MT203). MS (ESI, negative): calculated for <semantics>C16H19O10<annotation encoding="application / x-tex">C_{16}H_{19}O_{10}< / annotation>< / semantics> (M-H) 371.0978; according to 371.09727 (3) Production of β-glucosylated MHET MHET (0.05 mol / l) and cellobiose (0.4 mol / l) are dissolved in sodium acetate buffer (0.05 mol / l, pH = 5.2) or phosphate buffer (0.05 mol / l, pH = 7) and a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase solution (100 U in sodium acetate buffer or phosphate buffer) is added. Cellobiose is a disaccharide consisting of two glucose molecules linked together by <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-1,4-glucoside. The enzyme <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucosidase enables the degradation of cellobiose to glucose. The glucose binds chemically to the MHET during the reaction. The reaction mixture is also shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. After column chromatography, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucosylated MHET is obtained. β-glucosylated MHET is shown in Fig. 15 as an example. The test results of the embodiment with sodium acetate buffer are as follows. The product is confirmed by mass spectrometry (MT204). MS (ESI, negative): calculated for <semantics>C16H19O10<annotation encoding="application / x-tex">C_{16}H_{19}O_{10}< / annotation>< / semantics> (M-H) 371.0978; according to 371.0972. Further test results are shown in Fig. 16, Fig. 17 and the following tables. Table 3: Signal assignment 1H-NMR spectrum of β-glucosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] Table 4: Signal assignment 13C-NMR spectrum of β-glucosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] * Di-1,3-β-glucosylated MHET MS (ESI, positive): calculated for <semantics>C22H30NaO15<annotation encoding="application / x-tex">C_{22}H_{30}NaO_{15}< / annotation>< / semantics> (M-H)- 557.1482; according to .557.1477. Di-1,3-β-glucosylated MHET is shown as an example in Fig. 18. Further test results are shown in the following tables. Table 5: Signal assignment 1H-NMR spectrum of Di-1,3-β-glucosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 6: Signal assignment 13C-NMR spectrum of Di-1,3-β-glucosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] . [Image disponible dans le document PDF, Image available in the PDF document] (4) Production of β-galactosylated MHET MHET (0.05 mol / l) and cellobiose (0.4 mol / l) are dissolved in sodium acetate buffer (0.05 mol / l, pH = 5.2) or phosphate buffer (0.05 mol / l, pH = 7) and a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase solution (100 U in sodium acetate buffer or phosphate buffer) is added. Lactose consists of D-galactose and D-glucose, which are linked by a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-1,4-glycosidic bond. <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosidase enzymatically catalyses the hydrolysis of this bond, producing galactose, which chemically binds to the MHET during the reaction. For this purpose, the reaction mixture is shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. The product β-galactosylated MHET is isolated by column chromatography. β-galactosylated MHET is shown in Fig. 19 as an example. The test results of the embodiment with sodium acetate buffer are as follows. The product is confirmed by mass spectrometry (MT206). MS (ESI, negative): calculated for <semantics>C16H19O10<annotation encoding="application / x-tex">C_{16}H_{19}O_{10}< / annotation>< / semantics> (M-H)- 371.0978; according to 371.0975. Further test results are shown in Fig. 20, Fig. 21 and the following tables. Table 7: Signal assignment 1H-NMR spectrum of β-galactosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 8: Signal assignment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] (5) Production of fructosylated MHET MHET(0.05 mol / l) and sucrose (0.4 mol / l) were dissolved in sodium acetate buffer (0.05 <semantics>mol / l<annotation encoding="application / x-tex">mol / l< / annotation>< / semantics>, pH = 5.2) and a fructosidase solution (100 U in sodium acetate buffer) was added. The fructosidase solution enzymatically catalyses the cleavage of sucrose into <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose. The <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose chemically binds to the MHET during the reaction. For this purpose, the reaction mixture is also shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. (6) Production of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate Bis(2-hydroxyethyl)terephthalate (0.05 mol / l) and sucrose (0.4 mol / l) are dissolved in 0.05 M phosphate buffer (0.05 mol / l, pH = 7) or are dissolved in 0,05 M phosphate buffer (0.05 mol / l, pH = <semantics>12<annotation encoding="application / x-tex">\frac{1}{2}< / annotation>< / semantics>) or are dissolved in 0,05 M phosphate buffer (0.05 mol / l, pH = <semantics>12<annotation encoding="application / x-tex">\frac{1}{2}< / annotation>< / semantics>) or are dissolved in 0,05 M phosphat mol / l, pH = 6) dissolved and a suspension of microorganisms (Protaminobacter rubrum Z 12 (CBD 574.77)) is added. In an alternative embodiment example, a -glucosidase solution (100 U in phosphate buffer) is added. Sucrose consists of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose, which are linked via an <semantics>α,β<annotation encoding="application / x-tex">\alpha,\beta< / annotation>< / semantics>-1,2- glycosidic bond. The microorganism Protaminobacter rubrum Z 12 contains an enzyme, an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosidase. It catalyses the cleavage of the used sucrose into <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D- fructose. The <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose chemically binds to the bis(2-hydroxyethyl)terephthalate during the reaction. For this purpose, the reaction mixture is shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. The product <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glycosylated bis(2-hydroxyethyl)terephthalate is obtained. Optimal product formation is determined by continuous sampling and thin-layer chromatography. <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate is shown as an example in Fig. 22. Test results of the embodiment with 0.05 M phosphate buffer (0.05 mol / l, pH = 6) and a suspension of microorganisms (Protaminobacter rubrum Z 12 (CBD 574.77)) are shown in Fig. 23, Fig. 24 and in the following tables. Table 9: Signal assignment <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] Table 10: Signal assignment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Di-α-1,6-glucosylated bis(2-hydroxyethyl)terephthalate <semantics>Di−α−1,6<annotation encoding="application / x-tex">Di-\alpha-1,6< / annotation>< / semantics>-glucosylated bis(2-hydroxyethyl)terephthalate is shown in Fig. 25 as an example. Further test results are shown in Fig. 26, Fig. 27 and the following tables. Table 11: Signal assignment <semantics>1<annotation encoding="application / x-tex">^{1}< / annotation>< / semantics>H-NMR spectrum of Di-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-1,6-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 12: Signal assignment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of Di-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-1,6-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] (7) Production of β-glucosylated bis(2-hydroxyethyl)terephthalate Bbis(2-hydroxyethyl)terephthalate (0.05 mol / l) and cellobiose (0.4 mol / l) are dissolved in sodium acetate buffer (0.05 mol / l, pH = 5.2) and a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase solution (100 U in sodium acetate buffer) is added. Cellobiose is a disaccharide consisting of two glucose molecules linked together by <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-1,4-glucoside. The enzyme <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosidase enables the degradation of cellobiose to glucose. The glucose chemically binds to the bis(2- hydroxyethyl)terephthalate during the reaction. The reaction mixture is also shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. After column chromatography, β- glucosylated bis(2-hydroxyethyl)terephthalate is obtained (see Fig. 28). Further test results are shown in Fig. 29, Fig. 30 and the following tables. Table 13: Signal assignment 1H-NMR spectrum of β-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] · Table 14: Signal assignment <semantics>13C-NMR<annotation encoding="application / x-tex">^{13}\text{C-NMR}< / annotation>< / semantics> spectrum of <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucosylated bis(2- hydroxyethyl)terephthalate . [Image disponible dans le document PDF, Image available in the PDF document] (8) Production of β-galactosylated bis(2-hydroxyethyl)terephthalate