Herpes zoster mRNA vaccine, preparation method therefor, and use thereof
A herpes zoster mRNA vaccine using VZV gE glycoprotein variants addresses the limitations of current vaccines by enhancing immune responses through targeted modifications and encapsulation, achieving superior efficacy and scalability.
Patent Information
- Authority / Receiving Office
- CA · CA
- Patent Type
- Patents
- Current Assignee / Owner
- HANGZHOU TIANLONG PHARM CO LTD
- Filing Date
- 2025-05-20
- Publication Date
- 2026-07-28
AI Technical Summary
Current herpes zoster vaccines, particularly live attenuated and recombinant protein vaccines, have limitations such as low efficacy, unsuitability for immunocompromised individuals, high production costs, and adverse reactions, while mRNA vaccines offer a promising alternative for generating robust immune responses but require optimization for improved immunogenicity.
Development of a herpes zoster mRNA vaccine using VZV gE glycoprotein variants with specific sequence truncations, mutations, and deletions, encapsulated in lipid nanoparticles, to enhance humoral and cellular immunity.
The vaccine significantly enhances IgG antibody production, increases immune cell counts, and promotes cytokine secretion, offering superior immune responses compared to existing vaccines, with potential for rapid production and scalability.
Abstract
Description
BSL-0035-CA 1 HERPES ZOSTER mRNA VACCINE, PREPARATION METHOD THEREFOR, AND USE THEREOF TECHNICAL FIELD
[0001] The present disclosure belongs to the technical field of mRNA vaccines, and specifically relates to a herpes zoster mRNA vaccine, a preparation method therefor, and a use thereof. BACKGROUND
[0002] Herpes zoster is an infectious skin disease caused by the reactivation of varicellazoster virus (VZV), which has been latent in the dorsal root ganglia or cranial ganglia for an extended period. Herpes zoster is a common disease in dermatology that is often accompanied by neuropathic pain in addition to skin damage. The disease mainly occurs in elderly people, immunosuppressed or immunodeficient groups, and is more common in spring and autumn. The incidence shows a significant increase with age.
[0003] VZV is not completely eliminated from the human body following recovering from varicella infection, but remains latent in the cranial ganglia, dorsal root ganglia, and autonomic ganglia throughout the neuraxis, and persists throughout life. After infection with VZV that results in varicella, the body produces specific antibodies against VZV and T cell-mediated cellular immunity (e.g., CD4+ / CD8+ / memory T cells, etc.). These two immune functions play an important role in the maintenance of latent VZV infection and the prevention of herpes zoster. VZV can spontaneously reactivate with age or when some external or internal factors that cause the immunity of the body to be suppressed occur, leading to herpes zoster (HZ).
[0004] Common activating factors for herpes zoster include age factors (e.g., old age), cellular immunodeficiency, genetic susceptibility, trauma, systemic diseases (e.g., diabetes, kidney disease, etc.), stress, fatigue, etc. In contrast to varicella infection in children, herpes zoster in adults (elderly) can easily lead to complications, with postherpetic neuralgia (PHN) being the most common complication, which can cause pain lasting 3 to 12 months after healing of herpes zoster.
[0005] Both herpes zoster and postherpetic neuralgia are common and prevalent diseases.BSL-0035-CA 2 Chronic pain (postherpetic neuralgia) and other complications caused by herpes zoster, commonly known as "shingles", seriously affect the quality of life of patients, particularly affecting the elderly and those with weak immune systems. Due to the unknown mechanism of pain, postherpetic neuralgia remains one of the intractable pains.
[0006] Herpes zoster has two notable features: a high infection rate; and significant suffering for the patients. Survey data from Europe and the United States show that the annual incidence of herpes zoster is generally 2 to 6‰. The incidence tends to increase with age. Statistics indicate that the incidence among individuals aged 10 to 49 is approximately 4‰, while the incidence among those over 75 years old is as high as 14‰. Additionally, women are slightly more likely to develop herpes zoster than men. The global incidence of herpes zoster is on the rise. Survey data from 1994 to 2018 show that the annual incidence of herpes zoster increases by 3.1% per year, with a more pronounced increase in the incidence especially among individuals aged 20 to 49.
[0007] Herpes zoster has not been included in the category of Class A and B notifiable infectious diseases in China, and there have been relatively few relevant population-wide epidemiological studies. According to statistics, in China, approximately 99.5% of adults aged 50 or older carry latent VZV, with around 1.56 million new cases reported each year. In China, the average annual incidence of herpes zoster among individuals aged 50 to 60 is 2.66‰, while the average annual incidence among those aged 80 or older is as high as 8.55‰. The incidence of postherpetic neuralgia (PHN) also increases with age, with studies showing that in China, the incidence of PHN among elderly patients with herpes zoster is 18.8%, and the incidence of PHN among those over 75 years old is 31.7%.
[0008] Vaccines are the most effective way to prevent herpes zoster. The main technology routes involved in the development of herpes zoster vaccines include live attenuated vaccines, recombinant protein vaccines, adenovirus vector vaccines, and mRNA vaccines.
[0009] There are only four vaccines available worldwide for preventing herpes zoster: Zostavax® (discontinued), a live attenuated vaccine from Merck; Shingrix®, a recombinant protein vaccine from GlaxoSmithKline (GSK); SkyZoster® (only sold in South Korea) from SK Chemicals; and a recently launched live attenuated vaccine from BCHT Biotechnology in China. The live attenuated vaccine Zostavax® from Merck was the first herpes zoster vaccineBSL-0035-CA 3 approved for marketing in the world, which was launched in the United States and Europe respectively in 2006. However, due to its low protective efficacy (with a protective efficiency of approximately 70% effective in reducing the development of herpes) and unsuitability for individuals with immunosuppression or immune system disorders, its scope of application was greatly limited, and the vaccine was discontinued in 2018. The recombinant protein vaccine Shingrix® from GSK was launched in the United States in 2017, then launched in Europe in 2018, and applied for approval in China in 2019. With its global sales reaching US$2.4 billion in 2021 and US$3.2 billion in 2022, the vaccine has been among the top ten best-selling vaccines in the world for several consecutive years. However, the vaccine is a protein subunit vaccine, which is expensive and has difficulty in scaling up production capacity due to the use of a special adjuvant from GSK. More importantly, the vaccine has severe side effects, in which the incidence of adverse reactions is significantly higher than that of live attenuated vaccines.
[0010] mRNA vaccines represent the third generation of vaccine technology following traditional vaccines and protein subunit vaccines. The mRNA vaccine enters human cells through a specific delivery system and uses the body's own cells to translate mRNA into protein. The expressed protein becomes a certain antigenic protein possessed by the virus and is recognized as a foreign antigen by antigen-presenting cells (APCs), which drives the maturation of dendritic cells (DCs) and subsequently activates B cells and T cells to generate a robust immune response, triggering both humoral and cellular immune responses. The mRNA vaccine breaks through the immune activation pattern of traditional vaccines by innovatively using the body's own cells to produce antigens, thereby activating dual-specific immunity, establishing immune memory, and providing longer-lasting specific immunity. The greatest advantage of mRNA vaccines lies in their ability to quickly develop mRNA vaccines once the antigenic gene sequences of the pathogen are known. The rapid design and construction, high adaptability to viral mutations, efficient and universal platform for fully synthetic production process, ease of standardized production, and other technical advantages of mRNA vaccines result in short production chains and development cycles, relatively simple processes, and rapid large-scale production capabilities.
[0011] The herpes zoster mRNA vaccine has the following advantages over traditionalBSL-0035-CA 4 vaccines: 1) it is a non-infectious and non-integrating agent with no risk of infection or insertion of mutations; 2) the mRNA vaccine activates specific immunity in humans through in vivo expression of antigens, allowing for more durable and effective specific immunity; 3) the mRNA vaccine enables stable delivery into cells for efficient in vivo expression; 4) the production of mRNA vaccines can undergo rigorous quality control.
[0012] gE, a major target protein for the development of herpes zoster vaccines, is one of the most abundant glycoproteins in VZV, and plays a key role in viral replication and viral transmission between ganglion cells. As a highly glycosylated type I membrane protein, gE can be transported between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes.
[0013] Based on the above problems, in order to further reduce the risk of herpes zoster in individuals with low immunity, there is an urgent need to provide a novel mRNA vaccine to prevent VZV, which can significantly enhance the effect of humoral and cellular immunity after vaccination. SUMMARY
[0014] The present disclosure provides a herpes zoster mRNA vaccine that can safely direct the body's cellular mechanism to produce virtually any protein of interest, ranging from natural proteins to antibodies and other completely novel proteins that can have preventive activity inside and outside cells. The herpes zoster mRNA vaccine of the present disclosure can be used to elicit a balanced immune response against VZV, including both cellular and humoral immune responses, without many of the risks associated with attenuated virus vaccination.
[0015] RNA (e.g., mRNA) vaccines can be used in a variety of settings depending on the prevalence of infection or the degree or level of unmet medical need. RNA (e.g., mRNA) vaccines can be used to prevent VZV in a variety of genotypes, strains, and isolates. RNA (e.g., mRNA) vaccines are superior because they generate much greater antibody potency and earlier responses than commercially available antiviral therapeutic treatments. Although not wishing to be bound by theory, it is believed that, like mRNA polynucleotides, RNA vaccines are better designed to produce an appropriate protein conformation through translation when the RNA vaccine assigns a natural cellular mechanism. Unlike traditional vaccines, whichBSL-0035-CA 5 are manufactured ex vivo and can trigger adverse cellular responses, RNA (e.g., mRNA) vaccines are delivered to cellular systems in a more natural manner.
[0016] The present disclosure innovatively designs a series of mRNA vaccine candidate antigens based on the important structure and biological function of the VZV gE protein, compares their immunogenicity with that of mRNA vaccines in the prior art (e.g., antigen YKVZV-007, see CN108472309A; and the marketed recombinant subunit vaccine Shingrix®), and successfully screens a number of herpes zoster mRNA vaccine candidates with novel antigenic structures and superior immunogenicity, which provides the basis for successful development of herpes zoster mRNA vaccines.
[0017] Based on the wild-type VZV gE glycoprotein, the present disclosure obtains a variety of ribonucleic acids encoding VZV gE glycoprotein variants through a specific combination (including sequence truncation, site mutation, and / or sequence deletion), and accordingly provides a novel mRNA vaccine for the prevention of VZV. Experiments have demonstrated that the vaccine can significantly enhance the effect of humoral and cellular immunity after vaccination, which includes: improving the content of IgG antibody against VZV gE protein, increasing the number of immune cells (including CD4+ and CD8+ that secrete IFN-γ+ and / or IL-2+), and promoting the secretion of cytokines (including IFN-γ+ and IL-2+) by immune cells in the herpes zoster mRNA vaccine.
[0018] The mRNA vaccine as provided herein may comprise an RNA polynucleotide of at least one VZV glycoprotein provided in the accompanying Sequence Listing, or a fragment, homologue (e.g., having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity), variant, or derivative thereof.
[0019] In some embodiments, the antigen encodes a VZV gE polypeptide.
[0020] In some embodiments, the VZV gE polypeptide (full length) comprises amino acids 1 to 623 (e.g., SEQ ID NO: 3, 51, 55, 171, 135, 139, 143, 147, 19, 23, 151, 27, 31, 35, 39, 43, 47, 163, 167).
[0021] In some embodiments, the VZV gE polypeptide is a variant. In some embodiments, the VZV gE variant is a truncated VZV gE polypeptide lacking an anchor domain (ER retention domain).BSL-0035-CA 6
[0022] In some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 539 (e.g., SEQ ID NO: 7).
[0023] In some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 573 (e.g., SEQ ID NO: 15, 59, 63, 67, 71, 75, 79, 83, 87, 91).
[0024] In some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 568 (e.g., SEQ ID NO: 11).
[0025] In some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 587 (e.g., SEQ ID NO: 95, 99, 103, 107, 111, 115, 119, 123, 127, 131).
[0026] In some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 601 (e.g., SEQ ID NO: 155, 159).
[0027] In some embodiments, the VZV gE variant is a full-length or truncated polypeptide. Herein, the VZV gE variant further comprises a mutation in one or more motifs associated with targeting Golgi or trans Golgi network (TGN), which results in decreased targeting or localization of the VZV gE polypeptide to Golgi or TGN. In particular, the present inventors unexpectedly found that the motifs associated with targeting gE proteins to Golgi or trans Golgi network comprise an "A568Y569R570V571" motif (with a specific mutant antigen sequence such as YK-VZV-011 (SEQ ID NO: 35)), especially having an A568D mutation and / or a Y569K mutation.
[0028] Additionally, in some embodiments, the VZV gE variant may have a Y582A / G mutation, or a Y569K / A mutation, or a combination of Y582G and Y569A mutations. Other mutation types also include a site mutation in a phosphorylated acidic motif such as S593EST596DT598 (SEQ ID NO: 182).
[0029] In some embodiments, the variant VZV gE polypeptide is a full-length or truncated polypeptide. Herein, the variant VZV gE polypeptide further comprises a mutation in one or more motifs Y582AGL585 (SEQ ID NO: 185) associated with VZV gE internalization or endocytosis, which results in reduced endocytosis of the VZV gE polypeptide.
[0030] In some embodiments, the VZV gE variant is a full-length polypeptide having a Y569K mutation (SEQ ID NO: 27, 31, 35, 39, 43, 47, 143, 147).
[0031] In some embodiments, the VZV gE variant is a full-length polypeptide having a Y582A mutation (SEQ ID NO: 23, 27, 31, 43, 47, 135, 139, 171).BSL-0035-CA 7
[0032] In some embodiments, the VZV gE variant is a full-length polypeptide having a Y582A mutation and a Y569K mutation (SEQ ID NO: 27, 31, 43, 47).
[0033] In some embodiments, the VZV gE variant is a full-length polypeptide having an A593EA595A596DA598 sequence (SEQ ID NO: 183).
[0034] In some embodiments, the VZV gE variant is a full-length or truncated polypeptide having an A593EA595A596DA598 sequence (SEQ ID NO: 183) and having a Y582G mutation, or a Y569K mutation, or a combination of Y582G and Y569K mutations.
[0035] In some embodiments, the VZV gE variant comprises any one or more site mutations selected from the group consisting of: A568D, Y569K, Y569A, R570E, V571K, Y582A, S593A, S595A, T596A, T598A; preferably A568D, Y569K, R570E, V571K.
[0036] In some embodiments, the site mutation is any one of the following combinations: 1) A568D; Y569K; R570E; V571K; (YK-VZV-023, YK-VZV-011) 2) A568D; Y569A; R570E; V571K; (YK-VZV-024) 3) Y569K; R570E; V571K; (YK-VZV-025) 4) A568D; Y569K; R570E; V571K; Y582A; (YK-VZV-030, YK-VZV-013) 5) A568D; Y569K; R570E; V571K; Y582G; (YK-VZV-031, YK-VZV-038) 6) A568D; Y582A; (YK-VZV-032) 7) Y569K; Y582A; (YK-VZV-033, YK-VZV-009) 8) R570E; Y582A; (YK-VZV-034) 9) V571K; Y582A; (YK-VZV-035) 10) S593A; S595A; T596A; T598A; (YK-VZV-016, YK-VZV-044) 11) Y582A; S593A; S595A; T596A; T598A; (YK-VZV-037) 12) A568D; Y569K; R570E; V571K; Y582G; S593A; S595A; T596A; T598A; (YKVZV-039) 13) A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A; (YKVZV-014) 14) Y582G; S593A; S595A; T596A; T598A; (YK-VZV-040) 15) Y569K; Y582A; S593A; S595A; T596A; T598A; (YK-VZV-010) 16) A568D; Y569K; R570E; V571K; S593A; S595A; T596A; T598A; (YK-VZV-012) 17) Y582G; (YK-VZV-029)BSL-0035-CA 8 18) A568D; (YK-VZV-018) 19) Y569K; (YK-VZV-020) 20) R570E; (YK-VZV-021) 21) V571K; (YK-VZV-022) 22) Y582A; (YK-VZV-028, YK-VZV-036)
[0037] In some embodiments, the VZV gE variant further comprises a sequence deletion, wherein the sequence deletion is selected from any one or more of the group consisting of: 1) A568, 2) Y569RVDKSPYNQS579 (SEQ ID NO: 186), 3) Y569RVDKSPYNQSMYYAGLPV587 (SEQ ID NO: 187).
[0038] The VZV gE antigen of the present disclosure has various combinations of mutations, comprising amino acid truncations at the C-terminus of gE antigen, and deletions or substitutions at key amino acid sites, as further described below by way of specific examples.
[0039] The present disclosure also provides a preparation method for the composition, comprising: providing a template that can transcribe the RNA of VZV; transcribing the RNA using the template under conditions suitable for transcription.
[0040] In some embodiments, the preparation method comprises the following steps: synthesizing a DNA sequence of the VZV gE antigen and then recombining it into the PVAX1 vector by homologous recombination; obtaining a plasmid after transformation and culture of E. coli; obtaining a linearized plasmid after digestion of the plasmid; using T7 RNA polymerase with the linearized plasmid as a template, adding NTP starting materials, followed by co-transcriptional capping, and then purifying to obtain RNA, preferably mRNA.
[0041] In some preferred embodiments, the purification method comprises one or a combination of the following: lithium chloride precipitation, affinity chromatography, ultrafiltration exchange, and cellulose chromatography.
[0042] In some embodiments, the preparation method for the composition comprises synthesizing a DNA sequence according to an antigen gene and inserting it into a plasmid DNABSL-0035-CA 9 construct. The plasmid DNA is cleaved using DNA restriction endonuclease to obtain a linearized template. Under the catalysis of T7 RNA polymerase, with the linearized plasmid as a template, key starting materials such as NTP and cap analogs are added for transcription and synthesis of mRNA, followed by RNA modification, where a cap is added at the 5' end. The modified mRNA is then purified by methods such as lithium chloride precipitation and affinity chromatography to remove contaminants, enzymes, free nucleotides, and other impurities.
[0043] In a third aspect, the composition of the present disclosure is in the form of a vaccine, i.e., a herpes zoster vaccine, which comprises a pharmaceutically acceptable carrier in addition to the composition.
[0044] In some preferred embodiments, the pharmaceutically acceptable carrier comprises a lipid mixture, preferably a lipid nanoparticle (LNP).
[0045] In some preferred embodiments, the lipid nanoparticle comprises, for example, a cationic lipid, a neutral lipid, a structural lipid, and a polymer-conjugated lipid.
[0046] In a fourth aspect, the present disclosure also provides a method for preparing the vaccine composition, comprising mixing the RNA of the VZV with the pharmaceutically acceptable carrier, for example to encapsulate at least a portion of the RNA in lipid nanoparticles. In some embodiments, the preparation method comprises the following steps: mixing RNA, preferably mRNA, with lipid nanoparticles to encapsulate it in lipid nanoparticles, followed by purification to remove an unencapsulated component.
[0047] In some more specific embodiments, the preparation method comprises the following specific steps: formulating the mRNA in the lipid nanoparticles (LNPs), i.e., mixing the purified mRNA with a lipid mixture in a microfluidic chip, allowing for self-assembly of lipid nanoparticles, with the mRNA encapsulated in the liposomes; the lipid nanoparticle solution is subjected to dialysis or filtration to remove the unencapsulated mRNA, non-aqueous solvent, and bacteria; the filtered lipid nanoparticle solution is packaged into sterile vials for storage to complete the preparation and production of an mRNA vaccine.
[0048] The present disclosure first discovered: Based on the wild-type VZV gE glycoprotein, the present disclosure obtains a number of ribonucleic acids encoding VZV gE glycoprotein variants through a specific combinationBSL-0035-CA 10 (including sequence truncation, site mutation, and / or sequence deletion), and provides a novel mRNA vaccine for the prevention of VZV. Experiments have demonstrated that the vaccine can significantly enhance the effect of humoral and cellular immunity after vaccination, which includes: improving the content of IgG antibody against VZV gE protein, increasing the number of immune cells (including CD4+ and CD8+ that secrete IFN-γ+ and / or IL-2+), and promoting the secretion of cytokines (including IFN-γ+ and IL-2+) by immune cells in the herpes zoster mRNA vaccine. Specifically, the present disclosure includes the following findings and results: 1. The results of Western Blot detection of 43 designed VZV gE antigen variants showed that 39 antigen sequences exhibited significant protein expression, including YK-VZV- 001, YK-VZV-003, YK-VZV-009, YK-VZV-010, YK-VZV-011, YK-VZV-012, YK-VZV-013, YK-VZV-014, YK-VZV-015, YK-VZV-016, YK-VZV-017, YK-VZV-018, YK-VZV-019, YK-VZV-020, YK-VZV-021, YK-VZV-022, YK-VZV-023, YK-VZV-024, YK-VZV-025, YK-VZV-026, YK-VZV-027, YK-VZV-028, YK-VZV-029, YK-VZV-030, YK-VZV-031, YK-VZV-032, YK-VZV-033, YK-VZV-034, YK-VZV-035, YK-VZV-036, YK-VZV-037, YK-VZV-038, YK-VZV-039, YK-VZV-040, YK-VZV-044, as well as YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4), which can serve as effective candidate antigens for subsequent immunogenicity screening and evaluation.
[0049] 2. Based on the above 39 sequences and the gE-specific antibody IgG titer results on day 42, a total of 14 variants were extracted, including YK-VZV-009, YK-VZV-011, YK-VZV- 013, YK-VZV-014, YK-VZV-010, YK-VZV-012, YK-VZV-018, YK-VZV-020, YK-VZV-030, YK-VZV-031, YK-VZV-038, YK-VZV-021, YK-VZV-024, YK-VZV-028, as well as 4 control sequences including YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4).
[0050] The effect of these sequences was 3.3 to 5.3 times that of the Shingrix® positive control and 1.8 to 2.8 times that of the YK-VZV-007 (Comparative Example 4) sequence. The effect of these sequences was superior to Shingrix®, YK-VZV-007 (Comparative Example 4), YKVZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), and YK-VZVBSL-0035-CA 11 045 (Comparative Example 3).
[0051] 3. As shown by the measurement results of the percentage of CD4+ T and CD8+ T cells secreting IFN-γ and IL-2 in the spleens of mice, (i) a total of 9 sequences were screened out based on the percentage of CD4+ T cells, including YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, YK-VZV-012, YKVZV-018, YK-VZV-028, YK-VZV-038, and YK-VZV-031; the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells was 2 times or more and up to 7 times that of the Shingrix® positive control, and approximately 1.8 to 5.3 times that of YK-VZV-007 (Comparative Example 4); the percentage of IFN-γ+ CD4+ T cells was 1.00 to 2.00%, which was 3 times or more and up to 6.7 times that of the Shingrix® positive control vaccine, and approximately 2.2 to 4.4 times that of YK-VZV-007 (Comparative Example 4); the percentage of IL-2+ CD4+ T cells was more than 1%, which was 3.7 times or more that of the Shingrix® positive control vaccine and 2.2 times or more that of YK-VZV-007; (ii) a total of 5 sequences were further screened out based on the percentage of CD8+ T cells, including YK-VZV-010, YK-VZV-013, YK-VZV-020, YK-VZV-018, and YK-VZV- 011; the total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells was 4 to 7 times or more that of the Shingrix® vaccine and approximately 3 to 5 times that of YK-VZV-007 (Comparative Example 4); the percentage of IFN-γ+ CD8+ T cells was optimal at 5.0% or more, which was 4.5 to 7 times or more that of the Shingrix® positive control vaccine and approximately 2.5 to 4.5 times that of YK-VZV-007; the percentage of IL-2+ CD8+ T cells was optimal at 0.3 to 0.5%, which was 2.5 to 4 times or more that of the Shingrix® positive control vaccine and approximately 1.5 to 3 times that of YK-VZV-007; the results were significantly higher than those of the comparative examples (YKVZV-004, YK-VZV-006, YK-VZV-045, and YK-VZV-007).
[0052] 4. To validate the above results, the VZV binding-gE antibody IgG titer in the serum of immunized mice on day 56 was further measured for validation based on the test results onBSL-0035-CA 12 day 42.
[0053] The results showed that on day 56 after the mice were immunized with mRNA vaccines including YK-VZV-009, YK-VZV-010, YK-VZV-011, YK-VZV-013, YK-VZV-020, YK-VZV-014, YK-VZV-012, YK-VZV-018, YK-VZV-021, YK-VZV-024, YK-VZV-028, YK-VZV-030, YK-VZV-031, and YK-VZV-038, the gE-specific antibody IgG titers of these vaccines were superior to the Shingrix® positive control, being approximately 1.8 to 5.0 times that of the Shingrix® vaccine; specifically, the antibody GMT of YK-VZV-011, YK-VZV-013, YK-VZV-020, YKVZV-018, and YK-VZV-010 could reach 650 × 104 or more, being 4.0 to 5.0 times or more that of the Shingrix® vaccine and 2 times or more that of YK-VZV-007 (Comparative Example 4); moreover, the results were significantly better than those of YK-VZV-004 (Comparative Example 1) and YK-VZV-045 (Comparative Example 3).
[0054] 5. Through the comprehensive analysis of IgG and multiparameter flow cytometry results, a total of 5 optimal antigen sequences (including YK-VZV-010, YK-VZV-013, YKVZV-011, YK-VZV-020, and YK-VZV-018) were screened out and further validated by ELISPOT, and the results are as follows: (i) The amount of cytokine IFN-γ secreted by T cells stimulated by the mRNA vaccine was 500 SFU or more, with a maximum close to 600 SFU, which was approximately 16 to 19 times that of the Shingrix® positive control and 2.5 to 3.0 times that of Comparative Example 4 (YK-VZV-007); and which was significantly better than that of the cytokine secreted and stimulated by the mRNA vaccine corresponding to Comparative Example 1 (YK-VZV-004), Comparative Example 2 (YK-VZV-006), or Comparative Example 3 (YK-VZV-045).
[0055] Specifically, the mRNA vaccine prepared from the YK-VZV-010 sequence reached a maximum of 598.8 SFU, which was 18.7 times that of the Shingrix® positive control and nearly 3 times that of the YK-VZV-007 control.
[0056] The IFN-γ secretion levels from high to low were YK-VZV-010, YK-VZV-011, YKVZV-018, YK-VZV-020, and YK-VZV-013, with no significant difference between the groups, indicating a good and significant immune effect.
[0057] (ii) The amount of cytokine IL-2 secreted by T cells stimulated by the mRNA vaccine was 400 to 600 SFU or more, which was 10 to 16 times that of the Shingrix® positive controlBSL-0035-CA 13 and 2.0 to 3.0 times that of the YK-VZV-007 control; and which was significantly better than that of the cytokine secreted and stimulated by the mRNA vaccine corresponding to Comparative Example 1 (YK-VZV-004), Comparative Example 2 (YK-VZV-006), or Comparative Example 3 (YK-VZV-045).
[0058] Specifically, the mRNA vaccine prepared from the YK-VZV-010 sequence reached a maximum of 614.5 SFU, which was 16.0 times that of the Shingrix® positive control and 3 times or more that of the YK-VZV-007 control.
[0059] The IL-2 secretion levels from high to low were YK-VZV-010, YK-VZV-011, YKVZV-018, YK-VZV-013, and YK-VZV-020, with no significant difference between the groups, indicating a good and significant immune effect.
[0060] 6. In addition, the antigen localization results of the above five sequences indicated their localization in the Golgi apparatus, cell membrane, or cytoplasm. BRIEF DESCRIPTION OF THE DRAWINGS
[0061] FIG. 1 shows the main functional domains of VZV gE protein and a series of deletion mutants; FIG. 2 shows the antigen expression of YK-VZV-001 to YK-VZV-045; FIG. 3 shows the cellular localization of VZV gE antigens of YK-VZV-010, YK-VZV- 011, and YK-VZV-013; FIG. 4 shows the cellular localization of VZV gE antigens of YK-VZV-018 and YKVZV-020, in which green represents gE antigen; yellow and red represent GM130 and TGN46, respectively; white arrow represents cell membrane; and orange arrow represents Golgi. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
[0062] The present disclosure is further described below by way of examples. It should be understood that the examples of the present disclosure are given only for illustrating the present disclosure and are not intended to limit the present disclosure, and any simple improvements to the present disclosure under the premise of the technical solution of the present disclosure are within the scope of protection of the present disclosure.
[0063] As used herein, the term "selected from" means selecting any one or any combinationBSL-0035-CA 14 of two or three or more of the listed objects or elements.
[0064] It should be understood that the term "a compound" as used herein may include the compound, an N-oxide thereof, a solvate thereof, a pharmaceutically acceptable salt thereof, a stereoisomer thereof, and a mixture thereof.
[0065] Antigen sequence design: Antigens are proteins capable of inducing an immune response (e.g., causing an immune system to produce antibodies against the antigens). As used herein, the term "antigen" is used to encompass immunogenic proteins and immunogenic fragments (an immunogenic fragment that induces or is capable of inducing an immune response) to a varicella-zoster virus (e.g., VZV), unless otherwise stated. It should be understood that the term "protein" encompasses peptides and the term "antigen" encompasses antigenic fragments. Exemplary sequences of the VZV antigens and the RNA encoding the VZV antigens of the composition of the present disclosure are provided in Table 1.
[0066] Nucleic acids: Nucleic acids comprise a polymer of nucleotides (nucleotide monomers). The composition of the present disclosure comprises an RNA having an open reading frame (ORF) encoding a VZV antigen. In some embodiments, the RNA is a messenger RNA (mRNA). In some embodiments, the RNA (e.g., mRNA) further comprises a 5′ UTR, a 3′ UTR, a poly(A) tail, and / or a 5′ cap analog.
[0067] Messenger RNA (mRNA) is any RNA that encodes (at least one) protein (a naturally occurring, non-naturally occurring, or modified polymer of amino acids) and can be translated to produce the encoded protein in vitro, in vivo, in situ, or ex vivo. Those skilled will appreciate that, unless otherwise stated, the nucleic acid sequences set forth in the present disclosure may recite a "T" in a representative DNA sequence but where the sequence represents RNA (e.g., mRNA), the "T" will be substituted for a "U". Accordingly, any DNA disclosed and identified herein by a particular sequence identification number also disclose a corresponding RNA (e.g., mRNA) sequence that is complementary to the DNA, in which each "T" of the DNA sequence is substituted by a "U".
[0068] An open reading frame (ORF) is a continuous stretch of DNA or RNA beginning with a start codon (e.g., methionine (ATG)) and ending with a stop codon (e.g., TAA, TAG, or TGA, or UAA or UAG). An ORF typically encodes a protein. It should be understood that the sequences disclosed herein may further comprise additional elements, such as 5′ and 3′ UTRs.BSL-0035-CA 15
[0069] Variant RNA: Antigen variants or other polypeptide variants refers to molecules that differ in their amino acid sequence from a wild-type, native, or reference sequence. The antigen / polypeptide variants may have substitutions, deletions, and / or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence. Typically, the variants have at least 50% identity with a wild-type, native, or reference sequence. In some embodiments, the variants share at least 80% or at least 90% identity with a wild-type, native, or reference sequence.
[0070] In some embodiments, a composition comprises an RNA or an RNA ORF comprising a nucleotide sequence of any one of the sequences provided herein (see, e.g., Sequence Listing and Table 1), or comprising a nucleotide sequence that has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity with a nucleotide sequence of any one of the sequences provided herein.
[0071] The term "identity" refers to a relationship between the sequences of two or more polypeptides (e.g., antigens) or polynucleotides (nucleic acids), as determined by comparing the sequences. Identity also refers to the degree of sequence relatedness between or among sequences as determined by the number of matches between strings of two or more amino acid residues or nucleic acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (e.g., "algorithm"). The identity of related antigens or nucleic acids can be readily calculated by known methods. "Percent identity (%)", when applied to a polypeptide or polynucleotide sequence, is defined as the percentage of residues (amino acid residues or nucleic acid residues) in the candidate amino acid or nucleic acid sequence that are identical with the residues in the amino acid sequence or nucleic acid sequence of a second sequence after aligning the sequences and introducing gaps(if necessary), to achieve the maximum percent identity. Methods and computer programs for alignment are well known in the art. It should be understood that identity depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation. Generally, variants of a particular polynucleotide or polypeptide (e.g., antigen) have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity with the particular referenceBSL-0035-CA 16 polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art. Such tools for alignment include those of the BLAST suite (Stephen F. Altsch, et al. (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25: 3389-3402).
[0072] As such, polynucleotides encoding peptides or polypeptides containing substitutions, insertions and / or additions, and deletions with respect to reference sequences, particularly the antigen sequences disclosed herein, are included within the scope of the present disclosure. Amino acid residues located in the carboxy- and amino-terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted to provide a truncated sequence. According to the structure and use of the sequence, gE proteins have a number of important domains related to their primary functions (see FIG. 1). gE proteins have a number of important domains related to their primary functions (see FIG. 3). (1) TM transmembrane domain, which consists of amino acids 539 to 559; (2) A568YRV571, which mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes; (3) Y582AGL585, which mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes; (4) S593ES595T596DT598, which is an important glycosylation site and mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes. In some embodiments, important structural sites can be removed and replaced with appropriate residues, thereby altering the transport and expression of the antigen to enhance the immunogenicity of the antigen. Such sequences can be readily identified by those skilled in the art. It should also be understood that some of the sequences provided herein contain sequence tags or terminal peptide sequences (e.g., at the Nterminus or C-terminus) that can be deleted, for example, prior to use in the preparation of an RNA (e.g., mRNA) vaccine.
[0073] As recognized by those skilled in the art, protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of varicellazoster virus antigens of interest. For example, provided herein is any protein fragment of a reference protein (meaning a polypeptide sequence that is at least one amino acid residue shorter than a reference antigen sequence but otherwise identical), provided that the fragment is immunogenic and confers a protective immune response against the varicella-zoster virus.BSL-0035-CA 17 In addition to variants that are identical to a reference protein but are truncated, in some embodiments, the antigen comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, or more site mutations, as shown in any one of the sequences provided or referenced herein. Antigens / antigenic polypeptides may range in length from approximately 4, 6, or 8 amino acids to full-length proteins.
[0074] VZV antigen variants: The present disclosure includes a variant VZV antigenic polypeptide. In some embodiments, the variant VZV antigenic polypeptide is a variant VZV gE polypeptide. The variant VZV gE polypeptide is designed to avoid ER / Golgi retention of the polypeptide, leading to increased surface expression of the antigen. In some embodiments, the variant gE polypeptide is truncated to remove an ER retention portion or a cytoplasmic tail portion of the polypeptide. In some embodiments, the variant VZV gE polypeptide is mutated to reduce the localization of the VZV polypeptide to the ER / Golgi / TGN. Such modifications inhibit ER trapping and therefore accelerate transport to the cell membrane. Thus, in some embodiments, the VZV glycoprotein is a variant gE polypeptide. VZV gE has a targeting sequence for the TGN at its C-terminus and is transported from the ER to the TGN in infected and gE-transfected cells. Most gE in the TGN appears to be retrieved from the plasma membrane by endocytosis and delivered from endosomes to the TGN, followed by recycling to the plasma membrane. gE is accumulated in the TGN, along with other VZV proteins (e.g., tegument proteins) associated with the production of fully enveloped VZV virions. Thus, mutations to reduce TGN localization and endocytosis contribute to the transport of gE to the cell membrane. The variant VZV gE polypeptide may be any truncated polypeptide lacking an anchor domain (ER retention domain). For example, the variant VZV gE polypeptide may be a truncated VZV gE polypeptide comprising at least amino acids 1 to 124, such as amino acids 1 to 124, 1 to 140, 1 to 160, 1 to 200, 1 to 250, 1 to 300, 1 to 350, 1 to 360, 1 to 400, 1 to 450, 1 to 500, 1 to 511, 1 to 550, and 1 to 561, as well as a polypeptide fragment having fragment sizes within the recited size ranges. In some embodiments, the variant VZV gE polypeptide is a truncated polypeptide lacking a carboxy-terminal tail domain. Thus, in some embodiments, the truncated VZV gE polypeptide comprises amino acids 1 to 573 of SEQ ID NO: 59. In some embodiments, the variant VZV gE polypeptide has at least one mutation in one or more motifs associated with ER retention, wherein the mutation in one or more motifs results in decreased retention of the VZV gE polypeptide in the ER and / or Golgi. In someBSL-0035-CA 18 embodiments, the variant VZV gE polypeptide has at least one mutation in one or more phosphorylated acidic motifs. For example, the variant VZV gE polypeptide may be a fulllength VZV gE polypeptide having a Y582G mutation, a Y569K mutation, or both a Y582G mutation and a Y569K mutation. Alternatively, the variant VZV gE polypeptide may be an antigenic fragment comprising, for example, amino acids 1 to 573 of VZV gE and having a Y569K mutation. Alternatively, the variant VZV gE polypeptide may be an antigenic fragment having a mutation in a phosphorylated acidic motif (e.g., SSTT motif, SEQ ID NO: 188). For example, the variant VZV gE polypeptide may be an antigenic fragment having an AEAADA sequence (SEQ ID NO: 183).
[0075] Naturally occurring eukaryotic mRNA molecules may contain stabilizing elements, including, but not limited to, an untranslated region (UTR) at their 5′ end (5′ UTR) and / or at their 3′ end (3′ UTR), in addition to other structural features, such as a 5′-cap structure or a 3′- poly(A) tail. Both the 5′ UTR and the 3′ UTR are typically transcribed from genomic DNA and are elements of premature mRNA. Characteristic structural features of mature mRNA (e.g., the 5′-cap and the 3′-poly(A) tail) are typically added to the transcribed (premature) mRNA during mRNA processing.
[0076] In some embodiments, the composition comprises an RNA polynucleotide having an open reading frame encoding at least one antigenic polypeptide having at least one modification, and at least one 5′ terminal cap, and is formulated within a lipid nanoparticle. 5′-capping of polynucleotides can be accomplished simultaneously during an in vitro transcription reaction using a chemical RNA cap analog to generate a 5′-guanosine cap structure according to manufacturer's protocols. In some instances, 5′-capping of modified RNA can also be accomplished post-transcriptionally using a vaccinia virus capping enzyme to generate a "cap" structure. Cap 1 structure can be generated using a vaccinia virus capping enzyme and a 2′- O methyl-transferase to generate: m7G(5′)ppp(5′)G-2′-O-methyl. Cap 2 structure can be generated from the Cap 1 structure followed by the 2′-O-methylation of the 5′-antepenultimate nucleotide using a 2′-O methyl-transferase. Cap 3 structure can be generated from the Cap 2 structure followed by the 2′-O-methylation of the 5′-preantepenultimate nucleotide using a 2′- O methyl-transferase. Enzymes can be derived from recombinant sources. The 3′-poly(A) tail is typically a stretch of adenine nucleotides added to the 3′ end of the transcribed mRNA.BSL-0035-CA 19 In some instances, it may comprise up to approximately 400 adenine nucleotides. In some embodiments, the length of the 3′-poly(A) tail may be an essential element with respect to the stability of the individual mRNA.
[0077] Chemical modification: In some embodiments, the composition of the present disclosure comprises an RNA having an open reading frame encoding a VZV antigen, wherein the nucleic acid comprises nucleotides and / or nucleosides that may be standard (unmodified) or modified as known in the art. In some embodiments, the nucleotides and nucleosides of the present disclosure comprise modified nucleotides or nucleosides. Such modified nucleotides and nucleosides may be naturally occurring modified nucleotides and nucleosides or non-naturally occurring modified nucleotides and nucleosides. Such modifications may include those at the sugar, backbone, or nucleobase portions of the nucleotides and / or nucleosides as recognized in the art.
[0078] In some embodiments, the naturally occurring modified nucleotides or nucleosides of the present disclosure are nucleotides or nucleosides as generally known or recognized in the art. Non-limiting examples of such naturally occurring modified nucleotides and nucleosides can be found particularly in the widely recognized MODOMICS database.
[0079] In some embodiments, the non-naturally occurring modified nucleotides or nucleosides of the present disclosure are nucleotides or nucleosides as generally known or recognized in the art. Non-limiting examples of such non-naturally occurring modified nucleotides and nucleosides can be found particularly in published U.S. Application Nos. PCT / US2012 / 058519; PCT / US2013 / 075177; PCT / US2014 / 058897; PCT / US2014 / 058891; PCT / US2014 / 070413; PCT / US2015 / 36773; PCT / US2015 / 36759; PCT / US2015 / 36771; or PCT / IB2017 / 051367, all of which are incorporated herein by reference.
[0080] Thus, the nucleic acids of the disclosure (e.g., DNA nucleic acids and RNA nucleic acids, such as mRNA nucleic acids) may comprise standard nucleotides and nucleosides, naturally occurring nucleotides and nucleosides, non-naturally occurring nucleotides and nucleosides, or any combination thereof.
[0081] In some embodiments, the nucleic acids of the disclosure (e.g., DNA nucleic acids and RNA nucleic acids, such as mRNA nucleic acids) comprise a plurality (more than one) of different types of standard and / or modified nucleotides and nucleosides. In someBSL-0035-CA 20 embodiments, a particular region of the nucleic acid contains one, two, or more (optionally different) types of standard and / or modified nucleotides and nucleosides.
[0082] In some embodiments, a modified RNA nucleic acid (e.g., a modified mRNA nucleic acid), introduced into a cell or organism, exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.
[0083] In some embodiments, a modified RNA nucleic acid (e.g., a modified mRNA nucleic acid), introduced into a cell or organism, may exhibit reduced immunogenicity in the cell or organism, respectively, relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.
[0084] In some embodiments, the nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise non-naturally modified nucleotides that are introduced during synthesis or post-synthesis of the nucleic acids to achieve desired functions or properties. The modification may be present on internucleotide linkages, purine or pyrimidine bases, or sugars. The modification can be chemically synthesized or introduced by a polymerase at the terminal of a chain or anywhere else in the chain. Any region of a nucleic acid can be chemically modified.
[0085] The present disclosure provides modified nucleosides and nucleotides of a nucleic acid (e.g., RNA nucleic acids, such as mRNA nucleic acids). A "nucleoside" refers to a compound containing a sugar molecule (e.g., pentose or ribose) or a derivative thereof in combination with an organic base (e.g., purine or pyrimidine) or a derivative thereof (also referred to herein as "nucleobase"). A "nucleotide" refers to a nucleoside that includes a phosphate group. Modified nucleotides can by synthesized by any useful method, such as chemical, enzymatic, or recombinant methods, to include one or more modified or non-natural nucleosides. The nucleic acid may comprise one or more regions of linked nucleosides. Such regions may have variable backbone linkages. The linkage may be a standard phosphodiester linkage, in which case the nucleic acid would comprise a region of nucleotides.
[0086] Modified nucleotide base pairing encompasses not only the standard adenosinethymine, adenosine-uracil, or guanosine-cytosine base pairs, but also base pairs formed between nucleotides and / or modified nucleotides comprising non-standard or modified bases,BSL-0035-CA 21 wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary non-standard base structures, for example, in those nucleic acids having at least one chemical modification. One example of such non-standard base pairing is the base pairing between the modified nucleotide inosine and adenine, cytosine, or uracil. Any combination of base / sugar or linker can be incorporated into the nucleic acids of the present disclosure.
[0087] In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 1-methyl-pseudouridine (m1ψ), 1-ethyl-pseudouridine (e1ψ), 5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), and / or pseudouridine (ψ). In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 5-methoxymethyl uridine, 5-methylthio uridine, 1- methoxymethyl pseudouridine, 5-methyl cytidine, and / or 5-methoxy cytidine. In some embodiments, polyribonucleotides comprise a combination of at least two (e.g., 2, 3, 4, or more) of any of the aforementioned modified nucleobases, including, but not limited to, chemical modifications.
[0088] In some embodiments, the mRNA of the present disclosure comprises a 1-methylpseudouridine (m1ψ) substitution at one or more or all uridine positions of the nucleic acid.
[0089] In some embodiments, the mRNA of the present disclosure comprises a 1-methylpseudouridine (m1ψ) substitution at one or more or all uridine positions of the nucleic acid and a 5-methyl cytidine substitution at one or more or all cytidine positions of the nucleic acid.
[0090] In some embodiments, the mRNA of the present disclosure comprises a pseudouridine (ψ) substitution at one or more or all uridine positions of the nucleic acid.
[0091] In some embodiments, the mRNA is uniformly modified (e.g., fully modified, modified throughout the sequence) for a particular modification. For example, a nucleic acid can be uniformly modified with 1-methyl-pseudouridine, meaning that all uridine residues in the mRNA sequence are replaced with 1-methyl-pseudouridine. Similarly, a nucleic acid can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified residue, such as those set forth above.
[0092] The nucleic acid may contain from approximately 1% to approximately 100%BSL-0035-CA 22 modified nucleotides (relative to overall nucleotide content, or relative to one or more types of nucleotides, i.e., any one or more of A, G, U, or C) or any intervening percentage (e.g., 1% to 20%, 1% to 25%, 1% to 50%, 1% to 60%, 1% to 70%, 1% to 80%, 1% to 90%, 1% to 95%, 10% to 20%, 10% to 25%, 10% to 50%, 10% to 60%, 10% to 70%, 10% to 80%, 10% to 90%, 10% to 95%, 10% to 100%, 20% to 25%, 20% to 50%, 20% to 60%, 20% to 70%, 20% to 80%, 20% to 90%, 20% to 95%, 20% to 100%, 50% to 60%, 50% to 70%, 50% to 80%, 50% to 90%, 50% to 95%, 50% to 100%, 70% to 80%, 70% to 90%, 70% to 95%, 70% to 100%, 80% to 90%, 80% to 95%, 80% to 100%, 90% to 95%, 90% to 100%, and 95% to 100%). It should be understood that any remaining percentage is accounted for by the presence of unmodified A, G, U, or C.
[0093] The mRNA may contain at minimum 1% and at maximum 100% modified nucleotides or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides. For example, the nucleic acid may contain a modified pyrimidine, such as a modified uracil or cytosine. In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90%, or 100% of the uracil in the nucleic acid is replaced by a modified uracil (e.g., a 5-substituted uracil). The modified uracil can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4, or more unique structures). In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90%, or 100% of the cytosine in the nucleic acid is replaced by a modified cytosine (e.g., a 5-substituted cytosine). The modified cytosine can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4, or more unique structures).
[0094] Untranslated region (UTR): The mRNA of the present disclosure may comprise one or more regions or portions which act or function as an untranslated region. When the mRNA is designed to encode at least one antigen of interest, the nucleic acid may comprise one or more of these untranslated regions (UTRs). A wild-type untranslated region of the nucleic acid is transcribed but not translated. In mRNA, the 5′ UTR starts at the transcription start site and continues to but not including the start codon; whereas the 3′ UTR starts immediatelyBSL-0035-CA 23 following the stop codon and continues until the transcription termination signal. There is growing evidence for the regulatory role of the UTR in the stability and translation of nucleic acid molecules. The regulatory features of the UTR can be incorporated into the polynucleotides of the present disclosure to particularly enhance the stability of the molecule. The specific features can also be incorporated to ensure controlled down-regulation of transcripts in case they are misdirected to undesired organ sites. A variety of 5′ UTR and 3′ UTR sequences are known and available in the art.
[0095] In some embodiments of the present disclosure, the 5′ UTR is a heterologous UTR, i.e., is a UTR found in nature associated with a different ORF. In another embodiment, the 5′ UTR is a synthetic UTR, i.e., does not occur in nature. The synthetic UTR includes UTRs that have been mutated to improve their properties, such as UTRs that increase gene expression as well as fully synthetic UTRs. Exemplary 5′ UTRs include Xenopus or human α-globin or β-globin (8278063; 9012219), human cytochrome b-245a polypeptide, hydroxysteroid (17b) dehydrogenase, and tobacco etch virus (US8278063, 9012219).
[0096] In some embodiments, the 5′ UTR of the present disclosure comprises a sequence selected from SEQ ID NO: 173 to 174.
[0097] In some preferred embodiments, the 5′ UTR of the present disclosure comprises a sequence selected from SEQ ID NO: 174.
[0098] The 3′ UTR is a region of an mRNA that is directly downstream (3′) from the stop codon (the codon of an mRNA transcript that signals a termination of translation). The 3′ UTR does not encode a protein (which is non-coding). Native or wild-type 3′ UTRs are known to have stretches of adenosine (A) and uridine (U) embedded in them. These AU-rich elements are particularly prevalent in genes with high rates of turnover.
[0099] The introduction, removal, or modification of 3′ UTR AU-rich elements (AREs) can be used to modulate the stability of the nucleic acids (e.g., RNA) of the present disclosure. When engineering a specific nucleic acid, one or more copies of an ARE can be introduced to make the nucleic acids of the present disclosure less stable, thereby reducing translation and decreasing the production of the resulting protein. Likewise, AREs can be identified and removed or mutated to increase the intracellular stability, thereby increasing translation and production of the resulting protein.BSL-0035-CA 24
[0100] The 3′ UTR may be heterologous or synthetic. With respect to 3′ UTRs, globin UTRs (including Xenopus β-globin UTRs and human β-globin UTRs) are known in the art (8278063, 9012219, US20110086907). A nucleic acid (e.g., mRNA) encoding a modified β-globin with enhanced stability in some cell types has been developed by cloning two sequential human β- globin 3′ UTRs head to tail and is well known in the art (US2012 / 0195936, WO2014 / 071963).
[0101] In some embodiments, the 3′ UTR of the present disclosure comprises a sequence selected from SEQ ID NO: 175.
[0102] Those of ordinary skill in the art will understand that 5′ UTRs that are heterologous or synthetic may be used with any desired 3′ UTR sequence. For example, a heterologous 5′ UTR may be used with a synthetic 3′ UTR or a heterologous 3′ UTR.
[0103] It should be understood that any UTR from any gene may be incorporated into a region of a nucleic acid. Furthermore, multiple wild-type UTRs of any known gene may be utilized. It is also within the scope of the present disclosure to provide artificial UTRs which are not variants of the wild-type region. These UTRs or portions thereof may be placed in the same orientation as in the transcript from which they are selected, or may be altered in orientation or location. Thus, a 5′ or 3′ UTR may be inverted, shortened, lengthened, or prepared with one or more other 5′ UTRs or 3′ UTRs. As used herein, the term "altered" as it relates to a UTR sequence, means that the UTR has been changed in some way relative to a reference sequence. For example, a 3′ UTR or 5′ UTR may be altered relative to a wild-type or native UTR by the change in orientation or location as taught above, or may be altered by the inclusion of additional nucleotides, deletion of nucleotides, exchange or transposition of nucleotides. Any of these changes producing an "altered" UTR (whether 3′ or 5′) comprises a variant UTR.
[0104] In vitro transcription of RNA: cDNA encoding the polynucleotides described herein may be transcribed using an in vitro transcription (IVT) system. In some embodiments, the RNA transcript is generated in an in vitro transcription reaction using a non-amplified, linearized DNA template to generate the RNA transcript. In some embodiments, the template DNA is isolated DNA. In some embodiments, the template DNA is cDNA. In some embodiments, the cDNA is formed by digestion of circular plasmid DNA. In some embodiments, cells, such as bacterial cells, such as E. coli cells, such as DH-1 cells are transfected with a plasmid DNA template. In some embodiments, the transfected cells areBSL-0035-CA 25 cultured to replicate the plasmid DNA, which is then isolated and purified. In some embodiments, the DNA template comprises an RNA polymerase promoter, such as a T7 promoter located 5′ to and operably linked to the target gene.
[0105] In some embodiments, an in vitro transcription template encodes a 5′ untranslated region (UTR), contains an open reading frame, and encodes a 3′ UTR and a poly(A) tail. The specific nucleic acid sequence composition and length of the in vitro transcription template will depend on the mRNA encoded by the template.
[0106] "5′ untranslated region" (UTR) refers to a region of an mRNA that is directly upstream (i.e., 5′) from the start codon (i.e., the first codon of an mRNA transcript translated by a ribosome) that does not encode a polypeptide. When generating RNA transcripts, the 5′ UTR may comprise a promoter sequence. Such promoter sequences are known in the art. It should be understood that such promoter sequences will not be present in the vaccine of the present disclosure.
[0107] "3′ untranslated region" (UTR) refers to a region of an mRNA that is directly downstream (i.e., 3′) from the stop codon (i.e., the codon of an mRNA transcript that signals a termination of translation) that does not encode a polypeptide.
[0108] An "open reading frame" is a continuous stretch of DNA beginning with a start codon (e.g., methionine (ATG)) and ending with a stop codon (e.g., TAA, TAG, or TGA), and encodes a polypeptide.
[0109] A "poly(A) tail" is a region of an mRNA that is downstream, such as directly downstream (i.e., 3′) from the 3′ UTR that contains multiple consecutive adenosine monophosphates. The poly(A) tail may contain 10 to 300 adenosine monophosphates. For example, the poly(A) tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 adenosine monophosphates. In some embodiments, the poly(A) tail contains 50 to 250 adenosine monophosphates. In a relevant biological context (e.g., in cells, in vivo), the poly(A) tail functions to protect an mRNA from enzymatic degradation, e.g., in the cytoplasm, and aids in transcription termination, and / or export of the mRNA from the nucleus and translation.
[0110] In some embodiments, the nucleic acid comprises 200 to 3000 nucleotides. ForBSL-0035-CA 26 example, the nucleic acid may comprise 200 to 500, 200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500, 500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000, 1500 to 3000, or 2000 to 3000 nucleotides.
[0111] The in vitro transcription system typically comprises a transcription buffer, a nucleotide triphosphate (NTP), an RNase inhibitor, an inorganic pyrophosphate, and a polymerase.
[0112] The NTP may be manufactured internally, may be selected from a supplier, or may be synthesized as described herein. The NTP may be selected from, but is not limited to, those described herein including natural and non-natural (modified) NTPs.
[0113] Any number of RNA polymerases or variants may be used in the method of the present disclosure. The polymerase may be selected from, but is not limited to, a phage RNA polymerase, such as a T7 RNA polymerase, a T3 RNA polymerase, a SP6 RNA polymerase, and / or a mutant polymerase such as, but not limited to, polymerases capable of incorporating modified nucleic acids and / or modified nucleotides (including chemically modified nucleic acids and / or nucleotides). Some embodiments exclude the use of DNase.
[0114] In some embodiments, the RNA transcript can be capped by enzymatic capping or cotranscriptional capping reactions. In some embodiments, the RNA comprises a 5′ terminal cap, such as 7mG(5′)ppp(5′)NlmpNp.
[0115] Purification of mRNA: Purification of the nucleic acids described herein may include, but is not limited to, nucleic acid purification, quality assurance, and quality control. Purification may be performed by methods known in the art such as, but not limited to, lithium chloride precipitation, beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNA™ oligo-T capture probes (corporation, Vedbaek, Denmark), or HPLC-based purification methods such as, but not limited to, strong anion-exchange HPLC, weak anion-exchange HPLC, reverse-phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The term "purified" when used in relation to a nucleic acid such as a "purified nucleic acid" refers to one that is separated from at least one contaminant. A "contaminant" is any substance that makes another substance unfit, impure, or inferior. Thus, the purified nucleic acid (e.g., DNA and RNA) is present in a form or environment different from that in which it is found in nature, or a form or environment different from that in which it was present prior to being subjected toBSL-0035-CA 27 a processing or purification method.
[0116] Quality assurance and / or quality control check may be performed using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC.
[0117] Quantification: In some embodiments, the nucleic acid may be quantified using methods such as, but not limited to, ultraviolet-visible spectroscopy (UV / Vis). A non-limiting example of a UV / Vis spectrometer is a spectrometer (Thermo Fisher, Waltham, MA). The quantified nucleic acid may be analyzed in order to determine if the nucleic acid may be of appropriate size and to check that no degradation of the nucleic acid has occurred. Degradation of the nucleic acid may be checked by methods such as, but not limited to, agarose gel electrophoresis; HPLC-based purification methods such as, but not limited to, strong anionexchange HPLC, weak anion-exchange HPLC, reverse-phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC); liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE), and capillary gel electrophoresis (CGE).
[0118] Lipid nanoparticle (LNP): In some embodiments, the RNA (e.g., mRNA) of the present disclosure is formulated in a lipid nanoparticle (LNP). The lipid nanoparticle typically comprises an ionizable cationic lipid, a non-cationic lipid, a sterol, a PEG lipid component, and a nucleic acid cargo of interest. The lipid nanoparticles of the present disclosure can be generated using components, compositions, and methods commonly known in the art, see for example CN116535381B, TW202340136A, CN116178193B, CN116178193B, CN115784921B, CN115745820B, CN115677518B, CN114957027B, CN114044741B, CN116854754A, CN116785265A, CN116789764A, CN116396178A, CN116375592A, and CN116082275A, all of which are incorporated herein by reference in their entirety.
[0119] As used herein, the term "cationic lipid" refers to a lipid that is positively charged at a selected pH value. Cationic lipids are prone to bind to negatively charged nucleic acids, i.e., to form lipid nanoparticles (LNPs) by interacting with negatively charged phosphate groups present in nucleic acids through electrostatic forces. LNP is currently one of the mainstream delivery carriers.
[0120] As used herein, the term "neutral lipid" refers to an auxiliary lipid that is uncharged or exists in a zwitterionic form at a selected pH value. The neutral lipid may regulate the flowBSL-0035-CA 28 of nanoparticles into a lipid bilayer structure and improve efficiency by promoting lipid phase transition, and may also affect target organ specificity.
[0121] As used herein, a "structural lipid" refers to a lipid that enhances the stability of nanoparticles by filling the gaps between lipids. The structural lipid may be selected from, but is not limited to, the group consisting of cholesterol, nonsterol, sitosterol, ergosterol, campesterol, stigmasterol, brassinosterol, tomatine, ursolic acid, α-tocopherol, corticosteroid, and mixtures thereof. In some embodiments, the structural lipid is cholesterol. In some embodiments, the structural lipid includes cholesterol, corticosteroid (e.g., prednisolone, dexamethasone, prednisone, and hydrocortisone), or any combination thereof.
[0122] In some embodiments, the molar ratio of the cationic lipid to the structural lipid is about 1:1 to 5:1, for example, about 1.0:1, 1.1:1, 1.2:1, 1.3:1, 1.4:1, 1.5:1, 1.6:1, 1.7:1, 1.8:1, 1.9:1, or 2.0:1.
[0123] In some embodiments, the molar ratio of the cationic lipid to the neutral lipid is about (1 to 10):1, for example, about 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, or 10:1.
[0124] In some embodiments, the molar ratio of the cationic lipid to the structural lipid is about (1 to 5):1, for example, about 1:1, 2:1, 3:1, 4:1, or 5:1.
[0125] In some embodiments, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (25 to 65):(5 to 25):(25 to 45):(0.5 to 5). For example, in some embodiments, by proportion (relative number of moles), the cationic lipid is 25 parts, 30 parts, 35 parts, 40 parts, 45 parts, 50 parts, 55 parts, 60 parts, or 65 parts; the neutral lipid is 5 parts, 10 parts, 15 parts, 20 parts, or 25 parts; the structural lipid is 25 parts, 30 parts, 35 parts, 40 parts, or 45 parts; the polymer-conjugated lipid is 0.5 parts, 1 part, 1.5 parts, 2 parts, 2.5 parts, 3.0 parts, 3.5 parts, 4.0 parts, 4.5 parts, or 5.0 parts.
[0126] In some embodiments, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (49 to 50):10:(38.5 to 39.5):1. For example, in some embodiments, by proportion (relative number of moles), the cationic lipid is 49 parts or 50 parts; the neutral lipid is 10 parts; the structural lipid is 38.5 parts, 39.0 parts, or 39.5 parts; the polymer-conjugated lipid is 1 part; such as 50:10:38.5:1.5 or 49:10:39.5:1.5.
[0127] As used herein, the term "polymer-conjugated lipid" refers to a lipid modified with polyethylene glycol (PEG). Hydrophilic PEG stabilizes LNPs, regulates nanoparticle size byBSL-0035-CA 29 limiting lipid fusion, and increases nanoparticle half-life by reducing non-specific interactions with macrophages. In some embodiments, the polymer-conjugated lipid is selected from one or more of PEG-modified phosphatidylethanolamine, PEG-modified phosphatidic acid, PEGmodified ceramide, PEG-modified dialkylamine, PEG-modified diacylglycerol, or PEGmodified dialkylglycerol. The molecular weight of PEG for the PEG modification is usually 350 to 5000 Da. For example, the polymer-conjugated lipid is selected from one or more of distearoyl phosphatidylethanolamine polyethylene glycol 2000 (DSPE-PEG2000), dimyristoylglycero-3-methoxypolyethylene glycol 2000 (DMG-PEG2000), or methoxypolyethylene glycol ditetradecylacetamide (ALC-0159).
[0128] In one embodiment of the compositions / carriers of the present disclosure, the polymer-conjugated lipid is DMG-PEG2000.
[0129] In one embodiment of the compositions / carriers of the present disclosure, the carrier comprises a neutral lipid, a structural lipid, and a polymer-conjugated lipid, wherein the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (25 to 65):(5 to 25):(25 to 45):(0.5 to 5), such as (45 to 55):(9 to 11):(34 to 43):(0.5 to 2.5).
[0130] In one embodiment of the compositions / carriers of the present disclosure, the carrier comprises a neutral lipid, a structural lipid, and a polymer-conjugated lipid, wherein the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is 50:10:38.5:1.5.
[0131] As used herein, the term "alkyl" is meant to include branched and linear saturated aliphatic monovalent hydrocarbon groups having a specified number of carbon atoms. As used herein, the term "alkylene" is meant to include branched and linear saturated aliphatic divalent hydrocarbon groups having a specified number of carbon atoms. Cn-m refers to a group having n to m carbon atoms. For example, C2-5 alkylene includes C2 alkylene, C3 alkylene, C4 alkylene, and C5 alkylene. C2-8 alkylene includes C2 alkylene, C3 alkylene, C4 alkylene, C5 alkylene, C6 alkylene, C7 alkylene, and C8 alkylene. C1-6 alkylene includes C1 alkylene, C2 alkylene, C3 alkylene, C4 alkylene, C5 alkylene, and C6 alkylene. C1-3 alkylene includes C1 alkylene, C2 alkylene, and C3 alkylene. C6-15 linear alkyl includes a linear alkyl group having 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 carbon atoms. C12-25 branched alkyl includes a branched alkyl group having 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 carbonBSL-0035-CA 30 atoms. An alkyl (or alkylene) group can be unsubstituted, or an alkyl (or alkylene) group can be substituted in which at least one hydrogen is replaced by another chemical group.
[0132] As used herein, a "therapeutically effective amount" is an amount of a therapeutic agent that improves a disease or condition when administered to a patient. A "prophylactically effective amount" is an amount of a prophylactic agent that prevents a disease or condition when administered to a subject. The "therapeutically effective amount" for a therapeutic agent or the "prophylactically effective amount" for a prophylactic agent varies with the therapeutic / prophylactic agent, the disease state and its severity, the age and weight of a patient / subject to be treated / prevented, etc. The therapeutically effective amount and the prophylactically effective amount can be routinely determined by those of ordinary skill in the art based on their knowledge and the present disclosure.
[0133] As used herein, the composition may be used to induce a protective immune response against VZV in a subject in need thereof, wherein the protective immune response comprises, for example, the production of a neutralizing antibody. In some embodiments, the subject is immunocompromised. In some embodiments, the subject is 10 years of age or older, such as 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, or 80 years of age.
[0134] The vaccines of the present disclosure are typically formulated in lipid nanoparticles. In some embodiments, the lipid nanoparticle comprises at least one ionizable cationic lipid, at least one non-cationic lipid, at least one sterol, and / or at least one polyethylene glycol (PEG)- modified lipid.
[0135] In some preferred embodiments, the lipid nanoparticle comprises a cationic lipid, a neutral lipid, a structural lipid, and a polymer-conjugated lipid.
[0136] In some preferred embodiments, the cationic lipid is a compound with the structure of formula I, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-6 alkylene; G2 is C2-8 alkylene; G3 is C1-3 alkylene; L1 is C6-15 linear alkyl; L2 is C12-25 branched alkyl. For example, YK-009 with the structure of formula I-I (see patent CN114044741B).BSL-0035-CA 31
[0137] formula I formula I-I
[0138] In some preferred embodiments, the cationic lipid is a compound with the structure of formula II, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C2-8 alkylene; G2 is C2-8 alkylene; L1 is -C(O)O- or -OC(O)-; L2 is - C(O)O- or -OC(O)-; R1 is C6-25 linear or branched alkyl; R2 is C6-25 linear or branched alkyl; G3 is HO(CH2)2- or HO(CH2)3-; G4 is HO(CH2)2- or HO(CH2)3-; L is (CH2)2-, -(CH2)3-, or - (CH2)4-. For example, YK-401 with the structure of formula II-I or YK-402 with the structure of formula II-II (see patent CN115784921B).