Bis(2-hydroxyethyl)terephthalate (0.05 mol / l) and lactose (0.4 mol / l) are dissolved in sodium acetate buffer (0.05 mol / l, pH = <semantics>5.2<annotation encoding="application / x-tex">5.2< / annotation>< / semantics>) or phosphate buffer (0.05 mol / l, pH = <semantics>7<annotation encoding="application / x-tex">7< / annotation>< / semantics>) and a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactosidase solution (100 U in sodium acetate buffer or phosphate buffer) is added. Lactose consists of D-galactose and D-glucose, which are linked by a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-1,4-glycosidic bond. B-galactosidase enzymatically catalyses the hydrolysis of this bond, producing galactose, which chemically binds to bis(2-hydroxyethyl)terephthalate during the reaction. For this purpose, the reaction mixture is also shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. The product <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- galactosylated bis(2-hydroxyethyl)terephthalate is isolated by column chromatography. β-galactosylated bis(2-hydroxyethyl)terephthalate is shown as an example in Fig. 31. Test results of the embodiment with sodium acetate buffer are shown in Fig.32, Fig. 33 and in the following tables. Table 15: Signal assignment 1H-NMR spectrum of β-galactosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 16: Signal assignment 13C-NMR spectrum of β-galactosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] · Di- β-galacosylated bis(2-hydroxyethyl)terephthalate MS (ESI, positive): calculated for <semantics>C24H34NaO16<annotation encoding="application / x-tex">C_{24}H_{34}NaO_{16}< / annotation>< / semantics> (M-H) 601.1745; according to 601.1739. Di-β-glucosylated bis(2-hydroxyethyl)terephthalate Di-β-glucosylated bis(2-hydroxyethyl)terephthalate is shown as an example in Fig. 34. The product is confirmed by mass spectrometry. MS (ESI, positive): calculated for <semantics>C24H34O16Na<annotation encoding="application / x-tex">C_{24}H_{34}O_{16}Na< / annotation>< / semantics> (M-H)+ 601.1745, according to 601.1739. Further test results are shown in Fig. 35, Fig. 36 and the following tables. Table 17: Signal assignment 1H-NMR spectrum of Di-β-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] Table 18: Signal assignment 13C-NMR spectrum of Di-β-glucosylated bis(2- hydroxyethyl)terephthalate [Image disponible dans le document PDF, Image available in the PDF document] (9) Production of fructosylated BHET BHET (0.05 mol / l) and sucrose (0.4 mol / l) were dissolved in sodium acetate buffer (0.05 <semantics>mol / l<annotation encoding="application / x-tex">mol / l< / annotation>< / semantics>, pH = 5.2) and a fructosidase solution (100 U in sodium acetate buffer) was added. The fructosidase solution enzymatically catalyses the cleavage of sucrose into <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-D-glucose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose. The <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-D-fructose chemically binds to the BHET during the reaction. For this purpose, the reaction mixture is also shaken at a temperature of 37 °C in a water bath. After optimal product formation, the reaction is terminated. MS (ESI, positive): calculated for <semantics>C16H19NaO10<annotation encoding="application / x-tex">C_{16}H_{19}NaO_{10}< / annotation>< / semantics> (M-H) 439.1216; according to 439.1211. (10) Production of polyester from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET α-glucosylated MHET (20 mg) is heated to 250°C for 50 sec. There is a gas formation. A brown-white solid remains, partially suspended and dissolved in water. Thin layer chromatography (MeOH / CH2Cl2) shows that a high polymer substance was formed from the substrate and is also UV-active. (11) Production of glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc 40 mg α-glucosylated BHET and 72 μl vinyl methyl acrylate are dissolved in 2 ml tert- butanol. Then 25 mg Novozymes 435 are added (immobilized on acrylic resin). The suspension is shaken at 50°C for 18 h. The suspension is then centrifuged, the supernatant is decanted and constricted at the rotary evaporator. The residue is chromatographed on silica gel 60 (Macherey Nagel, 0.044-0.063 mm). (Fluid system: 11 volumes ethyl acetate to 1 volume methanol). A white solid was obtained. Glycosylated MA-BHET-α-Glc is shown as an example in Fig. 37. Further test results are shown in