[0139] formula II OH G3 N-G!—b—Rt N G2 1-2 ^2 g4 YK-401BSL-0035-CA 32 formula II-I formula II-II
[0140] In some preferred embodiments, the cationic lipid is a compound with the structure of formula III, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-6 alkylene; G2 is C2-8 alkylene; R1 is C6-20 linear or branched alkyl; R2 is C12-25 branched alkyl; G3 is HO(CH2)2N(CH3)(CH2)2-, HO(CH2)2N(CH2CH3)(CH2)2-, (HO(CH2)2)2N(CH2)2-, CH3O(CH2)2N(CH3)(CH2)2-, (CH3)2N(CH2)3SC(O)O(CH2)2-, (CH3)2N(CH2)3SC(O)-, CH3NH(CH2)2N(CH3)(CH2)2-, or CH3CH2NH(CH2)2-. For example, YK-201 with the structure of formula III-I or YK-202 with the structure of formula III-II (see patent CN115677518B).
[0141] formula III formula III-I YK-402 YK-201BSL-0035-CA 33 formula III-II
[0142] In some preferred embodiments, the cationic lipid is a compound with the structure of formula IV, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-8 alkylene; G2 is C2-8 alkylene; R1 is C6-25 linear or branched alkyl; R2 is C12-25 linear or branched alkyl; G3 is HO(CH2)2N(R3)CH2CH(OH)CH2-, wherein R3 is - CH3, -CH2CH3, or -CH2CH2OH. For example, YK-305 with the structure of formula IV-I or YK-310 with the structure of formula IV-II (see patent CN115745820B).
[0143] formula IV formula IV-I YK-202 YK-305BSL-0035-CA 34 formula IV-II
[0144] In some preferred embodiments, the cationic lipid is a compound with the structure of formula V, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 and G2 are each independently unsubstituted C6-C10 alkylene; G3 is unsubstituted C1-C12 alkylene; R1 and R2 are each independently C6-C24 alkyl or C6-C24 alkenyl; R3 is OR5, N, -C(=O)OR4, -OC(=O)R4, or -NR5C(=O)R4; R4 is C1-C12 hydrocarbyl; and R5 is H or C1-C6 hydrocarbyl; for example, ALC0315 with the structure of formula V-I (see patent CN108368028B). formula V, see (CN108368028B, ALC0315) formula V-I
[0145] In some preferred embodiments, the cationic lipid is a compound with the structure of formula VI, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein R4 is selected from -(CH2)nQ and -(CH2)nCHQR; Q is selected from the group R3 ^G3BSL-0035-CA 35 consisting of -OR, -OH, -O(CH2)nN(R)2, -OC(O)R, -CX3, -CN, -N(R)C(O)R, -N(H)C(O)R, - N(R)S(O)2R, -N(H)S(O)2R, -N(R)C(O)N(R)2, -N(H)C(O)N(R)2, -N(H)C(O)N(H)(R), - N(R)C(S)N(R)2, -N(H)C(S)N(R)2, -N(H)C(S)N(H)(R), -N(R)S(O)2R8, and heterocycle; n is 1, 2, or 3; for example, SM102 with the structure of formula VI-I (see patent CN110520409A).
[0146] formula VI, see (CN110520409A, SM102) formula VI-I
[0147] In some preferred embodiments, the cationic lipid is a compound with the structure of formula VII, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof. formula VII, see (CN102625696B, DLIN-MC3-DMA)
[0148] In some more preferred embodiments, the cationic lipid comprises YK-009, YK-401, YK-305, ALC0315, SM102, and DLIN-MC3-DMA.
[0149] In some preferred embodiments, the molar ratio of the cationic lipid to the neutral lipid is (1 to 10):1.
[0150] In some preferred embodiments, the molar ratio of the cationic lipid to the structural lipid is (1 to 5):1.
[0151] In some preferred embodiments, the molar ratio of the cationic lipid, the neutral lipid,BSL-0035-CA 36 the structural lipid, and the polymer-conjugated lipid is (25 to 75):(5 to 25):(15 to 65):(0.5 to 10).
[0152] In some preferred embodiments, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (35 to 49):(7.5 to 15):(35 to 55):(1 to 5), such as 49:10:43.5:1.5.
[0153] In some preferred embodiments, the neutral lipid includes one or more of phosphatidylcholine, phosphatidylethanolamine, sphingomyelin, ceramide, sterol, and derivatives thereof.
[0154] In some more preferred embodiments, the neutral lipid is selected from one or more of the following: 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-snglycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2- dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3- phosphocholine (DSPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl- 2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3- phosphocholine (18:0 Diether PC), 1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3- phosphocholine (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2- dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-dioleoyl-sn-glycero-3- phosphoethanolamine (DOPE), 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3- phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2- diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3- phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), dipalmitoyl phosphatidylglycerol (DPPG), palmitoyl oleoyl phosphatidylethanolamine (POPE), distearoyl-phosphatidyl-ethanolamine (DSPE), dipalmitoyl phosphatidylethanolamine (DPPE), dimyristoyl phosphoethanolamine (DMPE), 1- stearoyl-2-oleoyl-stearoylethanolamine (SOPE), 1-stearoyl-2-oleoyl-phosphatidylcholine (SOPC), sphingomyelin, phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, palmitoyl oleoyl phosphatidylcholine, lysophosphatidylcholine, lysophosphatidylethanolamine (LPE), or mixtures thereof.BSL-0035-CA 37
[0155] In some more preferred embodiments, the neutral lipid is DOPE and / or DSPC.
[0156] In some preferred embodiments, the structural lipid is selected from one or more of the following: cholesterol, nonsterol, sitosterol, ergosterol, campesterol, stigmasterol, brassinosterol, tomatine, ursolic acid, α-tocopherol, or corticosteroid.
[0157] In some more preferred embodiments, the structural lipid is cholesterol.
[0158] In some preferred embodiments, the polymer-conjugated lipid is selected from one or more of PEG-modified phosphatidylethanolamine, PEG-modified phosphatidic acid, PEGmodified ceramide, PEG-modified dialkylamine, PEG-modified diacylglycerol, or PEGmodified dialkylglycerol.
[0159] In some more preferred embodiments, the polymer-conjugated lipid is selected from one or more of distearoyl phosphatidylethanolamine polyethylene glycol 2000 (DSPEPEG2000), dimyristoylglycero-3-methoxypolyethylene glycol 2000 (DMG-PEG2000), or methoxypolyethylene glycol ditetradecylacetamide (ALC-0159).
[0160] Pharmaceutical preparation: Provided herein are compositions (e.g., pharmaceutical compositions), methods, kits, and reagents for the prevention or treatment of varicella-zoster virus in humans and other mammals, for example. The compositions provided herein can be used as therapeutic or prophylactic agents. They can be used in medications to prevent and / or treat herpes zoster.
[0161] In some embodiments, a herpes zoster vaccine containing RNA as described herein can be administered to a subject (e.g., a mammalian subject, such as a human subject), and the RNA polynucleotide is translated in vivo to produce an antigenic polypeptide (antigen).
[0162] An "effective amount" of a composition (e.g., comprising RNA) is based at least in part on the target tissue, target cell type, mode of administration, physical characteristics of the RNA (e.g., length, nucleotide composition, and / or degree of modified nucleosides), other components of the vaccine, and other determinants, such as age, body weight, height, sex, and general health of the subject. Typically, an effective amount of a composition provides an induced or boosted immune response as a function of antigen production in the cells of the subject. In some embodiments, an effective amount of a composition containing an RNA polynucleotide having at least one chemical modification is more efficient than a composition containing a corresponding unmodified polynucleotide encoding the same antigen or peptideBSL-0035-CA 38 antigen. Increased antigen production may be evidenced by increased cell transfection (the percentage of cells transfected with the RNA vaccine), increased protein translation and / or expression from the polynucleotide, decreased nucleic acid degradation (e.g., as evidenced by increased duration of protein translation from a modified polynucleotide), or altered antigenspecific immune response of the host cell.
[0163] The term "pharmaceutical composition" refers to the combination of an active agent with an inert or active carrier, making the composition particularly suitable for diagnostic or therapeutic use in vivo or ex vivo. A "pharmaceutically acceptable carrier" does not cause undesirable physiological effects after or during administration to a subject. The carrier in the pharmaceutical composition must also be "acceptable" in the sense that it is compatible with and capable of stabilizing the active ingredient. One or more solubilizers can be used as pharmaceutical carriers for delivery of the active agent.
[0164] In some embodiments, the composition (comprising a polynucleotide and the polypeptide it encodes) according to the present disclosure can be used to treat or prevent herpes zoster. The composition may be administered prophylactically or therapeutically to healthy individuals as part of an active immunization scheme or early in infection during the incubation phase or during active infection after onset of symptoms. In some embodiments, the amount of RNA provided to the cell, tissue, or subject may be an amount effective for immunoprophylaxis.
[0165] In some embodiments, the composition may be administered intramuscularly.
[0166] The composition can be used in a variety of settings depending on the prevalence of infection or the degree or level of unmet medical need. As a non-limiting example, RNA vaccines can be used to treat and / or prevent a variety of infectious diseases. RNA vaccines have superior properties in that they produce much larger antibody titers, better neutralizing immunity, produce more durable immune responses, and / or produce responses earlier than commercially available vaccines.
[0167] Provided herein are pharmaceutical compositions comprising RNA and / or complexes, optionally in combination with one or more pharmaceutically acceptable excipients. In addition to traditional excipients (e.g., any and all solvents, dispersion media, diluents or other liquid vehicles, dispersion or suspension aids, surfactants, isotonic agents, thickeners orBSL-0035-CA 39 emulsifiers, preservatives), excipients may include, but are not limited to, lipidoids, liposomes, lipid nanoparticles, polymers, lipid complexes, core-shell nanoparticles, peptides, proteins, cells transfected with RNA (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics, and combinations thereof.
[0168] The RNA may be formulated or administered alone or in combination with one or more other components. For example, an immunizing composition may comprise other components including, but not limited to, adjuvants.
[0169] The relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and / or any additional ingredients in the pharmaceutical composition according to the present disclosure will vary depending upon the identity, size, and / or condition of the subject being treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100%, e.g., between 0.5% and 50%, between 1% and 30%, between 5% and 80%, or at least 80% (w / w) of the active ingredient.
[0170] In some embodiments, an RNA is formulated using one or more excipients to increase mRNA stability, increase cell transfection efficiency and protein translation efficiency, alter the biodistribution of mRNA to target specific tissues or cell types, etc.
[0171] Dosing / administration: Provided herein are immunizing compositions (e.g., RNA vaccines), methods, kits, and reagents for the prevention of varicella-zoster virus in humans and other mammals. Immunizing compositions can be used as therapeutic or prophylactic agents. In some embodiments, immunizing compositions are used to provide prophylactic protection against herpes zoster.
[0172] A subject may be any mammal, including non-human primate and human subjects.
[0173] In some embodiments, an immunizing composition (e.g., RNA vaccine) is administered to a subject (e.g., a mammalian subject, such as a human subject) in an effective amount to induce an antigen-specific immune response. The RNA encoding the VZV gE antigen is expressed and translated in vivo to produce the antigen, which then stimulates an immune response in the subject.
[0174] Prophylactic protection against herpes zoster can be achieved following administration of the immunizing composition (e.g., RNA vaccine) of the present disclosure.BSL-0035-CA 40 The immunizing composition may be administered once, twice, three times, four times or more, but it is possible that a single vaccine administration is sufficient (optionally followed by a single booster).
[0175] A method for eliciting an immune response against a varicella-zoster virus antigen (or multiple antigens) in a subject is provided in an aspect of the present disclosure. In some embodiments, the method comprises administering to a subject an immunizing composition comprising an RNA (e.g., mRNA) having an open reading frame encoding a VZV gE glycoprotein, thereby inducing an immune response specific to the varicella-zoster virus antigen in the subject, wherein anti-antigen antibody titer in the subject is increased following vaccination relative to anti-antigen antibody titer in a subject vaccinated with a traditional vaccine (e.g., recombinant subunit vaccine from GSK). An "anti-antigen antibody" is a serum antibody that binds specifically to an antigen.
[0176] A prophylactically effective dose is an effective dose that prevents viral infection at a clinically acceptable level. In some embodiments, the effective dose is a dose listed in a package insert for the vaccine. As used herein, the traditional vaccine refers to a vaccine other than the mRNA vaccines of the present disclosure. For example, the traditional vaccine includes, but is not limited to, live microorganism vaccines, killed microorganism vaccines, subunit vaccines, protein antigen vaccines, DNA vaccines, virus-like particle (VLP) vaccines, etc. In exemplary embodiments, the traditional vaccine is a vaccine that has achieved regulatory approval and / or is registered by a national drug regulatory body, such as the U.S. Food and Drug Administration (FDA) or the European Medicines Agency (EMA).
[0177] A method for eliciting an immune response against a varicella-zoster virus in a subject is provided in other aspects of the present disclosure. The method comprises administering to a subject an immunizing composition (e.g., RNA vaccine) comprising an RNA polynucleotide comprising an open reading frame encoding a VZV gE antigen, thereby inducing an immune response specific to the varicella-zoster virus in the subject.
[0178] In other embodiments, the immune response is assessed by determining the protein (antibody titer) in the subject. In other embodiments, the ability of serum or antibody from an immunized subject to neutralize viral uptake or reduce varicella-zoster virus transformation of human B lymphocytes is tested. In other embodiments, the ability to promote a robust TBSL-0035-CA 41 cell response is measured using techniques recognized in the art.
[0179] Also provided herein is a method for eliciting an immune response against a varicellazoster virus in a subject by administering to the subject an RNA having an open reading frame encoding a first antigen, wherein the RNA does not comprise a stabilizing element, and wherein an adjuvant is not co-formulated or co-administered with the vaccine.
[0180] The immunizing composition (e.g., RNA vaccine) may be administered by any route that results in a therapeutically effective outcome. These routes include, but are not limited to, intradermal, intramuscular, or subcutaneous administration. The present disclosure provides a method comprising administering an RNA vaccine to a subject in need thereof. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, etc. The RNA is typically formulated in dosage unit form for ease of administration and uniformity of dosage. However, it should be understood that the total daily dosage of the RNA may be determined by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors, including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex, and diet of the patient; the time of administration, route of administration, and excretion rate of the specific compound employed; the duration of the treatment; medications used in combination or concurrently with the specific compound employed; and similar factors well known in the medical art.
[0181] The effective amount of the RNA as provided herein may be as low as 5 µg, administered for example as a single dose or as two 2.5 µg doses. In some embodiments, the effective amount is a total dose of 5 µg to 200 µg. For example, the effective amount may be a total dose of 5 μg, 10 μg, 20 μg, 25 μg, 30 μg, 35 μg, 40 μg, 45 μg, 50 μg, 55 μg, 60 μg, 65 μg, 70 μg, 75 μg, 80 μg, 85 μg, 90 μg, 95 μg, 100 μg, 110 μg, 120 μg, 130 μg, 140 μg, 150 μg, 160 μg, 170 μg, 180 μg, 190 μg, or 200 μg. In some embodiments, the effective amount is a total dose of 5 µg to 200 µg. In some embodiments, the effective amount is a total dose of 10 µg. In some embodiments, the effective amount is a total dose of 20 µg. In someBSL-0035-CA 42 embodiments, the effective amount is a total dose of 75 µg. In some embodiments, the effective amount is a total dose of 150 µg. In some embodiments, the effective amount is a total dose of 200 µg.
[0182] Vaccine efficacy Some aspects of the present disclosure provide a preparation of the immunizing composition (e.g., RNA vaccine), wherein the RNA is formulated in an effective amount to produce an antigen-specific immune response in a subject (e.g., to produce an antibody specific to a varicella-zoster virus antigen). An "effective amount" is a dose of the RNA effective to produce an antigen-specific immune response. Also provided herein is a method for inducing an antigen-specific immune response in a subject.
[0183] As used herein, the immune response to the vaccine or LNP of the present disclosure is the generation of a humoral and / or a cellular immune response in a subject to (one or more) varicella-zoster virus proteins present in the vaccine. For purposes of the present disclosure, the "humoral" immune response refers to an immune response mediated by antibody molecules, including, for example, secretory (IgA) or IgG molecules, while the "cellular" immune response refers to an immune response mediated by T lymphocytes (e.g., CD4+ helper and / or CD8+ T cells, such as CTLs) and / or other leukocytes. One important aspect of cellular immunity involves an antigen-specific response by cytolytic T lymphocytes (CTLs). CTLs have specificity for peptide antigens that are presented in association with proteins encoded by the major histocompatibility complex (MHC) and expressed on the cell surface. CTLs help induce and promote the destruction of intracellular microorganisms or the lysis of cells infected with such microorganisms. Another aspect of cellular immunity involves an antigen-specific response by helper T cells. Helper T cells serve to help stimulate the function, and focus the activity of non-specific effector cells on cells that display peptide antigens in association with MHC molecules on their surface. The cellular immune response also leads to the production of cytokines (e.g., IFN-γ, IL-2, TNF-β), chemokines, and other such molecules produced by activated T cells and / or other leukocytes.
[0184] In some embodiments, the antigen-specific immune response is characterized by measuring an anti-varicella-zoster virus antigen antibody titer produced in a subject administered the immunizing composition as provided herein. Antibody titer is aBSL-0035-CA 43 measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen (e.g., an anti-VZV gE glycoprotein) or an epitope of the antigen. Antibody titer is typically expressed as the reciprocal of the maximum dilution that provides a positive result. For example, enzyme-linked immunosorbent assay (ELISA) is a common assay for determining antibody titers.
[0185] In some embodiments, antibody titers are used to assess whether a subject has been infected or to determine whether immunization is required. In some embodiments, antibody titers are used to determine the strength of an autoimmune response, to determine whether a booster immunization is needed, to determine whether a prior vaccine is effective, and to identify any recent or prior infections. According to the present disclosure, antibody titers can be used to determine the strength of an immune response induced in a subject by an immunizing composition (e.g., RNA vaccine).
[0186] In some embodiments, the anti-VZV gE antigen antibody titer produced in the subject is increased by at least 1 log relative to a control (unvaccinated subject). For example, the anti-VZV gE antigen antibody titer produced in the subject may be increased by at least 1.5, at least 2, at least 2.5, at least 3, at least 3.5, or at least 4 log relative to a control. In some embodiments, the anti-VZV gE antigen antibody titer produced in the subject is increased by 1, 1.5, 2, 2.5, or 3 log relative to a control. In some embodiments, the anti-VZV gE antigen antibody titer produced in the subject is increased by 1 to 4 log relative to a control. For example, the anti-VZV gE antigen antibody titer produced in the subject may be increased by 1 to 1.5, 1 to 2, 1 to 2.5, 1 to 3, 1.5 to 2, 1.5 to 2.5, 1.5 to 3, 2 to 2.5, 2 to 3, or 2.5 to 4 log relative to a control.
[0187] In some embodiments, the anti-VZV gE antigen antibody titer produced in the subject is increased by at least 2-fold relative to a control (vaccinated with the traditional vaccine Shingrix® from GSK). For example, the anti-VZV gE antigen antibody titer produced in the subject may be increased by at least 1-fold, at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, or at least 3.5-fold relative to control GSK.
[0188] In some embodiments, the control is an anti-varicella-zoster virus antigen antibody titer produced in a subject not administered an immunizing composition (e.g., RNA vaccine). In some embodiments, the control is an anti-varicella-zoster virus antigen antibody titerBSL-0035-CA 44 produced in a subject administered the recombinant subunit vaccine Shingrix®.
[0189] In some embodiments, the ability of an immunizing composition (e.g., RNA vaccine) to be effective is measured in a murine model. For example, the immunizing composition can be administered to a murine model and the murine model can be assayed for induction of neutralizing antibody titers. Viral challenge studies can also be used to assess the efficacy of the vaccines of the present disclosure. For example, the immunizing composition can be administered to a murine model, the murine model can be challenged with virus, and the murine model can be assayed for survival and / or immune response (e.g., T cell response, such as cytokine response).
[0190] The present disclosure also relates to the following embodiments: 1. An immunogenic composition, comprising a ribonucleic acid (RNA) of a varicellazoster virus (VZV) encoding a wild-type VZV gE glycoprotein or a variant thereof; wherein the sequence of the wild-type VZV gE glycoprotein is SEQ ID NO: 3.
[0191] 2. The composition according to embodiment 1, wherein the variant of the VZV gE glycoprotein comprises one or more of the following mutations relative to the wild-type VZV gE glycoprotein: a sequence truncation, a site mutation, and a sequence deletion.
[0192] 3. The composition according to embodiment 2, wherein the sequence truncation comprises a lack of a carboxy-terminal tail domain.
[0193] 4. The composition according to any one of embodiments 1 to 3, wherein the sequence truncation is selected from any one of the group consisting of: 1) truncation of amino acids 540 to 623 at the C-terminal of gE protein; i.e., retention of amino acids 1 to 539 of VZV gE protein; 2) truncation of amino acids 569 to 623 at the C-terminal of gE protein; i.e., retention of amino acids 1 to 568 of VZV gE protein; 3) truncation of amino acids 574 to 623 at the C-terminal of gE protein; i.e., retention of amino acids 1 to 573 of VZV gE protein; 4) truncation of amino acids 588 to 623 at the C-terminal of gE protein; i.e., retention of amino acids 1 to 587 of VZV gE protein; 5) truncation of amino acids 602 to 623 at the C-terminal of gE protein; i.e., retention of amino acids 1 to 601 of VZV gE protein.BSL-0035-CA 45
[0194] 5. The composition according to any one of embodiments 2 to 4, wherein the variant of the VZV gE glycoprotein comprises a site mutation selected from: a mutation in a motif associated with ER retention and endocytosis of gE protein, and / or at least one site mutation in at least one motif associated with localization to Golgi or trans Golgi network, and at least one site mutation in a phosphorylated acidic motif at the C-terminal of gE; wherein the motif associated with ER retention and endocytosis of gE protein includes a "Y582A583G584L585" motif (e.g., a mutation in the "Y582A583G584L585" motif can prevent endocytosis of gE protein and reduce gE antigen localization to trans Golgi network, such as mutation site Y582A, YK-VZV-013 (SEQ ID NO: 43)); the motif associated with gE protein localization to Golgi or trans Golgi network includes an "A568Y569R570V571" motif (e.g., the "A568Y569R570V571" motif, with a specific mutant antigen sequence such as YK-VZV-011 (SEQ ID NO: 35)); the phosphorylated acidic motif at the C-terminal of gE includes an "S593E594S595T596D597T598" motif (e.g., a mutation of the "S593E594S595T596D597T598" motif to an "A593E594A595A596D597A598" motif can reduce gE antigen localization to trans Golgi network, with a specific mutant antigen sequence such as YK-VZV-010 (SEQ ID NO: 31)).
[0195] 6. The composition according to any one of embodiments 2 to 5, wherein the variant of the VZV gE glycoprotein comprises a site mutation selected from: A568D, Y569K, Y569A, R570E, V571K, Y582A, S593A, S595A, T596A, and T598A; for example, selected from A568D, Y569K, R570E, and V571K; for example, selected from A568D and Y569K.
[0196] 7. The composition according to any one of embodiments 2 to 6, wherein the variant of the VZV gE glycoprotein comprises a site mutation selected from: 1) A568D; Y569K; R570E; V571K; (YK-VZV-023, YK-VZV-011) 2) A568D; Y569A; R570E; V571K; (YK-VZV-024) 3) Y569K; R570E; V571K; (YK-VZV-025) 4) A568D; Y569K; R570E; V571K; Y582A; (YK-VZV-030, YK-VZV-013) 5) A568D; Y569K; R570E; V571K; Y582G; (YK-VZV-031, YK-VZV-038) 6) A568D; Y582A; (YK-VZV-032) 7) Y569K; Y582A; (YK-VZV-033, YK-VZV-009) 8) R570E; Y582A; (YK-VZV-034)BSL-0035-CA 46 9) V571K; Y582A; (YK-VZV-035) 10) S593A; S595A; T596A; T598A; (YK-VZV-016, YK-VZV-044) 11) Y582A; S593A; S595A; T596A; T598A; (YK-VZV-037) 12) A568D; Y569K; R570E; V571K; Y582G; S593A; S595A; T596A; T598A; (YKVZV-039) 13) A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A; (YKVZV-014) 14) Y582G; S593A; S595A; T596A; T598A; (YK-VZV-040) 15) Y569K; Y582A; S593A; S595A; T596A; T598A; (YK-VZV-010) 16) A568D; Y569K; R570E; V571K; S593A; S595A; T596A; T598A; (YK-VZV-012) 17) Y582G; (YK-VZV-029) 18) A568D; (YK-VZV-018) 19) Y569K; (YK-VZV-020) 20) R570E; (YK-VZV-021) 21) V571K; and (YK-VZV-022) 22) Y582A; (YK-VZV-028, YK-VZV-036).
[0197] 8. The composition according to any one of embodiments 2 to 7, wherein the variant of the VZV gE glycoprotein comprises a site mutation selected from: 1) A568D; Y569K; R570E; V571K; (YK-VZV-011) 2) A568D; Y569A; R570E; V571K; (YK-VZV-024) 4) A568D; Y569K; R570E; V571K; Y582A; (YK-VZV-030, YK-VZV-013) 5) A568D; Y569K; R570E; V571K; Y582G; (YK-VZV-031, YK-VZV-038) 7) Y569K; Y582A; (YK-VZV-009) 13) A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A; (YKVZV-014); 15) Y569K; Y582A; S593A; S595A; T596A; T598A; (YK-VZV-010) 16) A568D; Y569K; R570E; V571K; S593A; S595A; T596A; T598A; (YK-VZV-012) 18) A568D; (YK-VZV-018) 19) Y569K; (YK-VZV-020) 20) R570E; (YK-VZV-021); andBSL-0035-CA 47 22) Y582A; (YK-VZV-028).
[0198] 9. The composition according to any one of embodiments 2 to 8, wherein the variant of the VZV gE glycoprotein comprises a sequence deletion selected from: 1) A568; 2) Y569RVDKSPYNQS579; and 3) Y569RVDKSPYNQSMYYAGLPV587.
[0199] 10. The composition according to any one of embodiments 1 to 9, wherein the variant of the VZV gE glycoprotein comprises a combination of a site mutation, a sequence truncation, and a sequence deletion selected from:BSL-0035-CA 48
[0200] Name Sequence truncation Site mutation Sequence deletion YK-VZV-018 gE (1 to 573) A568D No sequence deletion YK-VZV-020 gE (1 to 573) Y569K No sequence deletion YK-VZV-021 gE (1 to 573) R570E No sequence deletion YK-VZV-024 gE (1 to 573) A568D; Y569A; R570E; V571K No sequence deletion YK-VZV-028 gE (1 to 587) Y582A -Y569RVDKSPYNQS579- YK-VZV-030 gE (1 to 587) A568D; Y569K; R570E; V571K; Y582A No sequence deletion YK-VZV-031 gE (1 to 587) A568D; Y569K; R570E; V571K; Y582G No sequence deletion YK-VZV-038 No sequence truncation A568D; Y569K; R570E; V571K; Y582G No sequence deletion YK-VZV-009 No sequence truncation Y569K; Y582A No sequence deletion YK-VZV-010 No sequence truncation Y569K; Y582A; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-011 No sequence truncation A568D; Y569K; R570E; V571K No sequence deletion YK-VZV-012 No sequence truncation A568D; Y569K; R570E; V571K; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-013 No sequence truncation A568D; Y569K; R570E; V571K; Y582A No sequence deletion YK-VZV-014 No sequence truncation A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A No sequence deletion
[0201] .
[0202] 11. The composition according to any one of embodiments 1 to 10, wherein the variant of the VZV gE glycoprotein comprises a combination of a site mutation, a sequence truncation, and / or a sequence deletion selected from: Name Sequence truncation Site mutation Sequence deletion YK-VZV-018 gE (1 to 573) A568D No sequence deletion YK-VZV-020 gE (1 to 573) Y569K No sequence deletion YK-VZV-010 No sequence truncation Y569K; Y582A; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-011 No sequence truncation A568D; Y569K; R570E; V571K No sequence deletionBSL-0035-CA 49 YK-VZV-013 No sequence truncation A568D; Y569K; R570E; V571K; Y582A No sequence deletion .
[0203] 12. The composition according to any one of embodiments 1 to 11, wherein the variant of the VZV gE glycoprotein comprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO: 27, 31, 35, 39, 43, 47, 63, 71, 75, 87, 103, 111, 115, or 143.
[0204] 13. The composition according to any one of embodiments 1 to 12, wherein the variant of the VZV gE glycoprotein comprises SEQ ID NO: 31, 35, 43, 63, or 71.
[0205] 14. The composition according to any one of embodiments 1 to 13, wherein the RNA of VZV has an open reading frame (ORF) encoding a VZV gE glycoprotein or a variant thereof, wherein the open reading frame comprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 26, 30, 34, 38, 42, 46, 62, 70, 74, 86, 102, 110, 114, or 142.
[0206] 15. The composition according to embodiment 14, wherein the open reading frame comprises a sequence of SEQ ID NO: 30, 34, 42, 62, or 70.
[0207] 16. The composition according to any one of embodiments 1 to 15, wherein the RNA of the VZV further comprises a 5′ untranslated region (UTR).
[0208] 17. The composition according to embodiment 16, wherein the 5′ UTR comprises a sequence as shown in SEQ ID NO: 173, 174, 175, 176, or 177.
[0209] 18. The composition according to embodiment 17, wherein the 5′ UTR comprises a sequence as shown in SEQ ID NO: 174.
[0210] 19. The composition according to any one of embodiments 1 to 18, wherein the RNA of the VZV further comprises a 3′ untranslated region (UTR).
[0211] 20. The composition according to embodiment 19, wherein the 3′ UTR comprises a sequence as shown in SEQ ID NO: 178, 179, 180, or 181.
[0212] 21. The composition according to embodiment 20, wherein the 3′ UTR comprises a sequence as shown in SEQ ID NO: 178.
[0213] 22. The composition according to any one of embodiments 1 to 21, wherein the RNABSL-0035-CA 50 of VZV further comprises a poly(A) tail.
[0214] 23. The composition according to embodiment 22, wherein the poly(A) tail has a length of 50 to 150 nucleotides.
[0215] 24. The composition according to any one of embodiments 1 to 23, wherein the RNA of the VZV further comprises a 5′ terminal cap.
[0216] 25. The composition according to embodiment 24, wherein the 5′ terminal cap is 7mG(5′)ppp(5′)NlmpNp.
[0217] 26. The composition according to any one of embodiments 14 to 25, wherein the sequence of the open reading frame is codon-optimized.
[0218] 27. The composition according to embodiment 26, wherein the sequence of the open reading frame comprises at least one base modification.
[0219] 28. The composition according to embodiment 27, wherein the base modification is selected from one or more of the following: pseudouridine, N1-methylpseudouridine, N1- ethylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deazapseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thiodihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thiopseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thiopseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine, and 2′-Omethyluridine.
[0220] 29. The composition according to embodiment 28, wherein the base modification comprises replacement of uracil by pseudouridine and / or N1-methylpseudouridine.
[0221] 30. The composition according to embodiment 27, 28, or 29, wherein the base modification is 1 to 100% base modification, such as 1% base modification, 2% base modification, 3% base modification, 4% base modification, 5% base modification, 6% base modification, 7% base modification, 8% base modification, 9% base modification, 10% base modification, 15% base modification, 20% base modification, 25% base modification, 30% base modification, 35% base modification, 40% base modification, 45% base modification, 50% base modification, 55% base modification, 60% base modification, 65% base modification, 70% base modification, 75% base modification, 80% base modification, 85% base modification, 90% base modification, 95% base modification, and 100% base modification; and a range with anyBSL-0035-CA 51 of the above values as endpoints.
[0222] 31. The composition according to any one of embodiments 1 to 30, wherein the RNA of the VZV comprises a sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 28, 32, 36, 40, 44, 48, 64, 72, 76, 88, 104, 112, 116, or 144.
[0223] 32. The composition according to embodiment 31, wherein the RNA of the VZV comprises a sequence as shown in SEQ ID NO: 32, 36, 44, 64, or 72.
[0224] 33. The composition according to any one of embodiments 1 to 32, wherein the RNA of the VZV is mRNA.
[0225] 34. The composition according to any one of embodiments 1 to 33, wherein the RNA encoding the VZV gE glycoprotein comprises an RNA sequence corresponding to a DNA sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 25, 29, 33, 37, 41, 45, 61, 69, 73, 85, 101, 109, 113, or 141.
[0226] 35. The composition according to embodiment 34, wherein the RNA encoding the VZV gE glycoprotein comprises an RNA sequence corresponding to the DNA sequence as shown in SEQ ID NO: 29, 33, 41, 61, or 69.
[0227] 36. A method for preparing the composition according to any one of embodiments 1 to 35, comprising: providing a template that can transcribe the RNA of the VZV; transcribing the RNA using the template under conditions suitable for transcription.
[0228] 37. The method according to embodiment 36, further comprising a purification step selected from: lithium chloride precipitation, affinity chromatography, ultrafiltration exchange, and cellulose chromatography.
[0229] 38. The composition according to any one of embodiments 1 to 35, wherein the composition is a vaccine, and further comprises a pharmaceutically acceptable carrier.
[0230] 39. The composition according to embodiment 38, wherein the carrier comprises a lipid mixture, such as a lipid nanoparticle (LNP).
[0231] 40. The composition according to embodiment 38 or 39, wherein the vaccine is an mRNA vaccine.BSL-0035-CA 52
[0232] 41. The composition according to embodiment 39 or 40, wherein the lipid mixture is a lipid nanoparticle (LNP), for example, comprising a cationic lipid, a neutral lipid, a structural lipid, and a polymer-conjugated lipid.
[0233] 42. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula I, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-6 alkylene; G2 is C2-8 alkylene; G3 is C1-3 alkylene; L1 is C6-15 linear alkyl; L2 is C12-25 branched alkyl; for example, the cationic lipid is YK-009 with the structure of formula I-I.
[0234] formula I formula I-I
[0235] 43. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula II, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C2-8 alkylene; G2 is C2-8 alkylene; L1 is -C(O)O- or -OC(O)-; L2 is -C(O)O- or -OC(O)-; R1 is C6-25 linear or branched alkyl; R2 is C6-25 linear or branched alkyl; G3 is HO(CH2)2- or HO(CH2)3-; G4 is HO(CH2)2- or HO(CH2)3-; L is (CH2)2-, -(CH2)3-, or -(CH2)4-; for example, the cationic lipid is YK-401 with the structure of formula II-I or YK-402 with the structure of formula II-II.
[0236] OHBSL-0035-CA 53 formula II formula II-I formula II-II
[0237] 44. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula III, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-6 alkylene; G2 is C2-8 alkylene; R1 is C6-20 linear or branched alkyl; R2 is C12-25 branched alkyl; G3 is HO(CH2)2N(CH3)(CH2)2-, HO(CH2)2N(CH2CH3)(CH2)2-, (HO(CH2)2)2N(CH2)2-, CH3O(CH2)2N(CH3)(CH2)2-, (CH3)2N(CH2)3SC(O)O(CH2)2-, (CH3)2N(CH2)3SC(O)-, CH3NH(CH2)2N(CH3)(CH2)2-, or CH3CH2NH(CH2)2-; for example, YK-201 with the structure of formula III-I or YK-202 with the structure of formula III-II.
[0238] G? N—G^U—Ri N G2 I-2 R2 G4 YK-402BSL-0035-CA 54 formula III formula III-I formula III-II
[0239] 45. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula IV, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 is C1-8 alkylene; G2 is C2-8 alkylene; R1 is C6-25 linear or branched alkyl; R2 is C12-25 linear or branched alkyl; G3 is HO(CH2)2N(R3)CH2CH(OH)CH2-, wherein R3 is -CH3, -CH2CH3, or -CH2CH2OH; for example, YK-305 with the structure of formula IV-I or YK-310 with the structure of formula IV-II.
[0240] G3x N "Ri YK-201 YK-202 G3X ^Gi ,O^xG2 o rBSL-0035-CA 55 formula IV formula IV-I formula IV-II
[0241] 46. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula V, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein G1 and G2 are each independently unsubstituted C6-C10 alkylene; G3 is unsubstituted C1-C12 alkylene; R1 and R2 are each independently C6-C24 alkyl or C6-C24 alkenyl; R3 is OR5, N, -C(=O)OR4, -OC(=O)R4, or - NR5C(=O)R4; R4 is C1-C12 hydrocarbyl; and R5 is H or C1-C6 hydrocarbyl; for example, ALC0315 with the structure of formula V-I.
[0242] formula VBSL-0035-CA 56 formula V-I
[0243] 47. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula VI, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof, wherein R4 is selected from -(CH2)nQ and - (CH2)nCHQR; Q is selected from the group consisting of -OR, -OH, -O(CH2)nN(R)2, -OC(O)R, -CX3, -CN, -N(R)C(O)R, -N(H)C(O)R, -N(R)S(O)2R, -N(H)S(O)2R, -N(R)C(O)N(R)2, - N(H)C(O)N(R)2, -N(H)C(O)N(H)(R), -N(R)C(S)N(R)2, -N(H)C(S)N(R)2, -N(H)C(S)N(H)(R), -N(R)S(O)2R8, and heterocycle; n is 1, 2, or 3; for example, SM102 with the structure of formula VI-I. formula VI formula VI-I
[0244] 48. The composition according to embodiment 41, wherein the cationic lipid is a compound with the structure of formula VII, or an N-oxide, a solvate, a pharmaceutically acceptable salt, or a stereoisomer thereof.BSL-0035-CA 57 formula VII
[0245] 49. The composition according to embodiment 41, wherein the cationic lipid is selected from YK-009, YK-401, YK-305, ALC0315, SM102, and DLIN-MC3-DMA.
[0246] 50. The composition according to any one of embodiments 41 to 49, wherein the molar ratio of the cationic lipid to the neutral lipid is (1 to 10):1.
[0247] 51. The composition according to any one of embodiments 41 to 50, wherein the molar ratio of the cationic lipid to the structural lipid is (1 to 5):1.
[0248] 52. The composition according to any one of embodiments 41 to 51, wherein the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (25 to 65):(5 to 25):(25 to 45):(0.5 to 5).
[0249] 53. The composition according to embodiment 52, wherein the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (49 to 50):10:(38.5 to 39.5):1.5, such as 50:10:38.5:1.5 or 49:10:39.5:1.5.
[0250] 54. The composition according to any one of embodiments 41 to 53, wherein the neutral lipid is selected from phosphatidylcholine, phosphatidylethanolamine, sphingomyelin, ceramide, sterol, derivatives thereof, and any combination thereof.
[0251] 55. The composition according to any one of embodiments 41 to 54, wherein the neutral lipid is selected from: 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2- dimyristoyl-sn-glycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3- phosphocholine (DSPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl- 2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3- phosphocholine (18:0 Diether PC), 1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3- phosphocholine (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2- dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-dioleoyl-sn-glycero-3-BSL-0035-CA 58 phosphoethanolamine (DOPE), 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3- phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2- diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3- phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), dipalmitoyl phosphatidylglycerol (DPPG), palmitoyl oleoyl phosphatidylethanolamine (POPE), distearoyl-phosphatidyl-ethanolamine (DSPE), dipalmitoyl phosphatidylethanolamine (DPPE), dimyristoyl phosphoethanolamine (DMPE), 1- stearoyl-2-oleoyl-stearoylethanolamine (SOPE), 1-stearoyl-2-oleoyl-phosphatidylcholine (SOPC), sphingomyelin, phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, palmitoyl oleoyl phosphatidylcholine, lysophosphatidylcholine, lysophosphatidylethanolamine (LPE), and mixtures thereof.
[0252] 56. The composition according to any one of embodiments 41 to 55, wherein the neutral lipid is DOPE and / or DSPC.
[0253] 57. The composition according to any one of embodiments 41 to 56, wherein the structural lipid is selected from: sterol, cholesterol, nonsterol, sitosterol, ergosterol, campesterol, stigmasterol, brassinosterol, tomatine, ursolic acid, α-tocopherol, corticosteroid, and any combination thereof.
[0254] 58. The composition according to embodiment 57, wherein the structural lipid comprises cholesterol; for example, the structural lipid is cholesterol.
[0255] 59. The composition according to any one of embodiments 41 to 56, wherein the polymer-conjugated lipid is selected from: PEG-modified phosphatidylethanolamine, PEGmodified phosphatidic acid, PEG-modified ceramide, PEG-modified dialkylamine, PEGmodified diacylglycerol, PEG-modified dialkylglycerol, and any combination thereof.
[0256] 60. The composition according to embodiment 59, wherein the polymer-conjugated lipid is selected from: distearoyl phosphatidylethanolamine polyethylene glycol 2000 (DSPEPEG2000), dimyristoylglycero-3-methoxypolyethylene glycol 2000 (DMG-PEG2000), methoxypolyethylene glycol ditetradecylacetamide (ALC-0159), and any combination thereof.
[0257] 61. The composition according to any one of embodiments 38 to 60, wherein the RNA of the VZV has an effective dose of 25 μg to 200 μg; preferably 50 μg to 100 μg.BSL-0035-CA 59
[0258] 62. The composition according to any one of embodiments 38 to 60, wherein the vaccine is an injection, such as a liquid preparation or a lyophilized preparation.
[0259] 63. A method for preparing the composition according to any one of embodiments 38 to 60, comprising: mixing the RNA of the VZV with the pharmaceutically acceptable carrier, for example to encapsulate at least a portion of the RNA in lipid nanoparticles.
[0260] 64. The method according to embodiment 63, further comprising a purification step of removing an unencapsulated component, such as dialysis and / or filtration.
[0261] 65. The method according to embodiment 64, wherein the unencapsulated component is selected from: unencapsulated RNA, a non-aqueous solvent, and bacteria.
[0262] 66. A use of the composition according to any one of embodiments 1 to 62 in the preparation of a medicament for inducing a protective immune response against VZV in a subject, wherein the protective immune response comprises, for example, the production of a neutralizing antibody.
[0263] 66a. The composition according to any one of embodiments 1 to 62, for use in inducing a protective immune response against VZV in a subject in need thereof, wherein the protective immune response comprises, for example, the production of a neutralizing antibody.
[0264] 66b. A method for inducing a protective immune response against VZV in a subject in need thereof, comprising administering to the subject the composition according to any one of embodiments 1 to 62, wherein the protective immune response comprises, for example, the production of a neutralizing antibody.
[0265] 67. The use, composition, or method according to embodiment 66, 66a, or 66b, wherein the subject is immunocompromised.
[0266] 68. The use, composition, or method according to embodiment 66, 66a, 66b, or 67, wherein the subject is 10 years of age or older, such as 50, 60, 70, 80 years of age or older.
[0267] 69. The use, composition, or method according to any one of embodiments 66 to 68, wherein the protective immune response further comprises a cellular immune response.
[0268] 70. The use, composition, or method according to any one of embodiments 66 to 69, wherein the inducing a protective immune response is for the prevention of VZV infection.
[0269] 71. The use, composition, or method according to any one of embodiments 66 to 69, wherein the inducing a protective immune response is for the prevention of VZV-related pain.BSL-0035-CA 60
[0270] Example 1: VZV gE mutant antigen design As a highly glycosylated type I membrane protein, gE can be transported between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes. gE proteins have a number of important domains related to their primary functions.
[0271] (1) TM transmembrane domain, which consists of amino acids 539 to 559; (2) A568YRV571 motif, which mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes; (3) Y582AGL585 motif, which mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes; (4) S593ES595T596DT598 motif, which is an important glycosylation site and mediates gE transport between the endoplasmic reticulum (ER), trans Golgi network (TGN), and endosomes.
[0272] The intracellular carboxyl terminus of gE plays a decisive role in the intracellular transport of gE. Based on the important domains of gE proteins and their functions, a series of mRNA antigens targeting mutations in key structural / functional domains of gE and mutations in different truncated forms were designed (as shown in FIG. 1).
[0273] Using the wild-type sequence of the gE gene of VZV (with reference to NCBI strain sequence number QXN54923.1), a series of 43 different gE variant mRNA sequences were designed: Table 1 summarizes the mRNAs encoding variant gE antigens with different Cterminal sequences, in which YK-VZV-004, YK-VZV-006, YK-VZV-045, and YK-VZV-007 correspond to the sequences of mutations or combinations of mutations in the disclosed patents (US11643441B1, CN114081943A, US20230233671A1, and CN108472309A), respectively.
[0274] Table 1: Herpes zoster mRNA vaccine antigens
[0275] SEQ ID NO: Name Sequence truncation: (truncated to) Site mutation Sequence deletion 7 YK-VZV-002 gE (1 to 539) Wild-type (WT) / 11 YK-VZV-003 gE (1 to 568) WT / 59 YK-VZV-017 gE (1 to 573) WT / 15 YK-VZV-004 Y569A (Comparative Example 1) / BSL-0035-CA 61 63 YK-VZV-018 A568D / 67 YK-VZV-019 A568 71 YK-VZV-020 Y569K / 75 YK-VZV-021 R570E / 79 YK-VZV-022 V571K / 83 YK-VZV-023 A568D; Y569K; R570E; V571K / 87 YK-VZV-024 A568D; Y569A; R570E; V571K / 91 YK-VZV-025 Y569K; R570E; V571K -A568- 95 YK-VZV-026 gE (1 to 587) WT 99 YK-VZV-027 Y569RVDKSPYNQS579 103 YK-VZV-028 Y582A Y569RVDKSPYNQS579 107 YK-VZV-029 Y582G Y569RVDKSPYNQS579 111 YK-VZV-030 A568D; Y569K; R570E; V571K; Y582A / 115 YK-VZV-031 A568D; Y569K; R570E; V571K; Y582G / 119 YK-VZV-032 A568D; Y582A / 123 YK-VZV-033 Y569K; Y582A / 127 YK-VZV-034 R570E; Y582A / 131 YK-VZV-035 V571K; Y582A / 171 YK-VZV-045 gE (1 to 623) full-length Y582A (Comparative Example 3) / 3 YK-VZV-001 WT full-length / 51 YK-VZV-015 Y569RVDKSPYNQS579 55 YK-VZV-016 S593A; S595A; T596A; T598A Y569RVDKSPYNQS579 135 YK-VZV-036 Y582A Y569RVDKSPYNQS579 139 YK-VZV-037 Y582A; S593A; S595A; T596A; T598A Y569RVDKSPYNQS579 143 YK-VZV-038 A568D; Y569K; R570E; V571K; Y582G / 147 YK-VZV-039 A568D; Y569K; R570E; V571K; Y582G; S593A; S595A; T596A; T598A / 19 YK-VZV-006 Y569A; S593A; S595A; T596A; T598A (Comparative Example 2) / 23 YK-VZV-007 Y582A; S593A; S595A; T596A; T598A (Comparative Example 4) / 151 YK-VZV-040 Y582G; S593A; S595A; T596A; T598A / 27 YK-VZV-009 Y569K; Y582A / 31 YK-VZV-010 Y569K; Y582A; S593A; S595A; T596A; T598A / 35 YK-VZV-011 A568D; Y569K; R570E; V571K / 39 YK-VZV-012 A568D; Y569K; R570E; V571K; / BSL-0035-CA 62 S593A; S595A; T596A; T598A 43 YK-VZV-013 A568D; Y569K; R570E; V571K; Y582A / 47 YK-VZV-014 A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A / 163 YK-VZV-043 / Y569RVDKSPYNQSM YYAGLPV587 167 YK-VZV-044 S593A; S595A; T596A; T598A Y569RVDKSPYNQSM YYAGLPV587 155 YK-VZV-041 gE (1 to 601) / Y569RVDKSPYNQSM YYAGLPV587 159 YK-VZV-042 / Y569RVDKSPYNQSM YYAGLPV587
[0276] Example 2: Preparation of VZV gE antigen mRNA vaccine Preparation of transcription template linearized plasmid All antigen gene fragments were artificially synthesized and cloned into pVAX vector (purchased from Thermo Fisher Scientific) by GenScript Biotech Corporation, resulting in a successfully constructed circular plasmid.
[0277] The template was prepared by linearizing the plasmid using BsaI restriction endonuclease (purchased from Shanghai Beyotime Biotechnology Co., Ltd.). The digestion system included the supercoiled plasmid inserted into the target gene corresponding to Example 1, 10× digestion buffer, BsaI restriction endonuclease, and RNase-free ddH2O. The digestion reaction was conducted at 37°C for 3 hours, and the digestion system is shown in Table 2.
[0278] Table 2: Digestion reaction system Component Amount pDNA 1 to 2 μg 10× digestion buffer 5.0 μL BsaI (10 U / μL) 1.0 μL RNase-free ddH2O Up to 50 μL
[0279] After the digestion reaction was completed, the linearized product was recovered using a DNA product purification kit (purchased from Yeasen Biotechnology (Shanghai) Co., Ltd.). The product concentration was measured using an ultra-micro UV-Vis spectrophotometer (Denovix), and the length and status of the linearized plasmid template were detected by agarose gel electrophoresis.BSL-0035-CA 63
[0280] Preparation of mRNA stock solution The in vitro co-transcriptional capping reaction is a process that assembles modified or natural nucleoside triphosphates (NTPs) according to the base sequence of the template to prepare an mRNA polynucleotide, during which Clean Cap is added to generate an mRNA with a Cap1 structure through a one-step transcription reaction. The conventional reaction system consists of the following components (all purchased from Suzhou Novoprotein Scientific Co., Ltd.):
[0281] Table 3: In vitro co-transcriptional capping reaction system Component Amount Template cDNA 1.0 μg 10× transcription buffer 2.0 μL NTP (100 mM each) 2.0 μL each Cap1-GAG (100 mM) 2.0 μL RNase inhibitor 0.5 μL T7 RNA polymerase 2.0 μL RNase-free ddH2O Up to 20 μL Incubation at 37°C for 2 hours
[0282] After transcription was completed, 1 μL of DNase I (2 U / μL) was added, mixed well, and incubated at 37°C for 20 minutes to remove template DNA. The transcription product was then purified by lithium chloride precipitation.
[0283] 1) 30 μL of RNase-free H2O and 7.5 M lithium chloride (with a final concentration of 2.8 M) were added to 20 μL of reaction mixture.
[0284] 2) After mixing well, the mixture was allowed to stand at -20°C for 2 hours, followed by centrifugation at 12,000 rpm for 15 minutes, and the supernatant was discarded. The RNA pellet was washed with 500 μL of 70% ethanol, followed by centrifugation at 12,000 rpm for 5 minutes, which was repeated once to collect the pellet.
[0285] 3) After drying, the mRNA pellet was dissolved in 100 μL of enzyme-free water, and the purified RNA solution was stored at -80°C. The concentration and integrity of the mRNA was determined.
[0286] Preparation of mRNA-LNP (mRNA vaccine) 20 mg each of cationic lipid, DSPC, cholesterol, and DMG-PEG2000 were accurately weighed and dissolved in anhydrous ethanol to prepare a solution with a concentration of 10BSL-0035-CA 64 mg / mL, which was formulated into a carrier mixture in a molar ratio of 49:10:39.5:1.5 as the organic phase for later use.
[0287] VZV mRNA was dissolved in 50 mM citrate buffer (pH 4.0) and diluted to prepare a solution with a concentration of 0.15 mg / mL as the aqueous phase for later use. The LNP intermediate solution was prepared in a microfluidic device by drawing 2 mL of the organic phase using a BD (brand name, Bidi in Chinese, the same below) 3 mL syringe and 7 mL of the aqueous phase using a BD 10 mL syringe, with the organic phase on the left pump and the aqueous phase on the right pump.
[0288] The volume of preparation was 9.0 mL; the flow rate of the organic phase was 5.0 mL / min; the flow rate of the aqueous phase was 15 mL / min; the LNP intermediate solution was collected.
[0289] The LNP intermediate solution was diluted by adding 9 times the volume of PBS and concentrated by ultrafiltration on a small-scale ultrafiltration device with an ultrafiltration membrane pore size of 50 kD. The mixture was further diluted by adding 4 times the volume of PBS and concentrated on the ultrafiltration device when it was concentrated to around 10 mL. The ultrafiltration was stopped when the final concentrated volume was less than 5 mL.
[0290] Example 3: Detection of antigen expression of herpes zoster mRNA vaccine by Western Blot To verify whether the designed antigen mRNA sequence can be expressed in cells and to assess the expression efficiency of different antigen sequences, cells were first transfected with the mRNA sequence, and the expression of antigen mRNA in cells was detected using Western Blot.
[0291] Experimental materials
[0292] Table 4: Main experimental materials and sources Material name Source 293T cells Purchased from ATCC Series of mRNA vaccines Prepared in Example 2 RIPA lysis buffer Thermo Fisher Scientific BCA kit Thermo Fisher Scientific Primary antibody (anti-VZV gE protein antibody, mouse mAb) Abcam Secondary antibody (goat anti-mouse IgG) ACRO
[0293] Experimental stepsBSL-0035-CA 65 Cell culture and transfection: 293T cells were inoculated into a 12-well plate at a density of 2.5 × 105 cells / well. The volume of mRNA preparation required for 500 ng of mRNA was calculated, and the corresponding volume of mRNA preparation sample was directly added to the cells and mixed well.
[0294] Experimental group: a mixture of protein samples obtained by lysis of cells transfected with a series of mRNA vaccines prepared in Example 2; negative control (NC): RIPA lysis buffer; positive control (PC): purified gE protein; internal reference protein loading control: glyceraldehyde 3-phosphate dehydrogenase (GAPDH); Protein sample preparation: (i) After 16 hours of transfection, the cells were removed from the incubator and pipetted repeatedly so that the cells were detached from the bottom of the plate, then transferred to a 1.5 mL centrifuge tube, and centrifuged at 1,500 rpm for 3 minutes at 25°C. (ii) The supernatant was discarded. The cells were pipetted and resuspended in 1 mL of PBS, and centrifuged at 1500 rpm for 3 minutes at 25°C. (iii) The previous step was repeated twice. (iv) 50 μL of RIPA lysis buffer was added to each tube of cells (with 0.5 μL of 100× protease inhibitor added before the use of RIPA lysis buffer) and placed on ice for 30 minutes, during which the samples were vortexed for 30 seconds every 5 minutes. (v) The centrifuge was pre-cooled. After the cells were fully lysed, the samples were centrifuged at 12000 rpm for 10 minutes at 4°C. The supernatant was pipetted and transferred to a new 1.5 mL centrifuge tube to obtain protein samples to be tested.
[0295] Development and analysis: The concentration of protein samples was quantified using a BCA kit, and 200 μL of BCA working solution and 10 μL of the sample to be tested were added. 10 μg of protein samples were pipetted into a 1.5 mL centrifuge tube and added with water to prepare a 24 μL system. 6 μL of 5× loading buffer was added, and the volume was made up to 30 μL with purified water. The total proteins were boiled for denaturation. 3 μg of sample (9 μL) was pipetted for spotting, alongside 4 μL of marker, and subjected to electrophoresis at 200 V for 30 minutes. The membrane transfer was performed using a dry transmembrane instrument. The gel was removed, and a transfer membrane "sandwich" was prepared. The negative plate was covered, and the membrane transfer was performed at 21BSL-0035-CA 66 V, 23 V, and 25 V for 1, 4, and 2 minutes, respectively. The membrane was then blocked at room temperature for 1 hour. Primary antibody incubation: The membrane was incubated at room temperature for 1 hour. Antibody preparation (diluted at 1:2000): 7.5 μL of antibody was pipetted, and 15 mL of primary antibody (anti-VZV gE protein antibody, mouse mAb) dilution buffer was added.
[0296] Membrane washing: The membrane was washed 3 times for 5 minutes each using 1× TBST buffer. Secondary antibody incubation: The membrane was incubated at room temperature for 1 hour. Antibody preparation (diluted at 1:1000): 30 μL of antibody was pipetted, and 30 mL of secondary antibody (goat anti-mouse IgG) dilution buffer was added. Membrane washing: The membrane was washed 3 times for 5 minutes each using 1× TBST buffer diluted with distilled water. Color development: 1 mL each of developing solution and fixing solution were mixed at a ratio of 1:1. The mixture was added dropwise to the membrane for color development and photographed.
[0297] Internal reference protein GAPDH: The relative intensity was consistent, indicating an equal loading amount across all samples, on the basis of which the expression levels were compared between different samples. Negative control (NC): Only the inner reference had corresponding bands, and there was no corresponding band in the target protein region, which met the requirements of negative control. Positive control (PC) (purified gE protein): There were corresponding bands within the target size range, and the inner reference had corresponding bands, which met the requirements of positive control. Under the conditions where the positive and negative controls were appropriately set and the bands were clearly defined, the expression of experimental samples and the level of relative expression were determined. The Western Blot results of the mixture of protein samples obtained by lysis of cells transfected with a series of mRNA vaccines prepared in Example 2 are shown in FIG. 2.
[0298] Example 4: Immunization of Balb / c mice Experimental materials Animals: Balb / c mice, female, 6 to 8 weeks old. Test substances: 1) mRNA vaccine corresponding to the antigen expressed in Example 3; 2) LNP sample (LNP sample without mRNA prepared in Example 2); 3) recombinant subunit vaccine (Shingrix®) from GSK.BSL-0035-CA 67 Grouping: Mice were randomly grouped according to body weight, with 5 mice per group.
[0299] Animal immunization: On day 0 and day 28, mice were immunized with vehicle or test substance (liquid mRNA vaccine prepared in Example 2) via intramuscular injection into the gastrocnemius muscle. The volumes and doses are shown in the table below.
[0300] Table 5: Immunization protocol in mice Group Number of animals Immunization Blood collection time Euthanasia time Vaccine to be tested Inoculation dose (µg / mouse) Inoculation volume (μL / mouse) Route Frequency 1 5 Vehicle 0 100 Intramuscular injection (gastrocnemius) Days 0 and 28 Blood collection from the orbital vein on days 42 and 56 Removal of spleen on day 56 2 5 YK-VZV-001 10 100 3 5 YK-VZV-003 10 100 4 5 YK-VZV-004 10 100 5 5 YK-VZV-006 10 100 6 5 YK-VZV-007 10 100 7 5 YK-VZV-009 10 100 8 5 YK-VZV-010 10 100 9 5 YK-VZV-011 10 100 10 5 YK-VZV-012 10 100 11 5 YK-VZV-013 10 100 12 5 YK-VZV-014 10 100 13 5 YK-VZV-015 10 100 14 5 YK-VZV-016 10 100 15 5 YK-VZV-017 10 100 16 5 YK-VZV-018 10 100 17 5 YK-VZV-019 10 100 18 5 YK-VZV-020 10 100BSL-0035-CA 68 19 5 YK-VZV-021 10 100 20 5 YK-VZV-022 10 100 21 5 YK-VZV-023 10 100 22 5 YK-VZV-024 10 100
[0301] Table 5 (continued) Group Number of animals Immunization Blood collection time Euthanasia time Vaccine to be tested Inoculation dose (µg / mouse) Inoculation volume (μL / mouse) Route Frequency 5 YK-VZV-025 10 100 Intramuscular injection (gastrocnemius) Days 0 and 28 23 Blood collection from the orbital vein on days 42 and 56 Removal of spleen on day 56 24 5 YK-VZV-026 10 100 25 5 YK-VZV-027 10 100 26 5 YK-VZV-028 10 100 27 5 YK-VZV-029 10 100 28 5 YK-VZV-030 10 100 29 5 YK-VZV-031 10 100 30 5 YK-VZV-032 10 100 31 5 YK-VZV-033 10 100 32 5 YK-VZV-034 10 100 33 5 YK-VZV-035 10 100 34 5 YK-VZV-036 10 100 35 5 YK-VZV-037 10 100 36 5 YK-VZV-038 10 100 37 5 YK-VZV-039 10 100 38 5 YK-VZV-040 10 100 39 5 YK-VZV-044 10 100 40 5 YK-VZV-045 10 100 41 5 LNP 10 100BSL-0035-CA 69 42 5 Shingrix® 10 100
[0302] Sample collection and pretreatment Approximately 0.2 mL of blood was collected from the orbital venous plexus of each animal. Serum was separated (by centrifugation at 4000 rpm for 10 minutes at 4°C) and stored in a refrigerator at 4°C for further processing.
[0303] Health monitoring Twice daily (once in the morning and once in the afternoon), including, but not limited to, observations of death, illness, breathing, secretions, feces, as well as food and water intake.
[0304] Humane endpoint According to the IACUC protocol, any mouse experiencing more than a 20% body weight loss during the experiment (the body weight on day 0 is used as the baseline body weight before infection, and the body weight on the day of inoculation is used as the baseline body weight after infection) or / and showing signs of imminent death will be euthanized and recorded as a dead animal in the results.
[0305] Example 5: Detection of gE protein-specific IgG antibody titer in serum of Balb / c mice by enzyme-linked immunosorbent assay (ELISA) Main experimental materials and sources The varicella-zoster virus (VZV) IgG (human) titer ELISA assay kit (gE protein) was purchased from Beijing ACROBiosystems Co., Ltd., which includes 1× washing buffer, positive control working solution, negative control working solution, dilution buffer, HRP-goat anti-mouse IgG, substrate solution, stop solution, and ELISA plate.
[0306] Experimental steps Preparation of working solution: Preparation of 1× washing buffer: 50 mL of 10× washing buffer was diluted with ultrapure water or deionized water, and the volume was fixed to 500 mL. Positive control working solution and negative control working solution were prepared.
[0307] Pretreatment of samples to be tested: A series of blood samples collected on day 42 and day 56 in Example 4.
[0308] Antibody titer assay: The samples to be tested, positive control (PC), and negativeBSL-0035-CA 70 control (NC) were diluted with dilution buffer from 1:100 to 1:102400.
[0309] Numbering: The diluted samples were numbered corresponding to the wells of the ELISA plate. PC working solution and NC working solution were set for each experiment.
[0310] Sample addition: 100 μL of diluted sample, positive control working solution, and negative control working solution were first added to the corresponding plate well. The plate was shaken to mix thoroughly, and incubated at 37°C for 1.0 hour.
[0311] Plate washing: The liquid in the wells was discarded, and the ELISA plate was patdried. The plate was washed with 1× washing buffer (300 μL / well, soak for 30 seconds) for a total of 3 times and pat-dried.
[0312] Addition of HRP enzyme conjugate: HRP-goat anti-mouse IgG was diluted 1000-fold with dilution buffer, then added to the plate at 100 μL per well, and incubated at 37°C for 1.0 hour.
[0313] Plate washing: The washing step (step 6) was repeated 3 times.
[0314] Color development: 100 μL of substrate solution was added to each well and incubated in the dark at 37°C for 20 minutes.
[0315] Termination: 50 μL of stop solution was added to each well, and the plate was shaken to mix thoroughly.
[0316] Reading: The absorbance of each well at OD450 nm and OD630 nm (with 630 nm as the background) was measured using a microplate reader, and read within 3 minutes after termination.
[0317] Interpretation of test results: Antibody-positive determination: OD450 nm - OD630 nm ≥ 0.1.
[0318] Example 6: Detection of percentage of CD4+ T cells and CD8+ T cells secreting IFN- γ and IL-2 in spleen of Balb / c mice by multiparameter flow cytometry (FCM) The role of immune checkpoint inhibitors is to prevent T cell exhaustion. The function of immune cells is assessed by detecting cytokine production in tumor samples. T cells and NK cells produce interferon gamma (IFN-γ) to exert an immune response under inflammatory conditions or host immune defense. CD8+ or CD4+ T cells producing IFN-γ in the spleens of mice were quantified using multiparameter flow cytometry (FCM).
[0319] Interferon gamma (IFN-γ) is a soluble dimeric cytokine and the only member of typeBSL-0035-CA 71 II interferons. It is mainly secreted by natural killer (NK) cells and natural killer T (NKT) cells, and plays a role in innate immunity; in the process of antigen-specific immunity, it is secreted by CD4 Th1 and CD8 cytotoxic T cells. IFN-γ or type II interferon plays an important role in both innate and adaptive immunity against viral, certain bacterial, and protozoan infections. IFN-γ serves as an important activator of macrophages and an inducer of the expression of major histocompatibility complex class II (MHC II). Interleukin-2 (IL- 2) is a cytokine of the chemokine family. It is a cytokine of multicellular origin (mainly produced by activated T cells) with pleiotropic effects (mainly promoting the growth, proliferation, and differentiation of lymphocytes). It plays an important role in the body's immune response and antiviral infection. It can stimulate the proliferation of T cells that have been activated by specific antigens or mitogenic factors; activate T cells and promote cytokine production; stimulate NK cell proliferation, enhance NK killing activity and cytokine production, and induce lymphokine-activated killer (LAK) cell production; promote B cell proliferation and antibody secretion; and activate macrophages.
[0320] Detection method: FCM (multiparameter flow cytometry).
[0321] Sample for detection: Spleen removed on day 56 from the immunized mouse model in Example 5.
[0322] Purpose of detection: To determine the percentage of CD4+ T cells and CD8+ T cells secreting IFN-γ and IL-2 in the spleens of mice. Detection indicators: CD4+ (IFN-γ+): total number of CD4+ T cells producing IFN-γ; CD4+ (IL-2+): total number of CD4+ T cells producing IL-2; CD4+ (IFN-γ+ IL-2+): total number of CD4+ T cells producing both IFN-γ and IL-2; CD4+ (IFN-γ+ or IL-2+): total number of CD4+ T cells producing either IFN-γ or IL-2; CD8+ (IFN-γ+): total number of CD8+ T cells producing IFN-γ; CD8+ (IL-2+): total number of CD8+ T cells producing IL-2; CD8+ (IFN-γ+ IL-2+): total number of CD8+ T cells producing both IFN-γ and IL-2; CD8+ (IFN-γ+ or IL-2+): total number of CD8+ T cells producing either IFN-γ or IL-2.