Fig. 38, Fig. 39 and the following tables. NMR in deuterated <semantics>(CD3)2SO<annotation encoding="application / x-tex">(CD_3)_2SO< / annotation>< / semantics>. Table 19: Signal assignment 1H-NMR spectrum of glycosylated MA-BHET-α-Glc [Image disponible dans le document PDF, Image available in the PDF document] • [Image disponible dans le document PDF, Image available in the PDF document] Table 20: Signal assignment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc [Image disponible dans le document PDF, Image available in the PDF document] . [Image disponible dans le document PDF, Image available in the PDF document] (12) Production of glycosylated MA2-BHET-α-Glc 40 mg α-glucosylated BHET and 72 μl vinyl methyl acrylate are dissolved in 2 ml tert- butanol. Then 25 mg Novozymes 435 are added (immobilized on acrylic resin). At 50°C, the suspension is shaken for 30 h. The suspension is then centrifuged, the supernatant is decanted and constricted at the rotary evaporator. The residue is chromatographed on silica gel. (Fluid system: 11 volumes ethyl acetate to 1 volume methanol). A white solid was obtained. Glycosylated MA2-BHET-α-Glc is shown as an example in Fig. 40. Further test results are shown in Fig. 41, Fig. 42 and the following tables. NMR in CD3OD. Table 21: Signal assessment 1H-NMR spectrum of glycosylated MA2-BHET-α-Glc [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] . Table 22: Signal assessment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated MA2-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc . [Image disponible dans le document PDF, Image available in the PDF document] • [Image disponible dans le document PDF, Image available in the PDF document] (13) Preparation of glycosylated -Glc-MHET-decanol 40 mg <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated BHET and 120 <semantics>μ<annotation encoding="application / x-tex">\mu< / annotation>< / semantics>l 1-decanol are added in 2 ml tert-butanol. Then 25 mg Novozymes 435 are added (immobilized on acrylic resin). At 50°C, the suspension is shaken for 24 h. The suspension is then centrifuged, the supernatant is decanted and constricted at the rotary evaporator. The residue is chromatographed on silica gel. (Fluid system: 11 volumes ethyl acetate to 1 volume methanol). A white solid was obtained. Glycosylated <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET-Decanol is shown as an example in Fig. 43. Further test results are shown in Fig. 44, Fig. 45 and the following tables. NMR measured in CDCl3. Table 23: Signal assessment <semantics>1H-NMR<annotation encoding="application / x-tex">^1\text{H-NMR}< / annotation>< / semantics> spectrum of glycosylated <semantics>α-Glc-MHET-Decanol<annotation encoding="application / x-tex">\alpha\text{-Glc-MHET-Decanol}< / annotation>< / semantics> [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 24: Signal assessment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of glycosylated <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc-MHET-Decanol [Image disponible dans le document PDF, Image available in the PDF document] (14) Alternative production of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET 40 mg <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated BHET are added to 2 ml 50 mM HEPES buffer pH 7.5. Then 25 mg Novozymes 435 (immobilised on acrylic resin) are added. At 50°C, the suspension is shaken for 24 h. The pH value of 7.5 of the solution is kept constant by adding 1 N NaOH solution. The suspension is then centrifuged, the supernatant is decanted and constricted at the rotary evaporator. The residue is chromatographed on silica gel. (Fluid system: 6 volumes ethyl acetate to 3 volumes isopropanol and 1 volume water). A white solid was obtained. <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET is shown as an example in Fig. 46. Further test results are shown in Fig. 47, Fig. 48 and the following tables. NMR in CD3OD. Table 25: Signal assignment <semantics>1H-NMR<annotation encoding="application / x-tex">^1\text{H-NMR}< / annotation>< / semantics> spectrum of <semantics>α-glucosylated MHET<annotation encoding="application / x-tex">\alpha\text{-glucosylated MHET}< / annotation>< / semantics> [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] Table 26: Signal assignment <semantics>13<annotation encoding="application / x-tex">^{13}< / annotation>< / semantics>C-NMR spectrum of <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosylated MHET [Image disponible dans le document PDF, Image available in the PDF document] (15) Polymerisation of MA-BHET-α-Glc 1 ml water and 50 mg MA-BHET-<semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-Glc and 1 mg <semantics>K2O8S2<annotation encoding="application / x-tex">K_2O_8S_2< / annotation>< / semantics> are added to 2 ml DMSO. This solution is rinsed with nitrogen for 2 hours. Then the reaction is closed and shaken at 50°C for 12 hours. The solvents were removed by freeze-drying, then part of the residue was dissolved overnight in deuterated methanol at 50°C and a 1H-NMR 400 MHz measured. Test results are shown in Fig.49. INDUSTRIAL APPLICABILITY This invention can be used commercially in many ways. For example, the further use of degradation products from the hydrolysis of PET in the form of biohybrid polymers is made possible. According to the invention, biohybrid polymers have an increased biocompatibility, compostability and / or enable improved adhesion of cultured cells to surfaces. •
Claims
<pat:ClaimStatement>Claims< / pat:ClaimStatement> <pat:Claims com:id="claims"> <pat:Claim com:id="CLM-00001"> <pat:ClaimNumber>1< / pat:ClaimNumber> <pat:ClaimText>1. A Compound comprising glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET), wherein the MHET or BHET and a saccharide are chemically bonded to each other via a glycosidic bond. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00002"> <pat:ClaimNumber>2< / pat:ClaimNumber> <pat:ClaimText>2. A Compound comprising mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2- hydroxyethyl) terephthalic acid chemically bonded to a saccharide, wherein the MHET or BHET and the saccharide are chemically bonded to each other via a glycosidic bond. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00003"> <pat:ClaimNumber>3< / pat:ClaimNumber> <pat:ClaimText>3. The compound according to any one of claims 1 to 2, wherein the saccharide is a monosaccharide or disaccharide. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00004"> <pat:ClaimNumber>4< / pat:ClaimNumber> <pat:ClaimText>4. The compound according to claim 3 wherein the monosaccharide or disaccharide is selected from a group consisting of hexoses and pentoses. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00005"> <pat:ClaimNumber>5< / pat:ClaimNumber> <pat:ClaimText>5. The compound according to claim 3 wherein the monosaccharide or disaccharide is selected from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-mannose, xylose, N-acetylglucosamine, glucosamine and glucuronic acid. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00006"> <pat:ClaimNumber>6< / pat:ClaimNumber> <pat:ClaimText>6. The compound according to any one of claims 1 to 5, wherein the compound is obtained by enzymatic glycosylation of MHET or BHET. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00007"> <pat:ClaimNumber>7< / pat:ClaimNumber> <pat:ClaimText>7. The compound according to any one of claims 1 to 6, wherein the compound is formed by enzymatic glycosylation of MHET or BHET. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00008"> <pat:ClaimNumber>8< / pat:ClaimNumber> <pat:ClaimText>8. The compound according to claim 6 or 7, wherein the enzymatic glycosylation is catalysed by a glucosidase, a galactosidase or a fructosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00009"> <pat:ClaimNumber>9< / pat:ClaimNumber> <pat:ClaimText>9. The compound according to claim 8, wherein the enzymatic glycosylation is catalysed by a glucosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00010"> <pat:ClaimNumber>10< / pat:ClaimNumber> <pat:ClaimText>10. The compound according to claim 9, wherein the glucosidase is an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosidase or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00011"> <pat:ClaimNumber>11< / pat:ClaimNumber> <pat:ClaimText>11. The compound according to any one of claims 6 to 10, wherein the MHET or BHET is obtained by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00012"> <pat:ClaimNumber>12< / pat:ClaimNumber> <pat:ClaimText>12. The compound according to any one of claims 6 to 11, wherein the MHET or BHET is formed by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00013"> <pat:ClaimNumber>13< / pat:ClaimNumber> <pat:ClaimText>13. The compound according to one of claims 11 or 12, wherein the enzymatic degradation of PET is catalysed by a hydrolase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00014"> <pat:ClaimNumber>14< / pat:ClaimNumber> <pat:ClaimText>14. The compound according to claim 13, wherein the hydrolase is hydrolase PETase from Idionella sakaiensis. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00015"> <pat:ClaimNumber>15< / pat:ClaimNumber> <pat:ClaimText>15. The compound according to claim 13 or 14, wherein the hydrolase comprises the amino acid sequence shown in SEQ ID NO:
1. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00016"> <pat:ClaimNumber>16< / pat:ClaimNumber> <pat:ClaimText>16. The compound according to any one of claims 11 to 15, wherein the enzyme for the enzymatic glycosylation of MHET or BHET and the enzyme for the enzymatic degradation of PET are used together. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00017"> <pat:ClaimNumber>17< / pat:ClaimNumber> <pat:ClaimText>17. The compound according to claim 16, wherein a microorganism containing the enzyme for enzymatic glycosylation and the enzyme for enzymatic degradation of PET is used. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00018"> <pat:ClaimNumber>18< / pat:ClaimNumber> <pat:ClaimText>18. The compound according to any one of claims 1 to 17, consisting of MHET or BHET chemically bonded to a saccharide via a glycosidic bond. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00019"> <pat:ClaimNumber>19< / pat:ClaimNumber> <pat:ClaimText>19. The compound according to any one of claims 1 to 18, wherein the compound has one of the following structures (a) or (b): (a) [Image disponible dans le document PDF, Image available in the PDF document] (b) [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond, and R2 comprises a saccharide bound via a glycosidic bond or is H. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00020"> <pat:ClaimNumber>20< / pat:ClaimNumber> <pat:ClaimText>20. The compound according to any one of claims 1 to 17, wherein the compound further comprises at least one methacrylic residue. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00021"> <pat:ClaimNumber>21< / pat:ClaimNumber> <pat:ClaimText>21. The compound according to claim 20, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond and R2 comprises a methacrylic residue. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00022"> <pat:ClaimNumber>22< / pat:ClaimNumber> <pat:ClaimText>22. The compound according to claim 21, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] • < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00023"> <pat:ClaimNumber>23< / pat:ClaimNumber> <pat:ClaimText>23. The compound according to claim 21, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00024"> <pat:ClaimNumber>24< / pat:ClaimNumber> <pat:ClaimText>24. The compound according to claim 21, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00025"> <pat:ClaimNumber>25< / pat:ClaimNumber> <pat:ClaimText>25. The compound according to one of claims 1 to 17, wherein the compound further comprises a lipophilic side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00026"> <pat:ClaimNumber>26< / pat:ClaimNumber> <pat:ClaimText>26. The compound according to claim 25, wherein the compound has the following structure: [Image disponible dans le document PDF, Image available in the PDF document] wherein R1 comprises a saccharide bound via a glycosidic bond and R2 comprises a lipophilic side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00027"> <pat:ClaimNumber>27< / pat:ClaimNumber> <pat:ClaimText>27. The compound according to claim 26, wherein R2 is a saturated or unsaturated aliphatic <semantics>C5<annotation encoding="application / x-tex">C_5< / annotation>< / semantics> to <semantics>C20<annotation encoding="application / x-tex">C_{20}< / annotation>< / semantics> hydrocarbon side chain, or a saturated or unsaturated aliphatic <semantics>C5<annotation encoding="application / x-tex">C_5< / annotation>< / semantics> to <semantics>C15<annotation encoding="application / x-tex">C_{15}< / annotation>< / semantics> hydrocarbon side chain, or a saturated or unsaturated aliphatic C8 to C12 hydrocarbon side chain, or a saturated or unsaturated aliphatic C10 hydrocarbon side chain or a saturated aliphatic C10 hydrocarbon side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00028"> <pat:ClaimNumber>28< / pat:ClaimNumber> <pat:ClaimText>28. The compound according to claim 26 selected from a compound having the following structure (a) to (j): (a) ΗC <semantics>∏i=1R1<annotation encoding="application / x-tex">\prod_{i=1}^{R_1}< / annotation>< / semantics> (b) Fo [Image disponible dans le document PDF, Image available in the PDF document] (C) (d) [Image disponible dans le document PDF, Image available in the PDF document] (e) (f) (g [Image disponible dans le document PDF, Image available in the PDF document] [Image disponible dans le document PDF, Image available in the PDF document] (h) (i) (j) wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00029"> <pat:ClaimNumber>29< / pat:ClaimNumber> <pat:ClaimText>29. The compound according to one of claims 1 to 22, 24 to 27 or 28(b)-(j), wherein the saccharide chemically bonded to MHET or BHET via a glycosidic bond is methacrylated. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00030"> <pat:ClaimNumber>30< / pat:ClaimNumber> <pat:ClaimText>30. A polymer of a compound according to any one of claims 1 to 29. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00031"> <pat:ClaimNumber>31< / pat:ClaimNumber> <pat:ClaimText>31. The polymer according to claim 30, said polymer being a biohybrid polymer. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00032"> <pat:ClaimNumber>32< / pat:ClaimNumber> <pat:ClaimText>32. A method for preparing a compound comprising glycosylated mono(2-hydroxyethyl) terephthalic acid (MHET) or glycosylated bis(2-hydroxyethyl) terephthalic acid (BHET), said method comprising the step of enzymatic glycosylation of mono(2-hydroxyethyl) terephthalic acid (MHET) or bis(2-hydroxyethyl) terephthalic acid (BHET), wherein in the step of enzymatic glycosylation the MHET or BHET and a saccharide are chemically bonded together via a glycosidic bond. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00033"> <pat:ClaimNumber>33< / pat:ClaimNumber> <pat:ClaimText>33. The method according to claim 32, wherein the saccharide is a monosaccharide or disaccharide. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00034"> <pat:ClaimNumber>34< / pat:ClaimNumber> <pat:ClaimText>34. The method according to claim 33, wherein the monosaccharide or disaccharide is selected from a group containing hexoses and pentoses. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00035"> <pat:ClaimNumber>35< / pat:ClaimNumber> <pat:ClaimText>35. The method according to claim 34, wherein the monosaccharide or disaccharide is selected from <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-glucose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-fructose, <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-fructose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-galactose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-galactose, <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-mannose and <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>-mannose, xylose, N-acetylglucosamine, glucosamine and glucuronic acid. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00036"> <pat:ClaimNumber>36< / pat:ClaimNumber> <pat:ClaimText>36. The method according to any one of claims 32 to 35, wherein the enzymatic glycosylation is catalysed by a glucosidase, a galactosidase or a fructosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00037"> <pat:ClaimNumber>37< / pat:ClaimNumber> <pat:ClaimText>37. The method according to claim 36, wherein the enzymatic glycosylation is catalysed by a glucosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00038"> <pat:ClaimNumber>38< / pat:ClaimNumber> <pat:ClaimText>38. The method according to claim 37, wherein the glucosidase is an <semantics>α<annotation encoding="application / x-tex">\alpha< / annotation>< / semantics>-glucosidase or a <semantics>β<annotation encoding="application / x-tex">\beta< / annotation>< / semantics>- glucosidase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00039"> <pat:ClaimNumber>39< / pat:ClaimNumber> <pat:ClaimText>39. The method according to any one of claims 32 to 38, wherein the MHET or BHET is obtained by bacterial degradation or enzymatic degradation from polyethylene terephthalate (PET). < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00040"> <pat:ClaimNumber>40< / pat:ClaimNumber> <pat:ClaimText>40. The method according to any one of claims 32 to 39, wherein the method comprises a step of bacterial degradation or enzymatic degradation of polyethylene terephthalate (PET) to MHET or BHET before the step of enzymatic glycosylation. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00041"> <pat:ClaimNumber>41< / pat:ClaimNumber> <pat:ClaimText>41. The method according to claim 39 or 40, wherein the enzymatic degradation of PET is catalysed by a hydrolase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00042"> <pat:ClaimNumber>42< / pat:ClaimNumber> <pat:ClaimText>42. The method according to claim 41, wherein the hydrolase is hydrolase PETase from Idionella sakaiensis. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00043"> <pat:ClaimNumber>43< / pat:ClaimNumber> <pat:ClaimText>43. The method according to claim 41 or 42, wherein the hydrolase comprises the amino acid sequence shown in SEQ ID NO:
1. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00044"> <pat:ClaimNumber>44< / pat:ClaimNumber> <pat:ClaimText>44. The method according to any one of claims 39 to 43, wherein the enzyme for the enzymatic glycosylation of MHET or BHET and the enzyme for the enzymatic degradation of PET are used together. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00045"> <pat:ClaimNumber>45< / pat:ClaimNumber> <pat:ClaimText>45. The method according to claim 44, wherein a microorganism containing the enzyme for enzymatic glycosylation and the enzyme for enzymatic degradation of PET is used. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00046"> <pat:ClaimNumber>46< / pat:ClaimNumber> <pat:ClaimText>46. The method according to one of claims 32 to 45, wherein a methacrylic residue is chemically bonded to the glycosylated MHET or BHET in a further step. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00047"> <pat:ClaimNumber>47< / pat:ClaimNumber> <pat:ClaimText>47. The method according to one of claims 32 to 46, wherein the methacrylic residue is chemically bonded to the glycosylated MHET or BHET by enzymatic esterification, wherein the enzymatic esterification is catalysed by a lipase. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00048"> <pat:ClaimNumber>48< / pat:ClaimNumber> <pat:ClaimText>48. The method according to claim 46 or 47, wherein the methacrylic residue is chemically bonded to the glycosylated MHET or BHET by addition of vinylmethyl methacrylate. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00049"> <pat:ClaimNumber>49< / pat:ClaimNumber> <pat:ClaimText>49. The method according to any one of claims 32 to 45, wherein in a further step a lipophilic side chain is chemically bonded to the glycosylated MHET or BHET. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00050"> <pat:ClaimNumber>50< / pat:ClaimNumber> <pat:ClaimText>50. The method according to claim 49, wherein the lipophilic side chain is a saturated or unsaturated aliphatic hydrocarbon side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00051"> <pat:ClaimNumber>51< / pat:ClaimNumber> <pat:ClaimText>51. The method according to claim 49 or 50, wherein the lipophilic side chain is a saturated or unsaturated C5 to C20 hydrocarbon side chain, or a saturated or unsaturated C5 to C15 hydrocarbon side chain, or a saturated or unsaturated C8 to C12 hydrocarbon side chain, or a saturated or unsaturated <semantics>C10<annotation encoding="application / x-tex">C_{10}< / annotation>< / semantics> hydrocarbon side chain or a saturated <semantics>C10<annotation encoding="application / x-tex">C_{10}< / annotation>< / semantics> hydrocarbon side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00052"> <pat:ClaimNumber>52< / pat:ClaimNumber> <pat:ClaimText>52. The method according to claim 51, wherein the lipophilic side chain is a saturated C10 hydrocarbon side chain. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00053"> <pat:ClaimNumber>53< / pat:ClaimNumber> <pat:ClaimText>53. The method according to one of claims 49 to 52, wherein the lipophilic side chain is bound by the addition of decanol. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00054"> <pat:ClaimNumber>54< / pat:ClaimNumber> <pat:ClaimText>54. The method according to any one of claims 32 to 53, wherein a polymerisation step follows the enzymatic glycosylation. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00055"> <pat:ClaimNumber>55< / pat:ClaimNumber> <pat:ClaimText>55. A polymer obtained by the method according to one of the claims 32 to 54. < / pat:ClaimText> < / pat:Claim> <pat:Claim com:id="CLM-00056"> <pat:ClaimNumber>56< / pat:ClaimNumber> <pat:ClaimText>56. The polymer according to claim 55, wherein the polymer is a biohybrid polymer. < / pat:ClaimText> < / pat:Claim> < / pat:Claims>