[0323] Experimental materials Main reagent sourcesBSL-0035-CA 72 Table 6: Reagents for sample detection Name Manufacturer Fetal bovine serum (FBS) ExCell Bio RPMI 1640 medium GIBCO Penicillin-streptomycin mixture GIBCO Phosphate buffer saline (PBS) Biotopped 10× RBC Lysis Buffer (Multi-species) Thermo Fisher Zombie Violet™ Fixable Viability Kit Biolegend Protein Transport Inhibitor (brefeldin A solution) Biolegend Fixation and Permeabilization Solution BD Perm / Wash Buffer BD Ionomycin / PMA Sigma PerCP / Cyanine5.5 anti-mouse CD3 Biolegend FITC anti-mouse CD4 Biolegend Alexa Fluor® 700 anti-mouse CD8a Biolegend APC anti-mouse IFN-γ Biolegend PE anti-mouse IL-2 Biolegend Cell Staining Buffer Biolegend
[0324] Preparation of test solution Each reagent was prepared according to the amount required for the experiment and all reagents were prepared in volume ratio.
[0325] FBS inactivation: FBS stored at -20°C was thawed at 4°C, then inactivated in a water bath at 56°C for 30 minutes, filtered through a 0.22 μm filter, and stored at 2 to 8°C with an effective period of 14 days.
[0326] Preparation of 1× RBC Lysis Buffer: 10× RBC Lysis Buffer (Multi-species) was diluted into 1× RBC Lysis Buffer with sterile water, and mixed well for later use.
[0327] Preparation of complete medium containing 1% dual antibiotics: Complete medium was prepared at a ratio of RPMI-1640: inactivated FBS = 9:1.
[0328] Complete medium containing 1% dual antibiotics was prepared at a ratio of complete medium: penicillin-streptomycin mixture = 99:1, mixed well, and stored at 2 to 8°C with an effective period of 14 days. The complete medium was equilibrated to room temperatureBSL-0035-CA 73 before use.
[0329] PMA / ionomycin positive stimulant working solution: 400 μL of PMA working solution and 80 μL of ionomycin (ION) were added to 19.520 mL of complete medium containing 1% dual antibiotics to prepare a positive stimulant working solution, which was ready for use. The final concentration of PMA was 1 μg / mL and the final concentration of ionomycin (ION) was 2 μg / mL.
[0330] Negative control: complete medium containing 1% dual antibiotics.
[0331] Preparation of peptide working solution: Protein Transport Inhibitor working solution was diluted 50-fold with complete medium containing 1% dual antibiotics.
[0332] Live / Dead working solution: Zombie Violet™ Fixable Viability solution was diluted 1000-fold with 1× PBS.
[0333] Surface staining antibody: Taking the amount for one well as an example, surface staining antibody was prepared according to the proportions in the table below, mixed well by pipetting, and stored in the dark at 2ºC to 8ºC for later use.
[0334] Table 7: Preparation of surface staining antibody Antibody name Antibody volume / well Cell Staining Buffer PerCP / Cyanine5.5 anti-mouse CD3 2 μL / test FITC anti-mouse CD4 2 μL / test 45.2 μL Alexa Fluor® 700 anti-mouse CD8a 0.8 μL / test
[0335] 1× Perm / Wash Buffer: 10× Perm / Wash Buffer was diluted 10-fold with ultrapure water.
[0336] Intracellular staining antibody: Taking the amount for one well as an example, intracellular staining antibody was prepared according to the proportions in the table below, mixed well by pipetting, and stored in the dark at 2ºC to 8ºC for later use.
[0337] Table 8: Preparation of intracellular staining antibody Antibody name Antibody volume / well 1× Perm / Wash Buffer APC anti-mouse IFN-γ 2 μL / test 44 μL PE anti-mouse IL-2 2 μL / test
[0338] Preparation of cryopreservation solution: prepared at a ratio of FBS: DMSO = 9:1, ready for use.BSL-0035-CA 74
[0339] Procedure Isolation of mouse spleen cells A cell strainer was placed in a 6-well plate containing 4 mL of complete medium containing 1% dual antibiotics. The spleen was then separately placed on the cell strainer, and gently mashed or ground with the plunger end of a syringe. The resulting cell suspension was filtered through the cell strainer and transferred to a 15 mL centrifuge tube. The 6-well plate was rinsed with 1 to 2 mL of complete medium containing 1% dual antibiotics, and the resulting liquid was filtered and transferred to the 15 mL centrifuge tube, which was centrifuged at 500 g for 5 minutes at 20ºC. The supernatant was discarded.
[0340] The cells were resuspended in 2 mL of 1× RBC Lysis Buffer, lysed for 5 ± 1 minutes, and centrifuged at 500 g for 5 minutes at 20ºC. The supernatant was discarded. The cells were washed with 5 mL of complete medium containing 1% dual antibiotics, and centrifuged at 500 g for 5 minutes at 20ºC. The supernatant was discarded.
[0341] The cells were resuspended in 10 mL of complete medium containing 1% dual antibiotics, mixed well, and 100 μL of cell suspension was immediately added to an EP tube. 10 μL of cell suspension and 10 μL of fluorescent staining solution were then added to the EP tube, mixed well, and 10 μL of mixture was taken for counting with a fluorescence counter. The total number of viable cells and cell viability were counted.
[0342] The cells in the 15 mL centrifuge tube were centrifuged at 400 g for 5 minutes at 20°C, and the supernatant was discarded. The cells were resuspended in fresh complete medium containing 1% dual antibiotics, and the concentration of viable cells in each sample was adjusted to 1 × 107 cells / mL.
[0343] After the samples were plated, the remaining cells were centrifuged at 400 g for 5 minutes at 20°C, and the cell concentration was adjusted to (1 to 2) × 107 cells / mL with cryopreservation solution. The mixture was aliquoted into pre-labeled cryovials at 1 mL per vial. The cryovials were placed in a programmed cooling box, cryopreserved in a refrigerator below -70°C for 12 to 24 hours, and transferred to a liquid nitrogen tank for long-term storage.
[0344] Stimulation of mouse spleen cells The stimulation of mouse spleen cells was performed in a 96-well U-shaped plate labeled with the experiment date.BSL-0035-CA 75
[0345] Positive wells, negative wells, and peptide wells were set up based on the experimental requirements. 100 μL / well of negative control was added to the negative wells, 100 μL / well of positive stimulant working solution was added to the positive wells, and 100 μL / well of peptide working solution was added to the peptide wells. 100 μL / well of cell suspension was then added to the positive wells, negative wells, and peptide wells.
[0346] The 96-well plate was stimulated in a 5% CO2 incubator at 37°C for 2 hours ± 5 minutes, then added with 10 μL / well of Protein Transport Inhibitor working solution, mixed well, and continuously stimulated in the 5% CO2 incubator at 37°C for an additional 18 hours ± 10 minutes. The round-bottom 96-well plate was then removed for flow cytometric staining.
[0347] Note: All experimental procedures in this section must be conducted in a biosafety cabinet, using sterile reagents.
[0348] Cell staining Washing stimulated samples: The round-bottom 96-well plate was removed and centrifuged at 500 g for 5 minutes at 4°C, and the supernatant was discarded. 200 μL of PBS was added to each well, resuspended and mixed well, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded.
[0349] Live / Dead staining: 50 μL of prepared Live / Dead working solution was added to each well, resuspended and mixed well, and stained in the dark at 2°C to 8°C for 30 minutes. After staining, 150 μL of PBS was added to each well, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded.
[0350] Surface staining: 50 μL of surface staining antibody was added to each well, resuspended and mixed well, and stained in the dark at 2°C to 8°C for 30 minutes. 150 μL of Cell Staining Buffer was added to each well to terminate the staining, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded.
[0351] Cell fixation and permeabilization: 100 μL of Fixation and Permeabilization Solution was added to each well, resuspended and mixed well, and incubated in the dark at 4°C for 20 minutes. 100 μL of 1× Perm / Wash Buffer was added to each well for termination, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded.
[0352] Intracellular staining: 50 μL of intracellular staining antibody was added to each well, resuspended and mixed well, and incubated in the dark at 4°C for 50 minutes. 150 μL of 1×BSL-0035-CA 76 Perm / Wash Buffer was added to each well to terminate the staining, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded. 200 μL of 1× Perm / Wash Buffer was added to each well, resuspended and mixed well, and the plate was centrifuged at 500 g for 5 minutes at 4°C. The supernatant was discarded.
[0353] Filtration: 200 μL of Cell Staining Buffer was added to each well, resuspended and mixed well, and the cell suspension was filtered through a 300-mesh nylon screen and transferred to a new well plate. Example of sample numbering: "01-P-1", where "01" represents the sample number, "P" represents the positive well, and the final "1" represents the well number.
[0354] Instrument detection Instrument name: Flow cytometer (Cytoflex); Instrument acquisition parameters: Setting the acquisition flow rate to high speed and recording a total of 100,000 cells collected from the lymphocyte gate. Data processing Data analysis: CD3+ cells were identified, and then CD4+ and CD8+ cells were separately identified. CD4+ (IFN-γ+) and CD4+ (IL-2+) subpopulations were identified from the CD4+ cells; CD8+ (IFN-γ+) and CD8+ (IL-2+) subpopulations were identified from the CD8+ cells.
[0355] Data calculation formula: All values from this assay were calculated as percentages; effective value = mean of peptide wells - mean of negative wells. All values were retained to one decimal place.
[0356] Example 7: Detection of IFN-γ and IL-2 cytokine secretion from spleen cells of Balb / c mice by enzyme-linked immunospot assay (ELISPOT) Enzyme-linked immunospot assay (ELISPOT) is a highly sensitive detection method in cellular immunology research, which can detect antibody-secreting cells (ASCs) and cytokine (CK)-secreting cells at the single-cell level. It offers greater sensitivity than ELISA and limited dilution methods and can detect one protein-secreting cell from 200,000 to 300,000 cells. Moreover, the method allows for functional assessment of viable cells stimulated by antigens, demonstrating high specificity, high intuitive reliability, and operability, making it widely used in the detection of CK-secreting cells or ASC assay in the immunology field bothBSL-0035-CA 77 domestic and abroad. Upon antigen stimulation, lymphocytes locally produce cytokines, which are captured by specific monoclonal antibodies (pre-coated) on the PVDF membrane at the bottom of the ELISPOT plate. After removing the cells, the captured cytokines bind to biotin-labeled monoclonal antibodies and subsequently to alkaline phosphatase- or horseradish peroxidase-labeled avidin. After adding substrate for color development, purple or reddishbrown spots appear on the PVDF membrane, indicating cytokine production by cells. The spots are automatically counted and analyzed by an ELISPOT reader.
[0357] The spleen removed from the mouse model in Example 6 was used to detect the levels of IFN-γ and IL-2 secreted by spleen cells after peptide library stimulation on day 56 postimmunization.
[0358] Sample processing: Follow the procedure for isolation and cryopreservation of mouse spleen cells.
[0359] ELISPOT method: Detect the levels of IFN-γ and IL-2 in the supernatant of spleen cells after peptide library stimulation.
[0360] Main reagents Table 9: Reagents for sample detection Name Source Mouse spleen cells Medleader FBS ExCell Bio RPMI-1640 medium GIBCO DMSO Sigma Phosphate buffer saline (1× PBS) Biotopped Phosphate buffer saline (20× PBS) Solarbio Phorbol 12-myristate 13-acetate (PMA) Sigma Ionomycin (ION) Sigma Penicillin-streptomycin mixture Gibco ELISpot Plus: Mouse IFN-γ (HRP) MabTech ELISpot Plus: Mouse IL-2 (HRP) MabTech Preparation of test solutionBSL-0035-CA 78 1) FBS inactivation: FBS stored at -20°C was thawed at 4°C, then inactivated in a water bath at 56°C for 30 minutes, filtered through a 0.22 μm filter, and stored at 2 to 8°C with an effective period of 30 days.
[0361] 2) Preparation of PMA working solution: 1 mL of DMSO was added to a PMA reagent bottle to dissolve the PMA powder, and the mixture was transferred to a 15 mL centrifuge tube. The PMA reagent bottle was rinsed with 1 mL of DMSO, and the rinse solution was transferred to the 15 mL centrifuge tube. 8 mL of DMSO was then added to the 15 mL centrifuge tube and mixed well to prepare a PMA working solution with a concentration of 100 μg / mL, which was stored in the dark in a refrigerator at -20ºC.
[0362] 3) Preparation of ION working solution: 2 mL of DMSO was added to an ION reagent bottle to dissolve the ION powder, and the mixture was transferred to a 15 mL centrifuge tube. The ION reagent bottle was rinsed with 1 mL of DMSO, then the rinsing step was repeated twice more (a total of 3 times, each with 1 mL), and the rinse solution was transferred to the 15 mL centrifuge tube. 5 mL of DMSO was then added to the 15 mL centrifuge tube and mixed well to prepare an ION working solution with a concentration of 1 mg / mL, which was stored in a refrigerator at -20ºC.
[0363] 4) Preparation of complete medium containing 1% dual antibiotics: Complete medium was prepared at a ratio of RPMI-1640: inactivated FBS = 9:1. Complete medium containing 1% dual antibiotics was prepared at a ratio of complete medium: penicillin-streptomycin mixture = 99:1, mixed well, and stored at 2 to 8°C with an effective period of 14 days. The complete medium was equilibrated to room temperature before use.
[0364] 5) Preparation of positive stimulant working solution: 400 μL of PMA working solution and 80 μL of ionomycin (ION) were added to 19.520 mL of complete medium to prepare a positive stimulant working solution, which was ready for use. The final concentration of PMA was 2 μg / mL and the final concentration of ION was 4 μg / mL.
[0365] 6) Preparation of peptide working solution: (i) Preparation of gE peptide library solution 100 μL of DMSO was added to each tube of lyophilized powder. After dissolution, the peptide concentration in each tube was 1 mg / mL per peptide. 900 μL of PBS was added to the dissolved peptide solution to adjust the gE peptide library concentration to 100 μg / mLBSL-0035-CA 79 per peptide.
[0366] (ii) Preparation of gE working solution gE working solution was prepared at a ratio of gE peptide library solution: complete medium containing 1% dual antibiotics = 1:50, resulting in a concentration of 2 μg / mL per peptide.
[0367] Negative control: complete medium containing 1% dual antibiotics.
[0368] 7) Preparation of 1× PBS solution: prepared at a ratio of 20× PBS: pure water = 1:19, stored at room temperature, ready for use.
[0369] 8) Preparation of PBS containing FBS: prepared at a ratio of PBS (Biotopped): inactivated FBS = 200:1, ready for use.
[0370] 9) Antibody preparation: (i) Preparation of R4-6A2-biotin: prepared at a ratio of R4-6A2-biotin: PBS containing FBS = 1:1000, ready for use.
[0371] (ii) Preparation of 5H4-biotin: prepared at a ratio of 5H4-biotin: PBS containing FBS = 1:1000, ready for use.
[0372] Experimental steps 1) The spleen removed from the mouse model in Example 6 was used to detect the levels of IFN-γ and IL-2 secreted by spleen cells after peptide library stimulation on day 56 post-immunization, as well as CD4+ and CD8+ T cells producing IFN-γ and IL-2.
[0373] 2) Sample for detection: Spleen removed on day 56, cryopreserved at -80ºC.
[0374] Resuscitation of mouse spleen cells Preparation: Before cell resuscitation, the temperature of the thermostatic water bath was adjusted to 37ºC, and complete medium containing 1% dual antibiotics was preheated at 37ºC.
[0375] Sampling: Mouse spleen cells cryopreserved in the liquid nitrogen tank were removed by a sample administrator and transferred to a box containing liquid nitrogen. The cryovials were removed from the box, sprayed with 75% ethanol, and then placed in a transfer window of the cell culture room.
[0376] Resuscitation: The cryovials were immediately removed from the transfer window byBSL-0035-CA 80 a validator and rapid thawed in the thermostatic water bath at 37ºC. Once fully thawed, the cells were aseptically transferred to a 15 mL centrifuge tube containing 9 mL of complete medium containing 1% dual antibiotics.
[0377] Rinsing: 1 mL of complete medium containing 1% dual antibiotics was added to a cryovial, then the cryovial was rinsed, and the rinse solution was transferred back to the 15 mL centrifuge tube.
[0378] Centrifugation: The cells were centrifuged at 400 g for 10 minutes at 18 to 20ºC.
[0379] Counting: The supernatant was discarded. The cells were resuspended in 10 mL of complete medium containing 1% dual antibiotics, mixed well, and 100 μL of cell suspension was added to an EP tube. 10 μL from 100 μL of cell suspension was then added to an EP tube containing 10 μL of fluorescent staining solution, mixed well, and 10 μL of mixture was taken for counting with a fluorescence counter. The total number of viable cells and cell viability were counted (if viability is below 50%, repeat counting with the fluorescence counter once and the results of the second counting shall prevail).
[0380] Re-centrifugation: The remaining cells in the 15 mL centrifuge tube were centrifuged at 400 g for 5 minutes at 18 to 20ºC.
[0381] Resuspension: The supernatant was discarded. The cells were resuspended in complete medium containing 1% dual antibiotics, and the concentration of viable cells was adjusted to A0: 4 × 106 cells / mL and A1: 4 × 105 cells / mL.
[0382] Stimulation of mouse spleen cells Plate washing: IFN-γ and IL-2 plates were washed with 200 μL / well of PBS (PBS used throughout the experiment was sterile) for a total of 4 times.
[0383] Blocking: PBS in the wells was discarded, and the plate was tapped (to the greatest extent remove the residual liquid in the wells). 200 μL / well of complete medium containing 1% dual antibiotics was added, and the plate was left at room temperature for at least 30 minutes (record the exact time).
[0384] Plating: Complete medium containing 1% dual antibiotics in the well plate was discarded, and the plate was tapped (to the greatest extent remove the residual liquid in the wells); 100 μL / well of positive stimulant working solution was added to the positive wells; 100 μL / well of negative control was added to the negative wells; 100 μL / well of peptide workingBSL-0035-CA 81 solution was added to the peptide wells; 200 μL / well of negative control was added to the blank wells without cells.
[0385] Addition of cells: 100 μL / well of A0 cell suspension was added to the negative wells and peptide wells, and 100 μL / well of A1 cell suspension was added to the positive wells.
[0386] Incubation: The plate was covered with aluminum foil and stimulated in a 5% CO2 incubator at 37°C for 21 hours ± 30 minutes.
[0387] Note: All experimental procedures in this section must be conducted in a biosafety cabinet, using sterile reagents.
[0388] Cytokine detection Plate washing: The next day, the original liquid in the well plate was discarded. The plate was tapped (to the greatest extent remove the residual liquid in the wells) and washed with 200 μL / well of PBS for a total of 5 times.
[0389] Addition of secondary antibody: PBS in the wells was discarded, and the plate was tapped (to the greatest extent remove the residual liquid in the wells). IFN-γ: R4-6A2-biotin working solution was added at 100 μL / well. IL-2: 5H4-biotin working solution was added at 100 μL / well. The plate was incubated at room temperature for 2 hours ± 5 minutes.
[0390] Plate washing: The original liquid in the well plate was discarded. The plate was tapped (to the greatest extent remove the residual liquid in the wells) and washed with 200 μL / well of PBS for a total of 5 times.
[0391] Addition of tertiary antibody: Streptavidin-HRP working solution was added at 100 μL / well. The plate was incubated at room temperature for 1 hour ± 2 minutes, and the liquid in the well plate was discarded. The plate was tapped (to the greatest extent remove the residual liquid in the wells) and washed with 200 μL / well of PBS for a total of 5 times.
[0392] Plate washing: The original liquid in the well plate was discarded. The plate was tapped (to the greatest extent remove the residual liquid in the wells) and washed with 200 μL / well of PBS for a total of 5 times.
[0393] Color development: TMB substrate solution, which had been brought to room temperature, was added at 100 μL / well. After color development at room temperature for 15 ± 1 minutes, the liquid in the well plate was discarded, and the plate was washed with pure water to terminate the color development. The bottom plate was removed from the well plate,BSL-0035-CA 82 and the bottom surface of the well plate was rinsed.
[0394] Reading: After the well plate was completely dried at room temperature in the dark, an ELISPOT analyzer was used for photographing and reading. Camera parameters: Shutter (Exposure): 400; Gain: 25. Counting parameters: IFN-γ-Mouse-Mab / IL-2-Mouse-MabT: Size: 30; Intensity (threshold for optical density): 30; TNTC: 80%.
[0395] Example 8: Distribution of VZV gE antigen in Chlorocebus sabaeus kidney cells (Vero) Vero cells are a lineage of cells used in cell cultures. The "Vero" lineage was isolated from kidney epithelial cells extracted from Chlorocebus sabaeus. Vero cells were transfected with different gE antigen variants constructed herein (YK-VZV-010, YK-VZV-011, YK-VZV- 013, YK-VZV-018, and YK-VZV-020). The transfected cells were stained with antibodies for gE antigen labeling and Golgi-labeled GM130 / TGN46 antibodies, and antigen localization was observed using confocal microscopy. The results are shown in FIGs 3 and 4.
[0396] Preparation of reagents and consumables Table 10: Reagents and consumables for sample detection Name Source μ-Slide 8 Well incubation box with light protection ibidi Anti-VZV gE protein antibody Abcam 488 donkey anti-mouse secondary antibody Yeasen Biotechnology (Shanghai) Co., Ltd. Anti-fluorescence quenching sealing agent (containing DAPI) Beyotime Biotechnology Co., Ltd. Phosphate buffer saline (1× PBS) Beyotime Biotechnology Co., Ltd. Phosphate buffer saline (20× PBS) Beyotime Biotechnology Co., Ltd. Immunostaining permeabilization buffer (Triton X-100) Beyotime Biotechnology Co., Ltd. 4% paraformaldehyde fix solution Beyotime Biotechnology Co., Ltd. QuickBlock™ primary antibody dilution buffer for immunostaining Beyotime Biotechnology Co., Ltd. QuickBlock™ blocking buffer for immunostaining Beyotime Biotechnology Co., Ltd. QuickBlock™ secondary antibody dilution buffer for immunofluorescence Beyotime Biotechnology Co., Ltd. 647-conjugated GOLGA2 / GM130 antibody Proteintech CoraLite® 594-conjugated TGN46 antibody Proteintech Experimental stepsBSL-0035-CA 83 1) Cell inoculation: Vero cells (purchased from Beyotime Biotechnology Co., Ltd.) were inoculated in a confocal petri dish, and the number of inoculated cells was recorded when the cell inoculation density was observed to be around 30% under a microscope. The cells were incubated overnight.
[0397] 2) Transfection: The cells were transfected with overexpression stock solution (50 ng / well) and incubated for 48 hours.
[0398] 3) Washing: The confocal petri dish was removed and the medium inside was discarded. The petri dish was washed with PBS 1 to 3 times, avoiding vigorous shaking.
[0399] 4) Fixation: The cells were fixed with 200 μL of 4% paraformaldehyde solution, left at room temperature for 15 minutes, and washed with 1× PBS three times, leaving at room temperature for 5 minutes each time.
[0400] 5) Permeabilization: The cells were permeabilized with 200 μL of 0.3% Triton X-100 (diluted with 1× PBS) for 10 minutes, and washed with 1× PBS three times, leaving at room temperature for 5 minutes each time.
[0401] 6) Blocking: The cells were blocked with 200 μL of immunostaining blocking buffer and incubated at room temperature for 2 hours.
[0402] 7) Primary antibody binding: 100 μL of primary antibody diluted with antibody dilution buffer was added, with the specific antibodies and dilution ratios as follows. VZV gE antibody was diluted 1:100, 647-conjugated GOLGA2 / GM130 antibody was diluted 1:100, and CoraLite® 594-conjugated TGN46 antibody was diluted 1:100. The mixture was incubated in the dark at 4°C overnight, and primary antibody was aspirated (can be reused).
[0403] 8) Primary antibody washing: The mixture was washed with 1× PBS three times for 5 minutes each to remove unbound primary antibody.
[0404] 9) Secondary antibody incubation: 200 μL of fluorescent secondary antibody diluted with antibody dilution buffer at a ratio of 1:300 was added. The mixture was incubated in the dark at room temperature for 1.5 hours.
[0405] 10) Secondary antibody washing: The mixture was washed with 1× PBS three times for 5 minutes each to remove unbound secondary antibody, preventing non-specific staining.
[0406] 11) Nuclear staining and sealing: The frame was removed, and a drop of DAPI staining solution was added to each well. The petri dish was covered with a lid and stored in the darkBSL-0035-CA 84 at 4°C.
[0407] 12) A confocal microscope was used for photographing and observation.
[0408] Control setting The present disclosure set the following controls: LNP: Blank LNP without mRNA vaccine; Shingrix®: Recombinant protein subunit vaccine Shingrix® produced and marketed by GSK, consisting of the extracellular region of VZV gE protein, amino acids 1 to 539, without mutations.
[0409] Comparative Example 1 Based on the herpes zoster mRNA vaccine antigen sequence reported in the literature (Morgan A, et al. 2020) and Moderna patent (US11643441B1), it was found that the antigen developed by the patent is gE (1-573aa) Y569A, based on which YK-VZV-004 (SEQ ID NO: 15) was designed in the present disclosure, which retains the same mutation site and truncation length as the herpes zoster mRNA vaccine antigen sequence gE (1-573aa) Y569A reported in Moderna patent (US11643441B1). YK-VZV-004: gE (1-573aa) Y569A was used as one of the positive controls for antigen screening, together with the sequences of mutations or combinations of mutations newly designed in the present disclosure for immunogenicity evaluation of the vaccine. The specific results are shown in examples.
[0410] Comparative Example 2 Based on the herpes zoster mRNA vaccine antigen sequence reported in the patent (CN114081943A), it was found that the full-length polypeptide of VZV gE developed by the patent comprises a combination of mutations (Y569A, S593A, S595A, T596A, and T598A), based on which YK-VZV-006 (SEQ ID NO: 19) was designed in the present disclosure, which retains the same combination of mutation sites (Y569A, S593A, S595A, T596A, and T598A) as SEQ ID NO: 2 mentioned in the patent (CN114081943A). YK-VZV-006: gE(1-623aa) (Y569A, S593A, S595A, T596A, and T598A) was also used as one of the controls for antigen screening in the present disclosure, together with the sequences of mutations or combinations of mutations newly designed in the present disclosure for immunogenicity evaluation of the vaccine. The specific results are shown in examples.
[0411] Comparative Example 3BSL-0035-CA 85 Based on the herpes zoster mRNA vaccine antigen sequence reported in US20230233671A1, it was found that the patent discloses mutant VZV gE protein Y582A, based on which YK-VZV-045 (SEQ ID NO: 171) was designed in the present disclosure, which retains the same combination of mutation sites (Y582A) as the mRNA vaccine antigen sequence mentioned in US20230233671A1. YK-VZV-045 was also used as one of the controls for antigen screening in the present disclosure, together with the sequences of mutations or combinations of mutations newly designed in the present disclosure for immunogenicity evaluation of the vaccine. The specific results are shown in examples.
[0412] Comparative Example 4 Based on the herpes zoster mRNA vaccine antigen sequence reported in CN108472309A, it was found that the patent discloses mutant VZV gE protein Y582A, based on which YK-VZV-007 (SEQ ID NO: 23) was designed in the present disclosure, which retains the same combination of mutation sites (Y582A, S593A, S595A, T596A, and T598A) as the mRNA vaccine antigen sequence mentioned in CN108472309A. YK-VZV-007 was also used as one of the controls for antigen screening in the present disclosure, together with the sequences of mutations or combinations of mutations newly designed in the present disclosure for immunogenicity evaluation of the vaccine. The specific results are shown in examples.
[0413] Summary and analysis of results In vitro expression results of VZV gE antigen variants The results of Western Blot detection of 43 VZV gE antigen variants (FIG. 2) show that YK-VZV-002 exhibits extremely low or almost no antigenic protein expression; YK-VZV- 041, YK-VZV-042, and YK-VZV-043 show negative results with no antigenic protein expression. Consequently, these four sequences could not be used as candidate antigens for the herpes zoster mRNA vaccine and were therefore excluded.
[0414] All other antigen variants exhibit significant protein expression, with the size of the expressed protein ranging from approximately 63 kDa to 75 kDa, which is consistent with the theoretical design of the antigen. These antigen variants can be used as effective candidate antigens for subsequent immunogenicity screening and evaluation.
[0415] As shown by the results from the above Western blot experiments, all the 39 antigen sequences of YK-VZV-001, YK-VZV-003, YK-VZV-004 (Comparative Example 1), YKBSL-0035-CA 86 VZV-006 (Comparative Example 2), YK-VZV-007 (Comparative Example 4), YK-VZV-009, YK-VZV-010, YK-VZV-011, YK-VZV-012, YK-VZV-013, YK-VZV-014, YK-VZV-015, YK-VZV-016, YK-VZV-017, YK-VZV-018, YK-VZV-019 YK-VZV-020, YK-VZV-021, YKVZV-022, YK-VZV-023, YK-VZV-024, YK-VZV-025, YK-VZV-026, YK-VZV-027, YKVZV-028, YK-VZV-029, YK-VZV-030, YK-VZV-031, YK-VZV-032, YK-VZV-033, YKVZV-034, YK-VZV-035, YK-VZV-036, YK-VZV-037, YK-VZV-038, YK-VZV-039, YKVZV-040, YK-VZV-044, and YK-VZV-045 (Comparative Example 3) exhibit significant protein expression and can be used as effective candidate antigens for subsequent immunogenicity screening and evaluation. Therefore, gE-specific antibody IgG titer assay was conducted on these antigens.
[0416] Results of gE protein-specific IgG antibody titers of VZV gE antigen variants in serum of Balb / c mice (D42) As shown in Example 5, the gE protein-specific IgG antibody titers in the serum of mice were measured on day 42 post-immunization by ELISA. The test results are shown in Table 11. Table 11: VZV gE protein-specific IgG antibody titers in serum of mice (day 42) Test substance Antibody GMT (× 104) Antibody GMT of test substance / antibody GMT of Shingrix® (times) Antibody GMT of test substance / antibody GMT of YK-VZV-007 (times) YK-VZV-009 1000 5.3 2.8 YK-VZV-010 1000 5.3 2.8 YK-VZV-013 1000 5.3 2.8 YK-VZV-014 1000 5.3 2.8 YK-VZV-011 950 5.0 2.6 YK-VZV-012 944 5.0 2.6 YK-VZV-018 870 4.6 2.4 YK-VZV-020 800 4.2 2.2 YK-VZV-030 662 3.5 1.8 YK-VZV-031 659 3.5 1.8 YK-VZV-038 654 3.4 1.8 YK-VZV-021 650 3.4 1.8 YK-VZV-024 640 3.4 1.8 YK-VZV-028 630 3.3 1.8 YK-VZV-003 560 2.9 1.6 YK-VZV-001 540 2.8 1.5BSL-0035-CA 87 YK-VZV-016 530 2.8 1.5 YK-VZV-015 520 2.7 1.4 YK-VZV-017 510 2.7 1.4 YK-VZV-023 190 1.0 0.5 YK-VZV-022 163 0.9 0.5 YK-VZV-026 163 0.9 0.5 YK-VZV-027 163 0.9 0.5 YK-VZV-033 163 0.9 0.5 YK-VZV-037 163 0.9 0.5 YK-VZV-039 163 0.9 0.5 YK-VZV-044 163 0.9 0.5 YK-VZV-040 162 0.9 0.5 YK-VZV-032 160 0.8 0.4 YK-VZV-034 154 0.8 0.4 YK-VZV-025 151 0.8 0.4 YK-VZV-035 150 0.8 0.4 YK-VZV-036 136 0.7 0.4 YK-VZV-029 102 0.5 0.3 LNP 0 0.0 0.0 Shingrix® 190 1.0 0.5 YK-VZV-004 (Comparative Example 1) 400 2.1 1.1 YK-VZV-006 (Comparative Example 2) 360 1.9 1.0 YK-VZV-045 (Comparative Example 3) 352 1.9 1.0 YK-VZV-007 (Comparative Example 4) 360 1.9 1.0 As shown by the gE-specific antibody IgG titer results on day 42, the Shingrix® positive control had a titer result of 190 × 104, while the following variants outperformed Shingrix®, including YK-VZV-009, YK-VZV-011, YK-VZV-013, YK-VZV-014, YK-VZV- 010, YK-VZV-012, YK-VZV-018, YK-VZV-020, YK-VZV-030, YK-VZV-031, YK-VZV-038, YK-VZV-021, YK-VZV-024, YK-VZV-028, YK-VZV-003, YK-VZV-001, YK-VZV-016, YK-VZV-015, YK-VZV-017, YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4), whose titer result was 2.7 to 5.3 times that of the Shingrix® positive control.
[0417] Using the Shingrix® positive control as a standard, and on the basis that the above gEBSL-0035-CA 88 specific antibody IgG titer result was also 1.8 to 2.8 times better than that of the YK-VZV-007 sequence (Comparative Example 4), a total of 14 variants were further extracted, including YK-VZV-009, YK-VZV-011, YK-VZV-013, YK-VZV-014, YK-VZV-010, YK-VZV-012, YK-VZV-018, YK-VZV-020, YK-VZV-030, YK-VZV-031, YK-VZV-038, YK-VZV-021, YK-VZV-024, YK-VZV-028, as well as 4 control sequences including YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4) for subsequent testing.
[0418] Results of cellular immunity of VZV gE antigen variants (FCM) Cellular immunity, particularly T cell immunity, plays a crucial role in the process of VZV infection. Studies have shown that the cell-mediated immune response is an important indicator for the evaluation of the immune effect of the herpes zoster vaccine. To further evaluate the specific cellular immune response induced by immunization of mice with the above antigen variant mRNA, the specific CD4+ and CD8+ T cell immune responses induced by immunization of mice with VZV gE antigen mRNA were detected by FCM in Example 6.
[0419] Using the Shingrix® positive control as a standard, and on the basis that the above gEspecific antibody IgG titer result was also better than that of the YK-VZV-007 sequence, a total of 14 variants were further extracted, including the spleens of immunized mice on day 56 of YK-VZV-009, YK-VZV-011, YK-VZV-013, YK-VZV-014, YK-VZV-010, YK-VZV-012, YK-VZV-018, YK-VZV-020, YK-VZV-030, YK-VZV-031, YK-VZV-038, YK-VZV-021, YK-VZV-024, YK-VZV-028, as well as 4 control sequences including YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4), and the percentage of CD4+ T cells and CD8+ T cells secreting IFN-γ and IL-2 in the spleens of mice was measured according to the detection method in Example 6.
[0420] CD4+ T cells The immune effect of CD4+ T cells plays a crucial role in the recovery of VZV infection and the immune effect of the vaccine. It is one of the most important indicators for the evaluation of the immune effect of the vaccine. The spleens of immunized mice were removed on day 56, and the percentage of CD4+ T cells secreting IFN-γ and IL-2 in the spleens of mice was measured. The specific results are shown in the table below.BSL-0035-CA 89 Table 12: Summary of CD4+ T cell assay results Test substance CD4+ (IFN-γ+) CD4+ (IL-2+) CD4+ (IFN-γ+ or IL-2+) CD4+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 2.00% 6.7 4.4 3.70% 12.3 7.4 4.20% 7.0 5.3 YK-VZV-013 1.70% 5.7 3.8 1.30% 4.3 2.6 1.90% 3.2 2.4 YK-VZV-011 1.60% 5.3 3.6 1.20% 4.0 2.4 1.60% 2.7 2.0 YK-VZV-020 1.60% 5.3 3.6 2.50% 8.3 5.0 3.10% 5.2 3.9 YK-VZV-012 1.40% 4.7 3.1 1.20% 4.0 2.4 1.70% 2.8 2.1 YK-VZV-018 1.20% 4.0 2.7 1.10% 3.7 2.2 1.40% 2.3 1.8 YK-VZV-028 1.20% 4.0 2.7 1.30% 4.3 2.6 1.70% 2.8 2.1 YK-VZV-014 1.10% 3.7 2.4 0.80% 2.7 1.6 1.10% 1.8 1.4 YK-VZV-038 1.10% 3.7 2.4 1.40% 4.7 2.8 1.90% 3.2 2.4 YK-VZV-031 1.00% 3.3 2.2 1.40% 4.7 2.8 1.70% 2.8 2.1 YK-VZV-021 0.90% 3.0 2.0 1.10% 3.7 2.2 1.50% 2.5 1.9 YK-VZV-009 0.80% 2.7 1.8 1.10% 3.7 2.2 1.40% 2.3 1.8 YK-VZV-024 0.70% 2.3 1.6 0.60% 2.0 1.2 0.90% 1.5 1.1 YK-VZV-030 0.60% 2.0 1.3 0.80% 2.7 1.6 1.10% 1.8 1.4 LNP 0.10% 0.3 0.2 0.10% 0.3 0.2 0.20% 0.3 0.3 Shingrix® 0.30% 1.0 0.7 0.30% 1.0 0.6 0.60% 1.0 0.8 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.2 0.55% 1.8 1.1 0.95% 1.6 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 1.7 1.1 0.30% 1.0 0.6 0.50% 0.8 0.6 YK-VZV-007 (Comparative Example 4) 0.45% 1.5 1.0 0.50% 1.7 1.0 0.80% 1.3 1.0 Note: Shingrix® is a recombinant protein vaccine from GSK.
[0421] Total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells A) Based on the above results, the mRNA vaccines prepared from test substances YKVZV-010, YK-VZV-020, YK-VZV-013, YK-VZV-038, YK-VZV-012, YK-VZV-028, YKVZV-031, YK-VZV-011, YK-VZV-021, YK-VZV-018, and YK-VZV-009 (11 in total) were screened out. The total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells secreted by these mRNA vaccines was 2 times or more and up to 7 times that of the Shingrix® positive control vaccine, and 1.8 to 5.3 times that of YK-VZV-007 (Comparative Example 4).BSL-0035-CA 90 Moreover, the results were significantly better than those of YK-VZV-004 (Comparative Example 1) and YK-VZV-045 (Comparative Example 3).
[0422] Specifically, the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells secreted by the mRNA vaccines prepared from YK-VZV-010, YK-VZV-020, YK-VZV-013, YK-VZV-011, and YK-VZV-018 was 7.0, 5.2, 3.2, 2.7, and 2.3 times that of the Shingrix® positive control vaccine, respectively; 5.3, 3.9, 2.4, 2.0, and 1.8 times that of YK-VZV-007 (Comparative Example 4), respectively; and significantly higher than that of YK-VZV-004 (Comparative Example 1) and YK-VZV-045 (Comparative Example 3).
[0423] The details are shown in the table below. Table 13: Total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells induced by mRNA vaccines - 1 Test substance CD4+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 4.20% 7.0 5.3 YK-VZV-020 3.10% 5.2 3.9 YK-VZV-013 1.90% 3.2 2.4 YK-VZV-038 1.90% 3.2 2.4 YK-VZV-012 1.70% 2.8 2.1 YK-VZV-028 1.70% 2.8 2.1 YK-VZV-031 1.70% 2.8 2.1 YK-VZV-011 1.60% 2.7 2.0 YK-VZV-021 1.50% 2.5 1.9 YK-VZV-018 1.40% 2.3 1.8 YK-VZV-009 1.40% 2.3 1.8 LNP 0.20% 0.3 0.3 Shingrix® 0.60% 1.0 0.8 YK-VZV-004 (Comparative Example 1) 0.95% 1.6 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 0.8 0.6 YK-VZV-007 (Comparative Example 4) 0.80% 1.3 1.0
[0424] B) However, the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-014, YK-VZV-030, and YK-VZV-024 was less than 2 times that of the Shingrix® positive control vaccine and less than 1.5 times that of Comparative Example 4 (YK-VZV-007), so that these sequences wereBSL-0035-CA 91 excluded. The specific results are shown in the table below.
[0425] Table 14: Total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells induced by mRNA vaccines - 2 Test substance CD4+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-014 1.10% 1.8 1.4 YK-VZV-030 1.10% 1.8 1.4 YK-VZV-024 0.90% 1.5 1.1 LNP 0.20% 0.3 0.3 Shingrix® 0.60% 1.0 0.8 YK-VZV-004 (Comparative Example 1) 0.95% 1.6 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 0.8 0.6 YK-VZV-007 (Comparative Example 4) 0.80% 1.3 1.0
[0426] Percentage of IFN-γ+ CD4+ T cells A) The mRNA vaccines prepared from test substances YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, YK-VZV-012, YK-VZV-018, YK-VZV-028, YK-VZV-014, YK-VZV-038, and YK-VZV-031 were screened out. The percentage of IFN-γ+ CD4+ T cells secreted by these mRNA vaccines was optimal at 1.00 to 2.00%, which was significantly higher than that of the comparative examples (YK-VZV-004, YK-VZV-045, and YK-VZV-007); which was 3 times or more and up to 6.7 times that of the Shingrix® positive control vaccine; and which was approximately 2.2 to 4.4 times that of Comparative Example 4 (YK-VZV-007).
[0427] Specifically, the percentage of IFN-γ+ CD4+ T cells secreted by the mRNA vaccines corresponding to YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, and YK-VZV- 018 was 6.7, 5.7, 5.3, 5.3, and 4.0 times that of the Shingrix® positive control vaccine, respectively; 4.4, 3.8, 3.6, 3.6, and 2.7 times that of Comparative Example 4 (YK-VZV-007), respectively; and significantly higher than that of Comparative Example 1 (YK-VZV-004) and Comparative Example 3 (YK-VZV-045).
[0428] The specific results are shown in the table below.BSL-0035-CA 92 Table 15: IFN-γ+ CD4+ T cells induced by mRNA vaccines - 1 Test substance CD4+ IFN-γ+ Compared to Shingrix® (times) Compared to YK-VZV-007 (times) YK-VZV-010 2.00% 6.7 4.4 YK-VZV-013 1.70% 5.7 3.8 YK-VZV-011 1.60% 5.3 3.6 YK-VZV-020 1.60% 5.3 3.6 YK-VZV-012 1.40% 4.7 3.1 YK-VZV-018 1.20% 4.0 2.7 YK-VZV-028 1.20% 4.0 2.7 YK-VZV-014 1.10% 3.7 2.4 YK-VZV-038 1.10% 3.7 2.4 YK-VZV-031 1.00% 3.3 2.2 LNP 0.10% 0.3 0.2 Shingrix® 0.30% 1.0 0.7 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 1.7 1.1 YK-VZV-007 (Comparative Example 4) 0.45% 1.5 1.0
[0429] B) Since the percentage of IFN-γ+ CD4+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-021, YK-VZV-009, YK-VZV-024, and YK-VZV-030 was less than 1.0%, which was significantly lower than the optimal and relatively optimal percentage of cells secreted by the mRNA vaccines (1.0 to 2.0%), only 2 to 3 times that of the Shingrix® positive control vaccine, and approximately 1 to 2 times that of Comparative Example 4 (YK-VZV-007), YK-VZV-021, YK-VZV-009, YK-VZV-024, and YK-VZV-030 were excluded from the candidate sequences. The specific results are shown in the table below. Table 16: IFN-γ+ CD4+ T cells induced by mRNA vaccines - 2 Test substance CD4+ IFN-γ+ Compared to Shingrix® (times) Compared to YK-VZV-007 (times) YK-VZV-021 0.90% 3.0 2.0 YK-VZV-009 0.80% 2.7 1.8 YK-VZV-024 0.70% 2.3 1.6 YK-VZV-030 0.60% 2.0 1.3 LNP 0.10% 0.3 0.2 Shingrix® 0.30% 1.0 0.7BSL-0035-CA 93 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 1.7 1.1 YK-VZV-007 (Comparative Example 4) 0.45% 1.5 1.0
[0430] IL-2+ CD4+ T cells A) The mRNA vaccines corresponding to test substances YK-VZV-010, YK-VZV- 020, YK-VZV-038, YK-VZV-031, YK-VZV-013, YK-VZV-028, YK-VZV-011, YK-VZV-012, YK-VZV-018, YK-VZV-021, and YK-VZV-009 were screened out. The percentage of IL-2+ CD4+ T cells secreted by these mRNA vaccines was optimal at 1.10 to 3.70%, which was significantly higher than that of comparative example mRNA vaccines (YK-VZV-004, YKVZV-045, and YK-VZV-007); which was 3.7 times or more that of the Shingrix® positive control vaccine and 2.2 times or more that of YK-VZV-007; and which was significantly higher than that of Comparative Example 1 (YK-VZV-004) and Comparative Example 3 (YK-VZV- 045).
[0431] Specifically, the percentage of IL-2+ CD4+ T cells secreted by the mRNA vaccines prepared from YK-VZV-010, YK-VZV-020, YK-VZV-013, YK-VZV-011, and YK-VZV-018 was 12.3, 8.3, 4.3, 4.0, and 3.7 times that of the Shingrix® positive control vaccine, respectively; 7.4, 5.0, 2.6, 2.4, and 2.2 times that of YK-VZV-007 (Comparative Example 4), respectively; and significantly higher than that of YK-VZV-004 (Comparative Example 1) and YK-VZV- 045 (Comparative Example 3).
[0432] The specific results are shown in the table below. Table 17: IL-2+ CD4+ T cells induced by mRNA vaccines - 1 Test substance CD4+ IL-2+ Compared to Shingrix® (times) Compared to YK-VZV-007 (times) YK-VZV-010 3.70% 12.3 7.4 YK-VZV-020 2.50% 8.3 5.0 YK-VZV-038 1.40% 4.7 2.8 YK-VZV-031 1.40% 4.7 2.8 YK-VZV-013 1.30% 4.3 2.6 YK-VZV-028 1.30% 4.3 2.6 YK-VZV-011 1.20% 4.0 2.4 YK-VZV-012 1.20% 4.0 2.4 YK-VZV-018 1.10% 3.7 2.2BSL-0035-CA 94 YK-VZV-021 1.10% 3.7 2.2 YK-VZV-009 1.10% 3.7 2.2 LNP 0.10% 0.3 0.2 Shingrix® 0.30% 1.0 0.6 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.1 YK-VZV-045 (Comparative Example 3) 0.30% 1.0 0.6 YK-VZV-007 (Comparative Example 4) 0.50% 1.7 1.0 B) Since the percentage of IL-2+ CD4+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-014, YK-VZV-030, and YK-VZV-024 was less than 1.0%, which was significantly lower than the optimal and relatively optimal percentage of cells secreted by the mRNA vaccines (more than 1.0%), 3 times or less that of the Shingrix® positive control vaccine, and less than two times that of YK-VZV-007 (Comparative Example 4), YKVZV-014, YK-VZV-030, and YK-VZV-024 were excluded from the candidate sequences. The specific results are shown in the table below. Table 18: IL-2+ CD4+ T cells induced by mRNA vaccines - 2 Test substance CD4+ IL-2+ Compared to Shingrix® (times) Compared to YK-VZV-007 (times) YK-VZV-014 0.80% 2.7 1.6 YK-VZV-030 0.80% 2.7 1.6 YK-VZV-024 0.60% 2.0 1.2 LNP 0.10% 0.3 0.2 Shingrix® 0.30% 1.0 0.6 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.1 YK-VZV-045 (Comparative Example 3) 0.30% 1.0 0.6 YK-VZV-007 (Comparative Example 4) 0.50% 1.7 1.0
[0433] iv) Conclusion A) After immunizing mice with the mRNA vaccines prepared from the selected sequences, the percentage of immune cells in the spleens of mice is as follows: the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells was 2 times or more and up to 7 times that of the Shingrix® positive control, and 1.8 to 5.3 times that of YKVZV-007 (Comparative Example 4);BSL-0035-CA 95 the percentage of IFN-γ+ CD4+ T cells was 1.00 to 2.00%, which was 3 times or more and up to 6.7 times that of the Shingrix® positive control vaccine, and approximately 2.2 to 4.4 times that of Comparative Example 4 (YK-VZV-007); the percentage of IL-2+ CD4+ T cells was more than 1%, which was 3.7 times or more that of the Shingrix® positive control vaccine and 2.2 times or more that of YK-VZV-007; the details are as follows: Table 19: CD4+ T cells producing IFN-γ+ or IL-2+ induced by mRNA vaccines Test substance CD4+ (IFN-γ+) CD4+ (IL-2+) CD4+ (IFN-γ+ or IL-2+) CD4+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 2.00% 6.7 4.4 3.70% 12.3 7.4 4.20% 7.0 5.3 YK-VZV-013 1.70% 5.7 3.8 1.30% 4.3 2.6 1.90% 3.2 2.4 YK-VZV-011 1.60% 5.3 3.6 1.20% 4.0 2.4 1.60% 2.7 2.0 YK-VZV-020 1.60% 5.3 3.6 2.50% 8.3 5.0 3.10% 5.2 3.9 YK-VZV-012 1.40% 4.7 3.1 1.20% 4.0 2.4 1.70% 2.8 2.1 YK-VZV-018 1.20% 4.0 2.7 1.10% 3.7 2.2 1.40% 2.3 1.8 YK-VZV-028 1.20% 4.0 2.7 1.30% 4.3 2.6 1.70% 2.8 2.1 YK-VZV-038 1.10% 3.7 2.4 1.40% 4.7 2.8 1.90% 3.2 2.4 YK-VZV-031 1.00% 3.3 2.2 1.40% 4.7 2.8 1.70% 2.8 2.1 LNP 0.10% 0.3 0.2 0.10% 0.3 0.2 0.20% 0.3 0.3 Shingrix® 0.30% 1.0 0.7 0.30% 1.0 0.6 0.60% 1.0 0.8 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.2 0.55% 1.8 1.1 0.95% 1.6 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 1.7 1.1 0.30% 1.0 0.6 0.50% 0.8 0.6 YK-VZV-007 (Comparative Example 4) 0.45% 1.5 1.0 0.50% 1.7 1.0 0.80% 1.3 1.0
[0434] Among the above sequences, the percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells induced by YK-VZV-010 in spleen cells was more than 2%, which was approximately 6 to 12 times that of the Shingrix® positive control vaccine, indicating the best immune effect.
[0435] B) The percentage of immune cells secreted by the mRNA vaccines prepared from the excluded sequences is as follows: the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells was less than 2BSL-0035-CA 96 times that of the Shingrix® positive control vaccine and less than 1.5 times that of Comparative Example 4 (YK-VZV-007); or the percentage of IFN-γ+ CD4+ T cells secreted by the mRNA vaccines was less than 1.0%, which was only 2 to 3 times that of the Shingrix® positive control vaccine and approximately 1 to 2 times that of Comparative Example 4 (YK-VZV-007); or the percentage of IL-2+ CD4+ T cells was less than 1.0%, which was 3 times or less that of the Shingrix® positive control vaccine and less than 2 times that of YK-VZV-007 (Comparative Example 4); the details are as follows: Table 20: CD4+ T cells producing IFN-γ+ or IL-2+ induced by mRNA vaccines Test substance CD4+ (IFN-γ+) CD4+ (IL-2+) CD4+ (IFN-γ+ or IL-2+) CD4+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD4+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-014 1.10% 3.7 2.4 0.80% 2.7 1.6 1.10% 1.8 1.4 YK-VZV-021 0.90% 3.0 2.0 1.10% 3.7 2.2 1.50% 2.5 1.9 YK-VZV-009 0.80% 2.7 1.8 1.10% 3.7 2.2 1.40% 2.3 1.8 YK-VZV-024 0.70% 2.3 1.6 0.60% 2.0 1.2 0.90% 1.5 1.1 YK-VZV-030 0.60% 2.0 1.3 0.80% 2.7 1.6 1.10% 1.8 1.4 LNP 0.10% 0.3 0.2 0.10% 0.3 0.2 0.20% 0.3 0.3 Shingrix® 0.30% 1.0 0.7 0.30% 1.0 0.6 0.60% 1.0 0.8 YK-VZV-004 (Comparative Example 1) 0.55% 1.8 1.2 0.55% 1.8 1.1 0.95% 1.6 1.2 YK-VZV-045 (Comparative Example 3) 0.50% 1.7 1.1 0.30% 1.0 0.6 0.50% 0.8 0.6 YK-VZV-007 (Comparative Example 4) 0.45% 1.5 1.0 0.50% 1.7 1.0 0.80% 1.3 1.0
[0436] The percentage of CD4+ T cells producing IFN-γ or IL-2 induced by the above mRNA vaccines in spleen cells was less than 1%, and the total percentage of IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells was less than 2.0 times that of Shingrix®, indicating a poor immuneboosting effect. Therefore, these sequences were not suitable as candidate sequences for the herpes zoster vaccine as compared to the sequences in part A above.BSL-0035-CA 97
[0437] In summary, the mRNA vaccines prepared from test substances YK-VZV-010, YKVZV-013, YK-VZV-011, YK-VZV-020, YK-VZV-012, YK-VZV-018, YK-VZV-028, YKVZV-038, and YK-VZV-031 were selected. IFN-γ+ CD4+ T cells and IL-2+ CD4+ T cells induced by these mRNA vaccines had an excellent effect. Therefore, the above sequences as well as YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YKVZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4) were used for subsequent CD8+ T cell immunoassays.
[0438] CD8+ T cells Based on the results for CD4+ T cells, test substances YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, YK-VZV-012, YK-VZV-018, YK-VZV-028, YK-VZV-038, YK-VZV-031, YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4) were assayed, and the number of CD8+ T cells producing IL-2 / IFN-γ induced by these sequences was measured. The specific results are shown in the table below. Table 21: Summary of CD8+ T cell assay results Test substance CD8+ IFN-γ+ CD8+ IL-2+ CD8+ (IFN-γ+ or IL-2+) CD8+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 8.10% 7.36 4.26 0.50% 4.17 2.78 7.90% 7.18 4.94 YK-VZV-013 6.90% 6.27 3.63 0.40% 3.33 2.22 7.10% 6.45 4.44 YK-VZV-020 5.60% 5.09 2.95 0.30% 2.50 1.67 5.60% 5.09 3.50 YK-VZV-018 5.20% 4.73 2.74 0.40% 3.33 2.22 5.20% 4.73 3.25 YK-VZV-011 5.00% 4.55 2.63 0.40% 3.33 2.22 5.10% 4.64 3.19 YK-VZV-012 4.20% 3.82 2.21 0.10% 0.83 0.56 4.20% 3.82 2.63 YK-VZV-028 3.10% 2.82 1.63 0.40% 3.33 2.22 3.10% 2.82 1.94 YK-VZV-038 2.40% 2.18 1.26 0.20% 1.67 1.11 2.30% 2.09 1.44 YK-VZV-031 1.80% 1.64 0.95 0.10% 0.83 0.56 1.90% 1.73 1.19 LNP 0.00% - - 0.00% - - 0.00% - - Shingrix® 1.10% 1.00 0.58 0.12% 1.00 0.67 1.10% 1.00 0.69 YK-VZV-004 (Comparative Example 1) 2.80% 2.55 1.47 0.21% 1.75 1.17 2.70% 2.45 1.69 YK-VZV-006 (Comparative 1.90% 1.73 1.00 0.20% 1.67 1.11 1.50% 1.36 0.94BSL-0035-CA 98 Example 2) YK-VZV-045 (Comparative Example 3) 1.50% 1.36 0.79 0.16% 1.33 0.89 1.40% 1.27 0.88 YK-VZV-007 (Comparative Example 4) 1.90% 1.73 1.00 0.18% 1.50 1.00 1.60% 1.45 1.00 Note: Shingrix® is a recombinant protein vaccine from GSK.
[0439] Total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells A) Based on the above results, the mRNA vaccines prepared from test substances YKVZV-010, YK-VZV-013, YK-VZV-020, YK-VZV-018, and YK-VZV-011 were screened out. The total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells induced by these mRNA vaccines was 4 to 7 times or more that of the Shingrix® positive control vaccine and approximately 3 to 5 times that of YK-VZV-007 (Comparative Example 4). The specific results are shown in the table below. Table 22: Total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells induced by mRNA vaccines - 1 Test substance CD8+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-010 7.90% 7.18 4.94 YK-VZV-013 7.10% 6.45 4.44 YK-VZV-020 5.60% 5.09 3.50 YK-VZV-018 5.20% 4.73 3.25 YK-VZV-011 5.10% 4.64 3.19 LNP 0.00% - - Shingrix® 1.10% 1.00 0.69 YK-VZV-004 (Comparative Example 1) 2.70% 2.45 1.69 YK-VZV-006 (Comparative Example 2) 1.50% 1.36 0.94 YK-VZV-045 (Comparative Example 3) 1.40% 1.27 0.88 YK-VZV-007 (Comparative Example 4) 1.60% 1.45 1.00
[0440] B) However, the total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-012, YK-VZV-028, YK-VZV-038, and YK-VZV-031 was less than 4 times that of the Shingrix® positive controlBSL-0035-CA 99 vaccine and 3 times or less that of YK-VZV-007 (Comparative Example 4). The specific results are shown in the table below. Table 23: Total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells induced by mRNA vaccines - 2 Test substance CD8+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-012 4.20% 3.82 2.63 YK-VZV-028 3.10% 2.82 1.94 YK-VZV-038 2.30% 2.09 1.44 YK-VZV-031 1.90% 1.73 1.19 LNP 0.00% - - Shingrix® 1.10% 1.00 0.69 YK-VZV-004 (Comparative Example 1) 2.70% 2.45 1.69 YK-VZV-006 (Comparative Example 2) 1.50% 1.36 0.94 YK-VZV-045 (Comparative Example 3) 1.40% 1.27 0.88 YK-VZV-007 (Comparative Example 4) 1.60% 1.45 1.00
[0441] IFN-γ+ CD8+ T cells A) The mRNA vaccines prepared from test substances YK-VZV-010, YK-VZV-013, YK-VZV-020, YK-VZV-018, and YK-VZV-011 were screened out. The percentage of IFN- γ+ CD8+ T cells secreted by these mRNA vaccines was optimal at 5.0% or more, with the percentage of YK-VZV-010 the highest at 8.10%, which was significantly higher than that of Comparative Examples 1 to 4 (YK-VZV-004, YK-VZV-006, YK-VZV-045, and YK-VZV- 007). The percentage of these five sequences was 4.5 to 7.0 times or more that of the Shingrix® positive control vaccine and approximately 2.5 to 4.5 times that of YK-VZV-007. The specific results are shown in the table below. Table 24: IFN-γ+ CD8+ T cells induced by mRNA vaccines - 1 Test substance CD8+ (IFN-γ+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-010 8.10% 7.36 4.26 YK-VZV-013 6.90% 6.27 3.63 YK-VZV-020 5.60% 5.09 2.95 YK-VZV-018 5.20% 4.73 2.74 YK-VZV-011 5.00% 4.55 2.63BSL-0035-CA 100 LNP 0.00% - - Shingrix® 1.10% 1.00 0.58 YK-VZV-004 (Comparative Example 1) 2.80% 2.55 1.47 YK-VZV-006 (Comparative Example 2) 1.90% 1.73 1.00 YK-VZV-045 (Comparative Example 3) 1.50% 1.36 0.79 YK-VZV-007 (Comparative Example 4) 1.90% 1.73 1.00
[0442] B) Since the percentage of IFN-γ+ CD8+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-012, YK-VZV-028, YK-VZV-038, and YK-VZV-031 was less than 5%, which was significantly lower than the optimal percentage of cells secreted by the mRNA vaccines (5.00 to 8.10%), only 4 times or less that of the Shingrix® positive control vaccine, and approximately 1 to 2 times that of YK-VZV-007, these sequences were excluded. The specific results are shown in the table below. Table 25: IFN-γ+ CD8+ T cells induced by mRNA vaccines - 2 Test substance CD8+ (IFN-γ+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-012 4.20% 3.82 2.21 YK-VZV-028 3.10% 2.82 1.63 YK-VZV-038 2.40% 2.18 1.26 YK-VZV-031 1.80% 1.64 0.95 LNP 0.00% - - Shingrix® 1.10% 1.00 0.58 YK-VZV-004 (Comparative Example 1) 2.80% 2.55 1.47 YK-VZV-006 (Comparative Example 2) 1.90% 1.73 1.00 YK-VZV-045 (Comparative Example 3) 1.50% 1.36 0.79 YK-VZV-007 (Comparative Example 4) 1.90% 1.73 1.00
[0443] IL-2+ CD8+ T cells A) The mRNA vaccines prepared from test substances YK-VZV-010, YK-VZV-013, YK-VZV-018, YK-VZV-011, YK-VZV-028, and YK-VZV-020 were screened out. The percentage of IL-2+ CD8+ T cells secreted by these mRNA vaccines was optimal at 0.3 to 0.5%, which was significantly higher than that of the comparative examples (YK-VZV-004, YKBSL-0035-CA 101 VZV-006, YK-VZV-045, and YK-VZV-007); and which was 2.5 to 4.0 times or more that of the Shingrix® positive control vaccine and approximately 1.5 to 3.0 times that of YK-VZV-007. The specific results are shown in the table below. Table 26: IL-2+ CD8+ T cells induced by mRNA vaccines - 1 Test substance CD8+ (IL-2+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-010 0.50% 4.17 2.78 YK-VZV-013 0.40% 3.33 2.22 YK-VZV-018 0.40% 3.33 2.22 YK-VZV-011 0.40% 3.33 2.22 YK-VZV-028 0.40% 3.33 2.22 YK-VZV-020 0.30% 2.50 1.67 LNP 0.00% - - Shingrix® 0.12% 1.00 0.67 YK-VZV-004 (Comparative Example 1) 0.21% 1.75 1.17 YK-VZV-006 (Comparative Example 2) 0.20% 1.67 1.11 YK-VZV-045 (Comparative Example 3) 0.16% 1.33 0.89 YK-VZV-007 (Comparative Example 4) 0.18% 1.50 1.00
[0444] B) Since the percentage of IL-2+ CD8+ T cells secreted by the mRNA vaccines prepared from test substances YK-VZV-038, YK-VZV-012, and YK-VZV-031 was only 0.2% or less, whose effect was not significantly different from or worse than that of the Shingrix® positive control vaccine and YK-VZV-007, and which was only approximately 0.8 to 1.6 times that of the Shingrix® positive control vaccine and approximately 0.5 to 1.0 times that of YKVZV-007, these sequences were excluded. The specific results are shown in the table below. Table 27: IL-2+ CD8+ T cells induced by mRNA vaccines - 2 Test substance CD8+ (IL-2+) Compared to Shingrix® (times) Compared to YK-VZV- 007 (times) YK-VZV-038 0.20% 1.67 1.11 YK-VZV-012 0.10% 0.83 0.56 YK-VZV-031 0.10% 0.83 0.56 LNP 0.00% - - Shingrix® 0.12% 1.00 0.67 YK-VZV-004 (Comparative Example 1) 0.21% 1.75 1.17BSL-0035-CA 102 YK-VZV-006 (Comparative Example 2) 0.20% 1.67 1.11 YK-VZV-045 (Comparative Example 3) 0.16% 1.33 0.89 YK-VZV-007 (Comparative Example 4) 0.18% 1.50 1.00 Conclusion:
[0445] Based on the results from (i) to (iii) above, the candidate vaccines were screened out, and the percentage of immune cells in the spleens of mice induced by these vaccines is as follows: A) the total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells was 4 to 7 times or more that of the Shingrix® vaccine and approximately 3 to 5 times that of YK-VZV-007 (Comparative Example 4); the percentage of IFN-γ+ CD8+ T cells was optimal at 5.0% or more, which was 4.5 to 7 times or more that of the Shingrix® positive control vaccine and approximately 2.5 to 4.5 times that of YK-VZV-007; the percentage of IL-2+ CD8+ T cells was optimal at 0.3 to 0.5%, which was 2.5 to 4 times or more that of the Shingrix® positive control vaccine and approximately 1.5 to 3 times that of YK-VZV-007; the results were significantly higher than those of the comparative examples (YKVZV-004, YK-VZV-006, YK-VZV-045, and YK-VZV-007); the details are as follows: Table 28: CD8+ T cells producing IFN-γ+ or IL-2+ induced by mRNA vaccines - 1 Test substance CD8+ IFN-γ+ CD8+ IL-2+ CD8+ (IFN-γ+ or IL-2+) CD8+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 8.10% 7.36 4.26 0.50% 4.17 2.78 7.90% 7.18 4.94 YK-VZV-013 6.90% 6.27 3.63 0.40% 3.33 2.22 7.10% 6.45 4.44 YK-VZV-020 5.60% 5.09 2.95 0.30% 2.50 1.67 5.60% 5.09 3.50 YK-VZV-018 5.20% 4.73 2.74 0.40% 3.33 2.22 5.20% 4.73 3.25 YK-VZV-011 5.00% 4.55 2.63 0.40% 3.33 2.22 5.10% 4.64 3.19 LNP 0.00% - - 0.00% - - 0.00% - - Shingrix® 1.10% 1.00 0.58 0.12% 1.00 0.67 1.10% 1.00 0.69 YK-VZV-004 (Comparative 2.80% 2.55 1.47 0.21% 1.75 1.17 2.70% 2.45 1.69BSL-0035-CA 103 Example 1) YK-VZV-006 (Comparative Example 2) 1.90% 1.73 1.00 0.20% 1.67 1.11 1.50% 1.36 0.94 YK-VZV-045 (Comparative Example 3) 1.50% 1.36 0.79 0.16% 1.33 0.89 1.40% 1.27 0.88 YK-VZV-007 (Comparative Example 4) 1.90% 1.73 1.00 0.18% 1.50 1.00 1.60% 1.45 1.00
[0446] B) The percentage of immune cells in the spleens of mice induced by the vaccines prepared from the excluded test substances is as follows: the total percentage of IFN-γ+ CD8+ T cells and IL-2+ CD8+ T cells was less than 4 times that of the Shingrix® vaccine and 3 times or less that of YK-VZV-007 (Comparative Example 4); or, the percentage of IFN-γ+ CD8+ T cells was less than 5%, which was significantly lower than the optimal percentage of cells secreted by the mRNA vaccines (5.20 to 8.10%), only 4 times or less that of the Shingrix® positive control vaccine, and approximately 1 to 2 times that of YK-VZV-007; or, the percentage of IL-2+ CD8+ T cells was only 0.2% or less, whose effect was not significantly different from or worse than that of the Shingrix® positive control vaccine and YK-VZV-007, and which was only approximately 0.8 to 1.6 times that of the Shingrix® positive control vaccine and approximately 0.5 to 1.0 times that of YK-VZV-007, so that these sequences were excluded; the details are as follows: Table 29: CD8+ T cells producing IFN-γ+ or IL-2+ induced by mRNA vaccines - 2 Test substance CD8+ IFN-γ+ CD8+ IL-2+ CD8+ (IFN-γ+ or IL-2+) CD8+ (IFN-γ+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) CD8+ (IFN-γ+ or IL-2+) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-012 4.20% 3.82 2.21 0.10% 0.83 0.56 4.20% 3.82 2.63 YK-VZV-028 3.10% 2.82 1.63 0.40% 3.33 2.22 3.10% 2.82 1.94 YK-VZV-038 2.40% 2.18 1.26 0.20% 1.67 1.11 2.30% 2.09 1.44 YK-VZV-031 1.80% 1.64 0.95 0.10% 0.83 0.56 1.90% 1.73 1.19 LNP 0.00% - - 0.00% - - 0.00% - -BSL-0035-CA 104 Shingrix® 1.10% 1.00 0.58 0.12% 1.00 0.67 1.10% 1.00 0.69 YK-VZV-004 (Comparative Example 1) 2.80% 2.55 1.47 0.21% 1.75 1.17 2.70% 2.45 1.69 YK-VZV-006 (Comparative Example 2) 1.90% 1.73 1.00 0.20% 1.67 1.11 1.50% 1.36 0.94 YK-VZV-045 (Comparative Example 3) 1.50% 1.36 0.79 0.16% 1.33 0.89 1.40% 1.27 0.88 YK-VZV-007 (Comparative Example 4) 1.90% 1.73 1.00 0.18% 1.50 1.00 1.60% 1.45 1.00
[0447] The percentage of CD8+ T cells producing IL-2+ induced by the mRNA vaccines prepared from YK-VZV-012 and YK-VZV-031 was less than that of the Shingrix® vaccine and YK-VZV-007 (Comparative Example 4). Therefore, these sequences were excluded.
[0448] The total percentage of CD8+ T cells producing IFN-γ+ and CD8+ T cells producing IFN-γ+ and IL-2+ induced by the mRNA vaccines prepared from YK-VZV-028 and YK-VZV- 038 was only approximately 2 times that of the Shingrix® vaccine, which was significantly lower than that of the sequences designed in part A above (up to 7 times or more), indicating a poor immune effect. Therefore, these sequences were not suitable as candidate sequences for the herpes zoster vaccine.
[0449] Therefore, based on the above results, the sequences with significant advantages in overall immune effect include: YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, and YK-VZV-018, with YK-VZV-010 showing the best effect.
[0450] Results of gE protein-specific IgG antibody titers of VZV gE antigen variants in serum of Balb / c mice (D56) To verify the consistency of some of the above IgG antibody titers and some of the cellular immunoassay results of VZV gE antigen variants, some of the following test substances (including YK-VZV-009, YK-VZV-010, YK-VZV-011, YK-VZV-013, YK-VZV-020, YKVZV-014, YK-VZV-012, YK-VZV-018, YK-VZV-021, YK-VZV-024, YK-VZV-028, YKVZV-030, YK-VZV-031, YK-VZV-038, YK-VZV-004 (Comparative Example 1), YK-VZV- 045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4)) were further used. Serum samples from immunized mice on day 56 were determined, and the VZV binding-gE antibody IgG titers in the serum were measured according to the detection method in ExampleBSL-0035-CA 105 5. The test results are shown in the table below. Table 30: VZV binding-gE antibody IgG titers in serum (day 56) Test substance Antibody GMT (× 104) Antibody GMT of test substance / antibody GMT of Shingrix® Antibody GMT of test substance / antibody GMT of YK-VZV-007 YK-VZV-010 750 5.00 2.68 YK-VZV-011 710 4.73 2.54 YK-VZV-018 698 4.65 2.49 YK-VZV-020 690 4.60 2.46 YK-VZV-013 669 4.46 2.39 YK-VZV-031 480 3.20 1.71 YK-VZV-030 454 3.03 1.62 YK-VZV-038 445 2.97 1.59 YK-VZV-009 420 2.80 1.50 YK-VZV-014 410 2.73 1.46 YK-VZV-012 405 2.70 1.45 YK-VZV-021 373 2.49 1.33 YK-VZV-028 357 2.38 1.28 YK-VZV-024 274 1.83 0.98 LNP 0 0.00 0.00 Shingrix® 150 1.00 0.54 YK-VZV-004 (Comparative Example 1) 330 2.20 1.18 YK-VZV-045 (Comparative Example 3) 170 1.13 0.61 YK-VZV-007 (Comparative Example 4) 280 1.87 1.00
[0451] Based on the above results, on day 56, the gE-specific antibody IgG titers of the above mRNA vaccines were all all superior to the Shingrix® positive control, being approximately 1.8 to 5.0 times that of the Shingrix® vaccine, with the antibody GMT ranging from 270 to 750 × 104. Specifically, the antibody GMT of YK-VZV-010, YK-VZV-011, YK-VZV-018, YKVZV-020, and YK-VZV-013 could reach 650 × 104 or more, being 4.0 to 5.0 times or more that of the Shingrix® vaccine and 2 times or more that of YK-VZV-007 (Comparative Example 4). Moreover, the results were significantly better than those of YK-VZV-004 (Comparative Example 1) and YK-VZV-045 (Comparative Example 3).
[0452] Based on the IgG antibody titers as well as CD4+ T cell and CD8+ T cell assay results, the five antigens YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV-020, and YK-VZVBSL-0035-CA 106 018 exhibited the best effect of cellular immunity, making them suitable candidate antigens for further detection and analysis by ELISPOT.
[0453] Results of cellular immune factors of VZV gE antigen variants (ELISOPT) ELISOPT is the gold standard for screening and evaluating the immune effects of candidate vaccine antigen-specific T cells and can be used to differentiate between subpopulations of activated T cells through cytokines, such as T helper (Th) type 1 cells (producing IFN-γ, IL-2, IL-6, IL-12, IL-21, and TNF-α cytokines), Th2 cells (producing IL-4, IL-5, IL-10, and IL-13 cytokines), and Th17 cells (producing IL-17 cytokines).
[0454] Through the comprehensive analysis of IgG and cytokine assay results, a total of 5 optimal antigen sequences (including YK-VZV-010, YK-VZV-013, YK-VZV-011, YK-VZV- 020, and YK-VZV-018) were screened out and further detected by ELISPOT together with Comparative Example 1 (YK-VZV-004), Comparative Example 2 (YK-VZV-006), Comparative Example 3 (YK-VZV-045), and Comparative Example 4 (YK-VZV-007), using LNP and Shingrix® as controls. The results are as follows: 1) The amount of cytokine IFN-γ secreted by T cells stimulated by the mRNA vaccine was 500 SFU or more, with a maximum close to 600 SFU, which was approximately 16 to 19 times that of the Shingrix® positive control and 2.5 to 3.0 times that of Comparative Example 4 (YK-VZV-007); and which was significantly better than that of the cytokine secreted and stimulated by the mRNA vaccine corresponding to Comparative Example 1 (YK-VZV-004), Comparative Example 2 (YK-VZV-006), or Comparative Example 3 (YK-VZV-045).
[0455] Specifically, the mRNA vaccine prepared from the YK-VZV-010 sequence reached a maximum of 598.8 SFU, which was 18.7 times that of the Shingrix® positive control and nearly 3 times that of the YK-VZV-007 control.
[0456] The IFN-γ secretion levels from high to low were YK-VZV-010, YK-VZV-018, YKVZV-011, YK-VZV-020, and YK-VZV-013, with no significant difference between the groups, indicating a good and significant immune effect.BSL-0035-CA 107
[0457] Table 31: IFN-γ+ secretion from spleen cells induced by mRNA vaccines Test substance IFN-γ+ (SFU) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 598.8 18.71 2.99 YK-VZV-018 565 17.66 2.82 YK-VZV-011 561.7 17.55 2.80 YK-VZV-020 522.4 16.33 2.61 YK-VZV-013 511.0 15.97 2.55 LNP 1.2 0.04 0.01 Shingrix® 32.0 1.00 0.16 YK-VZV-004 (Comparative Example 1) 280.3 8.76 1.40 YK-VZV-006 (Comparative Example 2) 220.3 6.88 1.10 YK-VZV-045 (Comparative Example 3) 200.1 6.25 1.00 YK-VZV-007 (Comparative Example 4) 200.3 6.26 1.00
[0458] 2) The amount of cytokine IL-2 secreted by T cells stimulated by the mRNA vaccine was 400 to 600 SFU or more, which was 10 to 16 times that of the Shingrix® positive control and 2.0 to 3.0 times that of the YK-VZV-007 control; and which was significantly better than that of the cytokine secreted and stimulated by the mRNA vaccine corresponding to Comparative Example 1 (YK-VZV-004), Comparative Example 2 (YK-VZV-006), or Comparative Example 3 (YK-VZV-045).
[0459] Specifically, the mRNA vaccine prepared from the YK-VZV-010 sequence reached a maximum of 614.5 SFU, which was 16.00 times that of the Shingrix® positive control and 3 times or more that of the YK-VZV-007 control.
[0460] The IL-2 secretion levels from high to low were YK-VZV-010, YK-VZV-011, YKVZV-018, YK-VZV-013, and YK-VZV-020, with no significant difference between the groups, indicating a good and significant immune effect.
[0461] Table 32: IL-2+ secretion from spleen cells induced by mRNA vaccines Test substance IL-2+ (SFU) Compared to Shingrix® (times) Compared to YKVZV-007 (times) YK-VZV-010 614.5 16.00 3.07 YK-VZV-011 490.3 12.77 2.45 YK-VZV-018 452.3 11.78 2.26 YK-VZV-013 441.6 11.50 2.20BSL-0035-CA 108 YK-VZV-020 418.9 10.91 2.09 LNP 16.1 0.42 0.08 Shingrix® 38.4 1.00 0.19 YK-VZV-004 (Comparative Example 1) 274.7 7.15 1.37 YK-VZV-006 (Comparative Example 2) 230.3 6.00 1.15 YK-VZV-045 (Comparative Example 3) 205.3 5.35 1.02 YK-VZV-007 (Comparative Example 4) 200.4 5.22 1.00
[0462] Results of cellular localization of VZV gE antigen variants 1) Reduction of gE antigen localization to trans Golgi network by C-terminal truncation and mutations in "A568Y569R570V571" motif The "A568Y569R570V571" motif (SEQ ID NO: 184) is a transport motif that targets the gE polypeptide to the trans Golgi network. YK-VZV-018 (SEQ ID NO: 63) and YK-VZV- 020 (SEQ ID NO: 71) encode a truncated polypeptide with terminal 50 amino acids deleted from the C-terminal region (retaining 1-573aa) and mutations at any site of the A568Y569R570V571 sequence (e.g., mutations at A568D and Y569K). The results of Example 8 showed that both YK-VZV-018 and YK-VZV-020 variants led to reduced localization of the gE polypeptide to the trans Golgi network and enhanced cell membrane expression.
[0463] 2) Reduction of gE antigen localization to trans Golgi network by any combination of "A568Y569R570V571" or "Y582A583G584L585" mutated motifs YK-VZV-011 (SEQ ID NO: 35) and YK-VZV-013 (SEQ ID NO: 43) encode a fulllength gE polypeptide with mutations at each site of the "A568Y569R570V571" motif (SEQ ID NO: 184). In addition, YK-VZV-013 also has mutations (e.g., Y582A) in the "Y582A583G584L585" endocytosis motif (SEQ ID NO: 185). The results of Example 8 showed that any combination of "A568Y569R570V571" or "Y582A583G584L585" mutated motifs resulted in gE antigen expression on the cell membrane.
[0464] 3) Reduction of localization of full-length gE variants with "A593E594A595A596D597A598" mutated motif and Y569K and Y582A mutations to trans Golgi networkBSL-0035-CA 109 YK-VZV-010 (SEQ ID NO: 31) encodes a full-length gE polypeptide, with the A593E594A595A596D597A598 sequence (SEQ ID NO: 183) replacing the "S593E594S595T596D597T598" motif (SEQ ID NO: 182). YK-VZV-010 replaces the Ser / Thr-rich "SSTT" acidic cluster with an Ala-rich sequence. In addition, the YK-VZV-010 mRNA vaccine also has Y569K and Y582A mutations. The results of Example 8 showed that the gE polypeptide of YK-VZV-010 showed enhanced cell membrane expression.
[0465] These variants are each modified to reduce the localization of the encoded gE protein to the trans Golgi network and enhance transport to the plasma membrane.
[0466] Table 33: Antigen localization results of different antigen sequences of VZV on Vero cells Mutation site Antigen sequence SEQ ID NO Expression Cellular localization full-length gE; Y569K; Y582A; S593A; S595A; T596A; T598A YK-VZV-010 31 +++ Showing localization in Golgi and cell membrane full-length gE; A568D; Y569K; R570E; V571K YK-VZV-011 35 ++ Showing localization in Golgi and cell membrane full-length gE; A568D; Y569K; R570E; V571K; Y582A YK-VZV-013 43 ++ Showing localization in Golgi, cytoplasm, and cell membrane gE (1-573aa); A568D YK-VZV-018 63 +++ Showing localization in Golgi, cytoplasm, and cell membrane gE (1-573aa); Y569K YK-VZV-020 71 +++ Showing localization in Golgi, cytoplasm, and cell membrane Summary In conclusion, the present disclosure designed 43 antigen sequences encoding VZV gE protein variants and screened out several sequences with excellent performance, including those at least outperformed the Shingrix® vaccine as well as YK-VZV-004 (Comparative Example 1), YK-VZV-006 (Comparative Example 2), YK-VZV-045 (Comparative Example 3), and YK-VZV-007 (Comparative Example 4), which is quite surprising. Among these sequences, the mutation combinations of YK-VZV-010 (full-length gE; Y569K; Y582A; S593A; S595A; T596A; T598A), YK-VZV-011 (full-length gE; A568D; Y569K; R570E; V571K), YK-VZV-013 (full-length gE; A568D; Y569K; R570E; V571K; Y582A), YK-VZV- 018 (gE 1-573aa, A568D), and YK-VZV-020 (gE 1-573aa, Y569K) were preferred. The following table shows the complete sequence information and numbering of the presentBSL-0035-CA 110 disclosure. For example, in the antigen sequences of YK-VZV-001, SEQ ID NO: 2 and 3 represent the nucleic acid sequence ("ORF-NT") and amino acid sequence ("ORF-AA") of the open reading frame for antigen YK-VZV-001, respectively; SEQ ID NO: 1 and 4 represent the DNA sequence ("DNA") and mRNA sequence ("mRNA") for antigen YK-VZV-001, respectively.
[0467] Table 34: Sequence listing SEQ ID NO: Name Sequence type 1 YK-VZV-001-DNA DNA 2 YK-VZV-001-ORF-NT ORF-NT 3 YK-VZV-001-ORF-AA ORF-AA 4 YK-VZV-001-mRNA mRNA 5 YK-VZV-002-DNA DNA 6 YK-VZV-002-ORF-NT ORF-NT 7 YK-VZV-002-ORF-AA ORF-AA 8 YK-VZV-002-mRNA mRNA 9 YK-VZV-003-DNA DNA 10 YK-VZV-003-ORF-NT ORF-NT 11 YK-VZV-003-ORF-AA ORF-AA 12 YK-VZV-003-mRNA mRNA 13 YK-VZV-004-DNA DNA 14 YK-VZV-004-ORF-NT ORF-NT 15 YK-VZV-004-ORF-AA ORF-AA 16 YK-VZV-004-mRNA mRNA 17 YK-VZV-006-DNA DNA 18 YK-VZV-006-ORF-NT ORF-NT 19 YK-VZV-006-ORF-AA ORF-AA 20 YK-VZV-006-mRNA mRNA 21 YK-VZV-007-DNA DNA 22 YK-VZV-007-ORF-NT ORF-NT 23 YK-VZV-007-ORF-AA ORF-AA 24 YK-VZV-007-mRNA mRNA 25 YK-VZV-009-DNA DNA 26 YK-VZV-009-ORF-NT ORF-NT 27 YK-VZV-009-ORF-AA ORF-AA 28 YK-VZV-009-mRNA mRNA 29 YK-VZV-010-DNA DNA 30 YK-VZV-010-ORF-NT ORF-NT 31 YK-VZV-010-ORF-AA ORF-AA 32 YK-VZV-010-mRNA mRNA 33 YK-VZV-011-DNA DNABSL-0035-CA 111 34 YK-VZV-011-ORF-NT ORF-NT 35 YK-VZV-011-ORF-AA ORF-AA 36 YK-VZV-011-mRNA mRNA 37 YK-VZV-012-DNA DNA 38 YK-VZV-012-ORF-NT ORF-NT 39 YK-VZV-012-ORF-AA ORF-AA 40 YK-VZV-012-mRNA mRNA 41 YK-VZV-013-DNA DNA 42 YK-VZV-013-ORF-NT ORF-NT 43 YK-VZV-013-ORF-AA ORF-AA 44 YK-VZV-013-mRNA mRNA 45 YK-VZV-014-DNA DNA 46 YK-VZV-014-ORF-NT ORF-NT 47 YK-VZV-014-ORF-AA ORF-AA 48 YK-VZV-014-mRNA mRNA 49 YK-VZV-015-DNA DNA 50 YK-VZV-015-ORF-NT ORF-NT 51 YK-VZV-015-ORF-AA ORF-AA 52 YK-VZV-015-mRNA mRNA 53 YK-VZV-016-DNA DNA 54 YK-VZV-016-ORF-NT ORF-NT 55 YK-VZV-016-ORF-AA ORF-AA 56 YK-VZV-016-mRNA mRNA 57 YK-VZV-017-DNA DNA 58 YK-VZV-017-ORF-NT ORF-NT 59 YK-VZV-017-ORF-AA ORF-AA 60 YK-VZV-017-mRNA mRNA 61 YK-VZV-018-DNA DNA 62 YK-VZV-018-ORF-NT ORF-NT 63 YK-VZV-018-ORF-AA ORF-AA 64 YK-VZV-018-mRNA mRNA 65 YK-VZV-019-DNA DNA 66 YK-VZV-019-ORF-NT ORF-NT 67 YK-VZV-019-ORF-AA ORF-AA 68 YK-VZV-019-mRNA mRNA 69 YK-VZV-020-DNA DNA 70 YK-VZV-020-ORF-NT ORF-NT 71 YK-VZV-020-ORF-AA ORF-AA 72 YK-VZV-020-mRNA mRNA 73 YK-VZV-021-DNA DNA 74 YK-VZV-021-ORF-NT ORF-NT 75 YK-VZV-021-ORF-AA ORF-AA 76 YK-VZV-021-mRNA mRNABSL-0035-CA 112 77 YK-VZV-022-DNA DNA 78 YK-VZV-022-ORF-NT ORF-NT 79 YK-VZV-022-ORF-AA ORF-AA 80 YK-VZV-022-mRNA mRNA 81 YK-VZV-023-DNA DNA 82 YK-VZV-023-ORF-NT ORF-NT 83 YK-VZV-023-ORF-AA ORF-AA 84 YK-VZV-023-mRNA mRNA 85 YK-VZV-024-DNA DNA 86 YK-VZV-024-ORF-NT ORF-NT 87 YK-VZV-024-ORF-AA ORF-AA 88 YK-VZV-024-mRNA mRNA 89 YK-VZV-025-DNA DNA 90 YK-VZV-025-ORF-NT ORF-NT 91 YK-VZV-025-ORF-AA ORF-AA 92 YK-VZV-025-mRNA mRNA 93 YK-VZV-026-DNA DNA 94 YK-VZV-026-ORF-NT ORF-NT 95 YK-VZV-026-ORF-AA ORF-AA 96 YK-VZV-026-mRNA mRNA 97 YK-VZV-027-DNA DNA 98 YK-VZV-027-ORF-NT ORF-NT 99 YK-VZV-027-ORF-AA ORF-AA 100 YK-VZV-027-mRNA mRNA 101 YK-VZV-028-DNA DNA 102 YK-VZV-028-ORF-NT ORF-NT 103 YK-VZV-028-ORF-AA ORF-AA 104 YK-VZV-028-mRNA mRNA 105 YK-VZV-029-DNA DNA 106 YK-VZV-029-ORF-NT ORF-NT 107 YK-VZV-029-ORF-AA ORF-AA 108 YK-VZV-029-mRNA mRNA 109 YK-VZV-030-DNA DNA 110 YK-VZV-030-ORF-NT ORF-NT 111 YK-VZV-030-ORF-AA ORF-AA 112 YK-VZV-030-mRNA mRNA 113 YK-VZV-031-DNA DNA 114 YK-VZV-031-ORF-NT ORF-NT 115 YK-VZV-031-ORF-AA ORF-AA 116 YK-VZV-031-mRNA mRNA 117 YK-VZV-032-DNA DNA 118 YK-VZV-032-ORF-NT ORF-NT 119 YK-VZV-032-ORF-AA ORF-AABSL-0035-CA 113 120 YK-VZV-032-mRNA mRNA 121 YK-VZV-033-DNA DNA 122 YK-VZV-033-ORF-NT ORF-NT 123 YK-VZV-033-ORF-AA ORF-AA 124 YK-VZV-033-mRNA mRNA 125 YK-VZV-034-DNA DNA 126 YK-VZV-034-ORF-NT ORF-NT 127 YK-VZV-034-ORF-AA ORF-AA 128 YK-VZV-034-mRNA mRNA 129 YK-VZV-035-DNA DNA 130 YK-VZV-035-ORF-NT ORF-NT 131 YK-VZV-035-ORF-AA ORF-AA 132 YK-VZV-035-mRNA mRNA 133 YK-VZV-036-DNA DNA 134 YK-VZV-036-ORF-NT ORF-NT 135 YK-VZV-036-ORF-AA ORF-AA 136 YK-VZV-036-mRNA mRNA 137 YK-VZV-037-DNA DNA 138 YK-VZV-037-ORF-NT ORF-NT 139 YK-VZV-037-ORF-AA ORF-AA 140 YK-VZV-037-mRNA mRNA 141 YK-VZV-038-DNA DNA 142 YK-VZV-038-ORF-NT ORF-NT 143 YK-VZV-038-ORF-AA ORF-AA 144 YK-VZV-038-mRNA mRNA 145 YK-VZV-039-DNA DNA 146 YK-VZV-039-ORF-NT ORF-NT 147 YK-VZV-039-ORF-AA ORF-AA 148 YK-VZV-039-mRNA mRNA 149 YK-VZV-040-DNA DNA 150 YK-VZV-040-ORF-NT ORF-NT 151 YK-VZV-040-ORF-AA ORF-AA 152 YK-VZV-040-mRNA mRNA 153 YK-VZV-041-DNA DNA 154 YK-VZV-041-ORF-NT ORF-NT 155 YK-VZV-041-ORF-AA ORF-AA 156 YK-VZV-041-mRNA mRNA 157 YK-VZV-042-DNA DNA 158 YK-VZV-042-ORF-NT ORF-NT 159 YK-VZV-042-ORF-AA ORF-AA 160 YK-VZV-042-mRNA mRNA 161 YK-VZV-043-DNA DNA 162 YK-VZV-043-ORF-NT ORF-NTBSL-0035-CA 114 163 YK-VZV-043-ORF-AA ORF-AA 164 YK-VZV-043-mRNA mRNA 165 YK-VZV-044-DNA DNA 166 YK-VZV-044-ORF-NT ORF-NT 167 YK-VZV-044-ORF-AA ORF-AA 168 YK-VZV-044-mRNA mRNA 169 YK-VZV-045-DNA DNA 170 YK-VZV-045-ORF-NT ORF-NT 171 YK-VZV-045-ORF-AA ORF-AA 172 YK-VZV-045-mRNA mRNA 173 5′ UTR Artificially synthesized 174 5′ UTR C3 (complement component 3) 175 5′ UTR Artificially synthesized 176 5′ UTR Artificially synthesized 177 5′ UTR Artificially synthesized 178 3′ UTR Homo sapiens hemoglobin β-globin gene 1 (TA) 179 3′ UTR Homo sapiens hemoglobin β-globin gene 180 3′ UTR PCBP4 gene 181 3′ UTR CYBA_1.5x 182 S593ES595T596DT598 motif Amino acid sequence 183 A593EA595A596DA598 motif Amino acid sequence 184 A568YRV571 motif Amino acid sequence 185 Y582AGL585 motif Amino acid sequence 186 Y569RVDKSPYNQS579 motif Amino acid sequence 187 Y569RVDKSPYNQSMYYAGLP V587 motif Amino acid sequence 188 SSTT motif Amino acid sequence 189 AYRVYAGLSSTT Amino acid sequence 190 YAGLSSTT Amino acid sequence 191 AYRVYAGL Amino acid sequence
[0468] SEQ ID NO: 1 YK-VZV-001-DNA AGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGCCACCATG GGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCATCATCACAG GCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATACGACGACTT CCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCCTACTACCAC AGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGCAGAAAGGCC TACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATGGCTTCCTGG AAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCATCGACAGCGBSL-0035-CA 115 GCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCTGGGAGATG ATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACACAAGATCGT GAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTGAATCCTAA GCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACCCCTTCACA CTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGACATGGTCCTT TCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGCACATTTGCC TGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTGCGCCGAGA ACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGGAAAGAAAG AGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGACGAGCTGG AACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAGAACCGAGA AGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGGCACCTCTAC CTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGAATTACCAC AGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTGCAGTACAA GATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGCCCATCGATC CTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCAACGCTCCC CAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCACCTGGCTC AGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAATTACACCG CCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCTGCACGAT GGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGCCTGTATG TGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGTGGTGTC TACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCAACTGCT GGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATCCCGGCA CAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGTTGTTCT GCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGAAGGCC TACAGAGTGGACAAGAGCCCTTACAACCAGAGCATGTACTACGCCGGCCTGCCTG TGGACGACTTCGAGGATAGCGAGAGCACCGACACCGAGGAAGAGTTCGGCAACG CCATTGGAGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAGACCCG GTGAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCC CTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCBSL-0035-CA 116 GGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAA SEQ ID NO: 2 YK-VZV-001-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGCBSL-0035-CA 117 CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AGGCCTACAGAGTGGACAAGAGCCCTTACAACCAGAGCATGTACTACGCCGGCCT GCCTGTGGACGACTTCGAGGATAGCGAGAGCACCGACACCGAGGAAGAGTTCGG CAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAG ACCCGGTGA SEQ ID NO: 3 YK-VZV-001-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 4 YK-VZV-001-mRNA AGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCA UGGGCACCGUGAACAAGCCUGUUGUGGGCGUGCUGAUGGGCUUCGGCAUCAUC ACAGGCACCCUGCGGAUCACCAAUCCUGUGCGGGCUAGCGUGCUGAGAUACGA CGACUUCCACAUCGACGAGGACAAGCUGGACACCAACAGCGUGUACGAGCCCU ACUACCACAGCGAUCACGCCGAGUCUAGCUGGGUCAACAGAGGCGAGAGCAGC AGAAAGGCCUACGACCACAACAGCCCCUACAUCUGGCCCCGGAACGACUACGA UGGCUUCCUGGAAAAUGCCCACGAGCACCACGGCGUGUACAAUCAAGGCAGAG GCAUCGACAGCGGCGAGAGACUGAUGCAGCCUACACAGAUGAGCGCCCAAGAGBSL-0035-CA 118 GACCUGGGAGAUGAUACCGGCAUCCACGUGAUCCCCACACUGAACGGCGACGA CAGACACAAGAUCGUGAACGUGGACCAGCGGCAGUACGGCGACGUGUUCAAGG GCGACCUGAAUCCUAAGCCUCAGGGCCAGCGCCUGAUCGAGGUGUCCGUGGAA GAGAAUCACCCCUUCACACUGAGAGCCCCUAUCCAGAGAAUCUACGGCGUGCG CUAUACCGAGACAUGGUCCUUUCUGCCCAGCCUGACAUGUACCGGGGAUGCCG CUCCUGCCAUCCAGCACAUUUGCCUGAAGCACACCACCUGUUUCCAGGACGUG GUGGUGGAUGUGGACUGCGCCGAGAACACCAAAGAGGAUCAGCUGGCCGAGA UCAGCUACCGGUUCCAGGGAAAGAAAGAGGCCGACCAGCCUUGGAUCGUGGUC AACACCAGCACACUGUUCGACGAGCUGGAACUGGACCCUCCUGAGAUUGAACC CGGGGUGCUGAAGGUGCUGAGAACCGAGAAGCAGUACCUGGGAGUGUACAUC UGGAACAUGAGAGGCAGCGACGGCACCUCUACCUACGCCACCUUUCUGGUCAC AUGGAAGGGCGACGAGAAAACACGGAACCCCACACCAGCUGUGACCCCUCAAC CUAGAGGCGCCGAGUUUCACAUGUGGAAUUACCACAGCCACGUGUUCAGCGUG GGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAGUACAAGAUCCACGAGGCCCC UUUCGACCUGCUGCUGGAAUGGCUGUACGUGCCCAUCGAUCCUACCUGCCAGC CUAUGCGGCUGUACUCCACCUGUCUGUAUCACCCCAACGCUCCCCAGUGCCUG AGCCACAUGAAUAGCGGCUGCACCUUCACAAGCCCUCACCUGGCUCAGCGAGU GGCCAGCACAGUGUACCAGAAUUGCGAGCACGCCGACAAUUACACCGCCUACU GUCUGGGCAUCAGCCACAUGGAACCUAGCUUCGGCCUGAUCCUGCACGAUGGC GGCACAACCCUGAAGUUCGUGGAUACCCCUGAGAGCCUGAGCGGCCUGUAUGU GUUCGUGGUGUACUUCAACGGCCACGUGGAAGCCGUGGCCUACACCGUGGUGU CUACCGUGGACCACUUCGUGAACGCCAUCGAGGAAAGAGGCUUCCCUCCAACU GCUGGACAGCCUCCUGCCACCACCAAGCCUAAAGAAAUCACACCCGUGAAUCC CGGCACAAGCCCACUGCUUAGAUACGCCGCUUGGACAGGCGGACUGGCUGCUG UUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCUGCACCGCCAAGCGGAUGAGA GUGAAGGCCUACAGAGUGGACAAGAGCCCUUACAACCAGAGCAUGUACUACGC CGGCCUGCCUGUGGACGACUUCGAGGAUAGCGAGAGCACCGACACCGAGGAAG AGUUCGGCAACGCCAUUGGAGGAUCUCACGGCGGCAGCAGCUAUACCGUGUAC AUCGACAAGACCCGGUGAGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUG GGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGBSL-0035-CA 119 AAUAAAGUCUGAGUGGGCGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 5 YK-VZV-002-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCBSL-0035-CA 120 TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTCAGATATGCCTGAGCTGGAGC CTCGGTGGCCATGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCC TGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 6 YK-VZV-002-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTGBSL-0035-CA 121 CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTCAGATATGCCTGA SEQ ID NO: 7 YK-VZV-002-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYA SEQ ID NO: 8 YK-VZV-002-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCUBSL-0035-CA 122 ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUCAGAUAUGCCUGAGC UGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCC UCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCG GCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAA SEQ ID NO: 9 YK-VZV-003-DNABSL-0035-CA 123 AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAABSL-0035-CA 124 TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGAGAGTGAAAGCCTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagccc ctcctccccttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 10 YK-VZV-003-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCABSL-0035-CA 125 CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AAGCCTGA SEQ ID NO: 11 YK-VZV-003-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK A SEQ ID NO: 12 YK-VZV-003-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCUBSL-0035-CA 126 ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGAGAGUGAAAGCCUGAgcUggagccUcggUggccaUgcUUcUU gccccUUgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaaUaaagUcU gagUgggcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAABSL-0035-CA 127 SEQ ID NO: 13 YK-VZV-004-DNA AGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGCCACCATG GGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCATCATCACAG GCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATACGACGACTT CCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCCTACTACCAC AGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGCAGAAAGGCC TACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATGGCTTCCTGG AAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCATCGACAGCG GCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCTGGGAGATG ATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACACAAGATCGT GAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTGAATCCTAA GCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACCCCTTCACA CTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGACATGGTCCTT TCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGCACATTTGCC TGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTGCGCCGAGA ACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGGAAAGAAAG AGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGACGAGCTGG AACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAGAACCGAGA AGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGGCACCTCTAC CTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGAATTACCAC AGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTGCAGTACAA GATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGCCCATCGATC CTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCAACGCTCCC CAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCACCTGGCTC AGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAATTACACCG CCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCTGCACGAT GGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGCCTGTATG TGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGTGGTGTC TACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCAACTGCTBSL-0035-CA 128 GGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATCCCGGCA CAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGTTGTTCT GCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGAAAGCC GCCAGAGTGGACAAGTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagcccctcctccc cttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 14 YK-VZV-004-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCABSL-0035-CA 129 ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AAGCCGCCAGAGTGGACAAGTGA SEQ ID NO: 15 YK-VZV-004-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AARVDK SEQ ID NO: 16 YK-VZV-004-mRNA AGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCA UGGGCACCGUGAACAAGCCUGUUGUGGGCGUGCUGAUGGGCUUCGGCAUCAUC ACAGGCACCCUGCGGAUCACCAAUCCUGUGCGGGCUAGCGUGCUGAGAUACGA CGACUUCCACAUCGACGAGGACAAGCUGGACACCAACAGCGUGUACGAGCCCU ACUACCACAGCGAUCACGCCGAGUCUAGCUGGGUCAACAGAGGCGAGAGCAGC AGAAAGGCCUACGACCACAACAGCCCCUACAUCUGGCCCCGGAACGACUACGA UGGCUUCCUGGAAAAUGCCCACGAGCACCACGGCGUGUACAAUCAAGGCAGAGBSL-0035-CA 130 GCAUCGACAGCGGCGAGAGACUGAUGCAGCCUACACAGAUGAGCGCCCAAGAG GACCUGGGAGAUGAUACCGGCAUCCACGUGAUCCCCACACUGAACGGCGACGA CAGACACAAGAUCGUGAACGUGGACCAGCGGCAGUACGGCGACGUGUUCAAGG GCGACCUGAAUCCUAAGCCUCAGGGCCAGCGCCUGAUCGAGGUGUCCGUGGAA GAGAAUCACCCCUUCACACUGAGAGCCCCUAUCCAGAGAAUCUACGGCGUGCG CUAUACCGAGACAUGGUCCUUUCUGCCCAGCCUGACAUGUACCGGGGAUGCCG CUCCUGCCAUCCAGCACAUUUGCCUGAAGCACACCACCUGUUUCCAGGACGUG GUGGUGGAUGUGGACUGCGCCGAGAACACCAAAGAGGAUCAGCUGGCCGAGA UCAGCUACCGGUUCCAGGGAAAGAAAGAGGCCGACCAGCCUUGGAUCGUGGUC AACACCAGCACACUGUUCGACGAGCUGGAACUGGACCCUCCUGAGAUUGAACC CGGGGUGCUGAAGGUGCUGAGAACCGAGAAGCAGUACCUGGGAGUGUACAUC UGGAACAUGAGAGGCAGCGACGGCACCUCUACCUACGCCACCUUUCUGGUCAC AUGGAAGGGCGACGAGAAAACACGGAACCCCACACCAGCUGUGACCCCUCAAC CUAGAGGCGCCGAGUUUCACAUGUGGAAUUACCACAGCCACGUGUUCAGCGUG GGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAGUACAAGAUCCACGAGGCCCC UUUCGACCUGCUGCUGGAAUGGCUGUACGUGCCCAUCGAUCCUACCUGCCAGC CUAUGCGGCUGUACUCCACCUGUCUGUAUCACCCCAACGCUCCCCAGUGCCUG AGCCACAUGAAUAGCGGCUGCACCUUCACAAGCCCUCACCUGGCUCAGCGAGU GGCCAGCACAGUGUACCAGAAUUGCGAGCACGCCGACAAUUACACCGCCUACU GUCUGGGCAUCAGCCACAUGGAACCUAGCUUCGGCCUGAUCCUGCACGAUGGC GGCACAACCCUGAAGUUCGUGGAUACCCCUGAGAGCCUGAGCGGCCUGUAUGU GUUCGUGGUGUACUUCAACGGCCACGUGGAAGCCGUGGCCUACACCGUGGUGU CUACCGUGGACCACUUCGUGAACGCCAUCGAGGAAAGAGGCUUCCCUCCAACU GCUGGACAGCCUCCUGCCACCACCAAGCCUAAAGAAAUCACACCCGUGAAUCC CGGCACAAGCCCACUGCUUAGAUACGCCGCUUGGACAGGCGGACUGGCUGCUG UUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCUGCACCGCCAAGCGGAUGAGA GUGAAAGCCGCCAGAGUGGACAAGUGAgcUggagccUcggUggccaUgcUUcUUgccccU UgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaaUaaagUcUgagUgg gcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABSL-0035-CA 131 AAAAAAAAAA SEQ ID NO: 17 YK-VZV-006-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCBSL-0035-CA 132 CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGAGAGTGAAGGCCGCGAGAGTGGACAAGAGCCCTTACAACCAGAGCA TGTACTACGCCGGCCTGCCTGTGGACGATTTCGAGGATGCTGAAGCCGCCGATGC CGAGGAAGAGTTTGGCAACGCCATTGGCGGATCTCACGGCGGCAGCAGCTATACC GTGTACATCGACAAGACCCGGTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagcc cctcctccccttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 18 YK-VZV-006-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGGBSL-0035-CA 133 AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AGGCCGCGAGAGTGGACAAGAGCCCTTACAACCAGAGCATGTACTACGCCGGCC TGCCTGTGGACGATTTCGAGGATGCTGAAGCCGCCGATGCCGAGGAAGAGTTTGG CAACGCCATTGGCGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAG ACCCGGTGA SEQ ID NO: 19 YK-VZV-006-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AARVDKSPYNQSMYYAGLPVDDFEDAEAADAEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 20 YK-VZV-006-mRNABSL-0035-CA 134 AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGGBSL-0035-CA 135 AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGAGAGUGAAGGCCGCUAGAGUGGACAAGAGCCCUUAC AACCAGAGCAUGUACUACGCCGGCCUGCCUGUGGACGAUUUCGAGGAUGCUGA AGCCGCCGAUGCCGAGGAAGAGUUUGGCAACGCCAUUGGCGGAUCUCACGGCG GCAGCAGCUAUACCGUGUACAUCGACAAGACCCGGUGAgcUggagccUcggUggccaU gcUUcUUgccccUUgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaa UaaagUcUgagUgggcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAA SEQ ID NO: 21 YK-VZV-007-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGBSL-0035-CA 136 AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGAGAGTGAAGGCCTACAGAGTGGACAAGAGCCCTTACAACCAGTCTAT GTATGCCGCCGGACTGCCCGTGGACGATTTTGAGGATGCTGAAGCCGCCGACGCC GAGGAAGAATTTGGCAACGCCATTGGCGGAAGCCACGGCGGCAGTAGCTATACCG TGTACATCGACAAGACCCGGTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagccc ctcctccccttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 22 YK-VZV-007-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACACBSL-0035-CA 137 AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AGGCCTACAGAGTGGACAAGAGCCCTTACAACCAGTCTATGTATGCCGCCGGACT GCCCGTGGACGATTTTGAGGATGCTGAAGCCGCCGACGCCGAGGAAGAATTTGGC AACGCCATTGGCGGAAGCCACGGCGGCAGTAGCTATACCGTGTACATCGACAAGA CCCGGTGA SEQ ID NO: 23 YK-VZV-007-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGIBSL-0035-CA 138 DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AYRVDKSPYNQSMYAAGLPVDDFEDAEAADAEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 24 YK-VZV-007-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCACBSL-0035-CA 139 ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGAGAGUGAAGGCCUACAGAGUGGACAAGAGCCCUUAC AACCAGUCUAUGUAUGCCGCCGGACUGCCCGUGGACGAUUUUGAGGAUGCUGA AGCCGCCGACGCCGAGGAAGAAUUUGGCAACGCCAUUGGCGGAAGCCACGGCG GCAGUAGCUAUACCGUGUACAUCGACAAGACCCGGUGAgcUggagccUcggUggccaU gcUUcUUgccccUUgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaa UaaagUcUgagUgggcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAA SEQ ID NO: 25 YK-VZV-009-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGBSL-0035-CA 140 CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGAGAGTGAAGGCCAAGAGAGTGGACAAGAGCCCTTACAACCAGTCTA TGTATGCCGCCGGACTGCCCGTGGACGATTTCGAGGATAGCGAGAGCACCGACAC CGAGGAAGAGTTCGGCAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACC GTGTACATCGACAAGACCCGGTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagcc cctcctccccttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABSL-0035-CA 141 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 26 YK-VZV-009-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCABSL-0035-CA 142 ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AGGCCAAGAGAGTGGACAAGAGCCCTTACAACCAGTCTATGTATGCCGCCGGACT GCCCGTGGACGATTTCGAGGATAGCGAGAGCACCGACACCGAGGAAGAGTTCGG CAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAG ACCCGGTGA SEQ ID NO: 27 YK-VZV-009-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AKRVDKSPYNQSMYAAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 28 YK-VZV-009-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGCBSL-0035-CA 143 AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGAGAGUGAAGGCCAAGAGAGUGGACAAGAGCCCUUAC AACCAGUCUAUGUAUGCCGCCGGACUGCCCGUGGACGAUUUCGAGGAUAGCGA GAGCACCGACACCGAGGAAGAGUUCGGCAACGCCAUUGGAGGAUCUCACGGCG GCAGCAGCUAUACCGUGUACAUCGACAAGACCCGGUGAgcUggagccUcggUggccaU gcUUcUUgccccUUgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaa UaaagUcUgagUgggcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABSL-0035-CA 144 AAAAAAAAAAAAAAAAAAAA SEQ ID NO: 29 YK-VZV-010-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCBSL-0035-CA 145 CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGAGAGTGAAGGCCAAGAGAGTGGACAAGAGCCCTTACAACCAGTCTA TGTATGCCGCCGGACTGCCCGTGGACGATTTTGAGGATGCTGAAGCCGCCGACGC CGAGGAAGAATTTGGCAACGCCATTGGCGGAAGCCACGGCGGCAGTAGCTATACC GTGTACATCGACAAGACCCGGTGAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCC CTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTT TGAATAAAGTCTGAGTGGGCGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 30 YK-VZV-010-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGGBSL-0035-CA 146 CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGA AGGCCAAGAGAGTGGACAAGAGCCCTTACAACCAGTCTATGTATGCCGCCGGACT GCCCGTGGACGATTTTGAGGATGCTGAAGCCGCCGACGCCGAGGAAGAATTTGGC AACGCCATTGGCGGAAGCCACGGCGGCAGTAGCTATACCGTGTACATCGACAAGA CCCGGTGA SEQ ID NO: 31 YK-VZV-010-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK AKRVDKSPYNQSMYAAGLPVDDFEDAEAADAEEEFGNAIGGSHGGSSYTVYIDKTRBSL-0035-CA 147 SEQ ID NO: 32 YK-VZV-010-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGCBSL-0035-CA 148 CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGAGAGUGAAGGCCAAGAGAGUGGACAAGAGCCCUUAC AACCAGUCUAUGUAUGCCGCCGGACUGCCCGUGGACGAUUUUGAGGAUGCUGA AGCCGCCGACGCCGAGGAAGAAUUUGGCAACGCCAUUGGCGGAAGCCACGGCG GCAGUAGCUAUACCGUGUACAUCGACAAGACCCGGUGAGCUGGAGCCUCGGUG GCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCAC CCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 33 YK-VZV-011-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTBSL-0035-CA 149 GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGCGCGTGAAGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGAGCA TGTACTACGCCGGCCTGCCTGTGGACGACTTCGAGGATAGCGAGAGCACCGACAC CGAGGAAGAGTTCGGCAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACC GTGTACATCGACAAGACCCGGTGAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCC CTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTT TGAATAAAGTCTGAGTGGGCGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 34 YK-VZV-011-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCATBSL-0035-CA 150 CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGCGCGTGA AGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGAGCATGTACTACGCCGGCC TGCCTGTGGACGACTTCGAGGATAGCGAGAGCACCGACACCGAGGAAGAGTTCG GCAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAA GACCCGGTGA SEQ ID NO: 35 YK-VZV-011-ORF-AABSL-0035-CA 151 MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK DKEKDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 36 YK-VZV-011-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGCBSL-0035-CA 152 AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGCGCGUGAAGGACAAAGAGAAGGACAAGUCCCCUUAC AACCAGAGCAUGUACUACGCCGGCCUGCCUGUGGACGACUUCGAGGAUAGCGA GAGCACCGACACCGAGGAAGAGUUCGGCAACGCCAUUGGAGGAUCUCACGGCG GCAGCAGCUAUACCGUGUACAUCGACAAGACCCGGUGAGCUGGAGCCUCGGUG GCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCAC CCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGCAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 37 YK-VZV-012-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGBSL-0035-CA 153 AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGC TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGCGCGTGAAGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGAGCA TGTACTACGCCGGCCTGCCTGTGGACGATTTCGAGGATGCTGAAGCCGCCGATGC CGAGGAAGAGTTTGGCAACGCCATTGGCGGATCTCACGGCGGCAGCAGCTATACC GTGTACATCGACAAGACCCGGTGAgctggagcctcggtggccatgcttcttgccccttgggcctccccccagccBSL-0035-CA 154 cctcctccccttcctgcacccgtacccccgtggtctttgaataaagtctgagtgggcggcAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 38 YK-VZV-012-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGA CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGCBSL-0035-CA 155 CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGCGCGTGA AGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGAGCATGTACTACGCCGGCC TGCCTGTGGACGATTTCGAGGATGCTGAAGCCGCCGATGCCGAGGAAGAGTTTGG CAACGCCATTGGCGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAG ACCCGGTGA SEQ ID NO: 39 YK-VZV-012-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERG FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK DKEKDKSPYNQSMYYAGLPVDDFEDAEAADAEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 40 YK-VZV-012-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCUBSL-0035-CA 156 ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCG GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAUCGAGG AAAGAGGCUUCCCUCCAACUGCUGGACAGCCUCCUGCCACCACCAAGCCUAAA GAAAUCACACCCGUGAAUCCCGGCACAAGCCCACUGCUUAGAUACGCCGCUUG GACAGGCGGACUGGCUGCUGUUGUUCUGCUGUGCCUGGUCAUCUUCCUGAUCU GCACCGCCAAGCGGAUGCGCGUGAAGGACAAAGAGAAGGACAAGUCCCCUUAC AACCAGAGCAUGUACUACGCCGGCCUGCCUGUGGACGAUUUCGAGGAUGCUGA AGCCGCCGAUGCCGAGGAAGAGUUUGGCAACGCCAUUGGCGGAUCUCACGGCG GCAGCAGCUAUACCGUGUACAUCGACAAGACCCGGUGAgcUggagccUcggUggccaU gcUUcUUgccccUUgggccUccccccagccccUccUccccUUccUgcacccgUacccccgUggUcUUUgaaBSL-0035-CA 157 UaaagUcUgagUgggcggcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAA SEQ ID NO: 41 YK-VZV-013-DNA AGACTCCTCCCCATCCTCTCCCTCTGTCCCTCTGTCCCTCTGACCCTGCAC TGTCCCAGCACCGCCACCATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGA TGGGCTTCGGCATCATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAG CGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAG CGTGTACGAGCCCTACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGA GGCGAGAGCAGCAGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGG AACGACTACGATGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATC AAGGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCG CCCAAGAGGACCTGGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGG CGACGACAGACACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTT CAAGGGCGACCTGAATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTG GAAGAGAATCACCCCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGC GCTATACCGAGACATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCT CCTGCCATCCAGCACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGG TGGATGTGGACTGCGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCT ACCGGTTCCAGGGAAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCA GCACACTGTTCGACGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCT GAAGGTGCTGAGAACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAG AGGCAGCGACGGCACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGAC GAGAAAACACGGAACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAG TTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCT GGCCATGCATCTGCAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAAT GGCTGTACGTGCCCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGT CTGTATCACCCCAACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTT CACAAGCCCTCACCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGA GCACGCCGACAATTACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCBSL-0035-CA 158 TTCGGCCTGATCCTGCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTG AGAGCCTGAGCGGCCTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGC CGTGGCCTACACCGTGGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAA AGAGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAA TCACACCCGTGAATCCCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGG CGGACTGGCTGCTGTTGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCA AGCGGATGCGCGTGAAGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGTCTA TGTATGCCGCCGGACTGCCCGTGGACGATTTCGAGGATAGCGAGAGCACCGACAC CGAGGAAGAGTTCGGCAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACC GTGTACATCGACAAGACCCGGTGAGCTGGAGCCTCGGTGGCCATGCTTCTTGCCC CTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTT TGAATAAAGTCTGAGTGGGCGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 42 YK-VZV-013-ORF-NT ATGGGCACCGTGAACAAGCCTGTTGTGGGCGTGCTGATGGGCTTCGGCAT CATCACAGGCACCCTGCGGATCACCAATCCTGTGCGGGCTAGCGTGCTGAGATAC GACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAGCCC TACTACCACAGCGATCACGCCGAGTCTAGCTGGGTCAACAGAGGCGAGAGCAGC AGAAAGGCCTACGACCACAACAGCCCCTACATCTGGCCCCGGAACGACTACGATG GCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAATCAAGGCAGAGGCAT CGACAGCGGCGAGAGACTGATGCAGCCTACACAGATGAGCGCCCAAGAGGACCT GGGAGATGATACCGGCATCCACGTGATCCCCACACTGAACGGCGACGACAGACAC AAGATCGTGAACGTGGACCAGCGGCAGTACGGCGACGTGTTCAAGGGCGACCTG AATCCTAAGCCTCAGGGCCAGCGCCTGATCGAGGTGTCCGTGGAAGAGAATCACC CCTTCACACTGAGAGCCCCTATCCAGAGAATCTACGGCGTGCGCTATACCGAGAC ATGGTCCTTTCTGCCCAGCCTGACATGTACCGGGGATGCCGCTCCTGCCATCCAGC ACATTTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGATGTGGACTG CGCCGAGAACACCAAAGAGGATCAGCTGGCCGAGATCAGCTACCGGTTCCAGGG AAAGAAAGAGGCCGACCAGCCTTGGATCGTGGTCAACACCAGCACACTGTTCGABSL-0035-CA 159 CGAGCTGGAACTGGACCCTCCTGAGATTGAACCCGGGGTGCTGAAGGTGCTGAG AACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGAGAGGCAGCGACGG CACCTCTACCTACGCCACCTTTCTGGTCACATGGAAGGGCGACGAGAAAACACGG AACCCCACACCAGCTGTGACCCCTCAACCTAGAGGCGCCGAGTTTCACATGTGGA ATTACCACAGCCACGTGTTCAGCGTGGGCGATACCTTTAGCCTGGCCATGCATCTG CAGTACAAGATCCACGAGGCCCCTTTCGACCTGCTGCTGGAATGGCTGTACGTGC CCATCGATCCTACCTGCCAGCCTATGCGGCTGTACTCCACCTGTCTGTATCACCCCA ACGCTCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACAAGCCCTCA CCTGGCTCAGCGAGTGGCCAGCACAGTGTACCAGAATTGCGAGCACGCCGACAAT TACACCGCCTACTGTCTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCT GCACGATGGCGGCACAACCCTGAAGTTCGTGGATACCCCTGAGAGCCTGAGCGGC CTGTATGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGT GGTGTCTACCGTGGACCACTTCGTGAACGCCATCGAGGAAAGAGGCTTCCCTCCA ACTGCTGGACAGCCTCCTGCCACCACCAAGCCTAAAGAAATCACACCCGTGAATC CCGGCACAAGCCCACTGCTTAGATACGCCGCTTGGACAGGCGGACTGGCTGCTGT TGTTCTGCTGTGCCTGGTCATCTTCCTGATCTGCACCGCCAAGCGGATGCGCGTGA AGGACAAAGAGAAGGACAAGTCCCCTTACAACCAGTCTATGTATGCCGCCGGACT GCCCGTGGACGATTTCGAGGATAGCGAGAGCACCGACACCGAGGAAGAGTTCGG CAACGCCATTGGAGGATCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAG ACCCGGTGA SEQ ID NO: 43 YK-VZV-013-ORF-AA MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYE PYYHSDHAESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNP KPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKH TTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPE IEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPR GAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLY STCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEP SFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGBSL-0035-CA 160 FPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLAAVVLLCLVIFLICTAKRMRVK DKEKDKSPYNQSMYAAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 44 YK-VZV-013-mRNA AGACUCCUCCCCAUCCUCUCCCUCUGUCCCUCUGUCCCUCUGACCCUGC ACUGUCCCAGCACCGCCACCAUGGGCACCGUGAACAAGCCUGUUGUGGGCGUG CUGAUGGGCUUCGGCAUCAUCACAGGCACCCUGCGGAUCACCAAUCCUGUGCG GGCUAGCGUGCUGAGAUACGACGACUUCCACAUCGACGAGGACAAGCUGGACA CCAACAGCGUGUACGAGCCCUACUACCACAGCGAUCACGCCGAGUCUAGCUGG GUCAACAGAGGCGAGAGCAGCAGAAAGGCCUACGACCACAACAGCCCCUACAU CUGGCCCCGGAACGACUACGAUGGCUUCCUGGAAAAUGCCCACGAGCACCACG GCGUGUACAAUCAAGGCAGAGGCAUCGACAGCGGCGAGAGACUGAUGCAGCCU ACACAGAUGAGCGCCCAAGAGGACCUGGGAGAUGAUACCGGCAUCCACGUGAU CCCCACACUGAACGGCGACGACAGACACAAGAUCGUGAACGUGGACCAGCGGC AGUACGGCGACGUGUUCAAGGGCGACCUGAAUCCUAAGCCUCAGGGCCAGCGC CUGAUCGAGGUGUCCGUGGAAGAGAAUCACCCCUUCACACUGAGAGCCCCUAU CCAGAGAAUCUACGGCGUGCGCUAUACCGAGACAUGGUCCUUUCUGCCCAGCC UGACAUGUACCGGGGAUGCCGCUCCUGCCAUCCAGCACAUUUGCCUGAAGCAC ACCACCUGUUUCCAGGACGUGGUGGUGGAUGUGGACUGCGCCGAGAACACCAA AGAGGAUCAGCUGGCCGAGAUCAGCUACCGGUUCCAGGGAAAGAAAGAGGCC GACCAGCCUUGGAUCGUGGUCAACACCAGCACACUGUUCGACGAGCUGGAACU GGACCCUCCUGAGAUUGAACCCGGGGUGCUGAAGGUGCUGAGAACCGAGAAGC AGUACCUGGGAGUGUACAUCUGGAACAUGAGAGGCAGCGACGGCACCUCUACC UACGCCACCUUUCUGGUCACAUGGAAGGGCGACGAGAAAACACGGAACCCCAC ACCAGCUGUGACCCCUCAACCUAGAGGCGCCGAGUUUCACAUGUGGAAUUACC ACAGCCACGUGUUCAGCGUGGGCGAUACCUUUAGCCUGGCCAUGCAUCUGCAG UACAAGAUCCACGAGGCCCCUUUCGACCUGCUGCUGGAAUGGCUGUACGUGCC CAUCGAUCCUACCUGCCAGCCUAUGCGGCUGUACUCCACCUGUCUGUAUCACC CCAACGCUCCCCAGUGCCUGAGCCACAUGAAUAGCGGCUGCACCUUCACAAGC CCUCACCUGGCUCAGCGAGUGGCCAGCACAGUGUACCAGAAUUGCGAGCACGC CGACAAUUACACCGCCUACUGUCUGGGCAUCAGCCACAUGGAACCUAGCUUCGBSL-0035-CA 161 GCCUGAUCCUGCACGAUGGCGGCACAACCCUGAAGUUCGUGGAUACCCCUGAG AGCCUGAGCGGCCUGUAUGUGUUCGUGGUGUACUUCAACGGCCACGUGGAAGC CGUGGCCUACACCGUGGUGUCUACCGUGGACCACUUCGUGAACGCCAU...
Claims
BSL-0035-CA 296 What is claimed is:
1. An immunogenic composition, comprising a ribonucleic acid (RNA) of a varicellazoster virus (VZV) encoding a wild-type VZV gE glycoprotein or a variant thereof; wherein the sequence of the wild-type VZV gE glycoprotein is SEQ ID NO: 3; wherein the variant of the VZV gE glycoprotein is the variant selected from: YK-VZV- 020, YK-VZV-030, YK-VZV-031, YK-VZV-009, YK-VZV-010, YK-VZV-011, YK-VZV-012, YK-VZV-013 and YK-VZV-014, Name Sequence truncation Site mutation Sequence deletion YK-VZV-020 gE (1 to 573) Y569K No sequence deletion YK-VZV-030 gE (1 to 587) A568D; Y569K; R570E; V571K; Y582A No sequence deletion YK-VZV-031 gE (1 to 587) A568D; Y569K; R570E; V571K; Y582G No sequence deletion YK-VZV-009 No sequence truncation Y569K; Y582A No sequence deletion YK-VZV-010 No sequence truncation Y569K; Y582A; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-011 No sequence truncation A568D; Y569K; R570E; V571K No sequence deletion YK-VZV-012 No sequence truncation A568D; Y569K; R570E; V571K; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-013 No sequence truncation A568D; Y569K; R570E; V571K; Y582A No sequence deletion YK-VZV-014 No sequence truncation A568D; Y569K; R570E; V571K; Y582A; S593A; S595A; T596A; T598A No sequence deletion .
2. The composition according to claim 1, wherein the variant of the VZV gE glycoprotein is the variant selected from: YK-VZV-020, YK-VZV-010, YK-VZV-011 and YK-VZV-013, Name Sequence truncation Site mutation Sequence deletion YK-VZV-020 gE (1 to 573) Y569K No sequence deletion YK-VZV-010 No sequence truncation Y569K; Y582A; S593A; S595A; T596A; T598A No sequence deletion YK-VZV-011 No sequence A568D; Y569K; R570E; No sequence deletionBSL-0035-CA 297 truncation V571K YK-VZV-013 No sequence truncation A568D; Y569K; R570E; V571K; Y582A No sequence deletion ; or, the amino acid sequence of the variant of the VZV gE glycoprotein is as shown in SEQ ID NO: 27, 31, 35, 39, 43, 47, 71, 111, or 115; or, the RNA of the VZV further comprises a 5′ untranslated region (UTR), preferably the sequence of the 5′ UTR is as shown in SEQ ID NO: 173, 174, 175, 176, or 177; or, the RNA of the VZV further comprises a 3′ untranslated region (UTR), preferably the sequence of the 3′ UTR is as shown in SEQ ID NO: 178, 179, 180, or 181; or, the RNA of the VZV further comprises a poly(A) tail, preferably the poly(A) tail has a length of 50 to 150 nucleotides; or, the RNA of the VZV further comprises a 5′ terminal cap, preferably the 5′ terminal cap is 7mG(5′)ppp(5′)NlmpNp; or, the sequence of the RNA of the VZV is as shown in SEQ ID NO: 28, 32, 36, 40, 44, 48, 72, 112, or 116; or, the RNA of the VZV is mRNA; or, the sequence of the RNA encoding the VZV gE glycoprotein corresponding to a DNA sequence shown in SEQ ID NO: 25, 29, 33, 37, 41, 45,69, 109, or 113.
3. The composition according to claim 1, wherein the RNA of the VZV has an open reading frame (ORF) encoding a VZV gE glycoprotein, the sequence of the open reading frameBSL-0035-CA 298 is as shown in SEQ ID NO: 26,30, 34, 38, 42, 46, 70, 110 or 114.
4. The composition according to claim 3, wherein the sequence of the open reading frame is codon-optimized.
5. The composition according to claim 4, wherein the sequence of the open reading frame comprises at least one base modification; preferably, the base modification is selected from one or more of the following: pseudouridine, N1-methylpseudouridine, N1-ethylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2- thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine, and 2′-Omethyluridine; more preferably, the base modification is replacement of uracil by pseudouridine and / or N1-methylpseudouridine.
6. The composition according to claim 5, wherein the base modification is 1 to 100% base modification; preferably, the base modification is 100% base modification.
7. A method for preparing the composition as defined in any one of claims 1 to 6, comprising: providing a template that can transcribe the RNA of the VZV; transcribing the RNA using the template under conditions suitable for transcription; preferably, further comprising a purification step selected from: lithium chloride precipitation, affinity chromatography, ultrafiltration exchange, and cellulose chromatography.
8. The composition according to claim 1, wherein the composition is a vaccine, and further comprises a pharmaceutically acceptable carrier.BSL-0035-CA 299 9. The composition according to claim 8, wherein the carrier comprises a lipid mixture; preferably, the lipid mixture is a lipid nanoparticle (LNP).
10. The composition according to claim 8 or 9, wherein the vaccine is an mRNA vaccine.
11. The composition according to claim 10, wherein the lipid nanoparticle (LNP) comprises a cationic lipid, a neutral lipid, a structural lipid, and a polymer-conjugated lipid.
12. The composition according to claim 11, wherein the cationic lipid is selected from: YK-009, YK-401, YK-305, ALC0315, SM102 and DLIN-MC3-DMA: o YK-009 YK-401BSL-0035-CA 300 ALC0315 SM102 DLIN-MC3 ; or, the molar ratio of the cationic lipid to the neutral lipid is (1 to 10):1; or, the molar ratio of the cationic lipid to the structural lipid is (1 to 5):1; or, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (25 to 75):(5 to 25):(15 to 65):(0.5 to 10); preferably, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is (35 to 49):(7.5 to 15):(35 to 55):(1 to 5); more preferably, the molar ratio of the cationic lipid, the neutral lipid, the structural lipid, and the polymer-conjugated lipid is 49:10:43.5:1.5; or, the neutral lipid is selected from phosphatidylcholine, phosphatidylethanolamine, sphingomyelin, ceramide, derivatives thereof, and any combination thereof; or, the neutral lipid is selected from: 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),BSL-0035-CA 301 1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3- phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2- distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-diundecanoyl-sn-glycerophosphocholine (DUPC), 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-diO-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1-oleoyl-2- cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC), 1-hexadecyl-snglycero-3-phosphocholine (C16 Lyso PC), 1,2-dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3- phosphocholine, 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-diphytanoylsn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3- phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinolenoylsn-glycero-3-phosphoethanolamine, 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3- phospho-rac-(1-glycerol) sodium salt (DOPG), dipalmitoyl phosphatidylglycerol (DPPG), palmitoyl oleoyl phosphatidylethanolamine (POPE), distearoyl-phosphatidyl-ethanolamine (DSPE), dipalmitoyl phosphatidylethanolamine (DPPE), dimyristoyl phosphoethanolamine (DMPE), 1-stearoyl-2-oleoyl-stearoylethanolamine (SOPE), 1-stearoyl-2-oleoylphosphatidylcholine (SOPC), sphingomyelin, phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, palmitoyl oleoyl phosphatidylcholine, lysophosphatidylcholine, lysophosphatidylethanolamine (LPE), and mixtures thereof; or, the neutral lipid is DOPE and / or DSPC; or, the structural lipid is selected from: sterol, cholesterol, nonsterol, sitosterol, ergosterol, campesterol, stigmasterol, brassinosterol, tomatine, ursolic acid, α-tocopherol, corticosteroid, and any combination thereof; preferably, the structural lipid comprises cholesterol; more preferably, the structural lipid is cholesterol; or, the polymer-conjugated lipid is selected from: PEG-modified phosphatidylethanolamine, PEG-modified phosphatidic acid, PEG-modified ceramide, PEG-modified dialkylamine, PEG-modified diacylglycerol, PEG-modified dialkylglycerol, and any combination thereof; preferably, the polymer-conjugated lipid is selected from: distearoylBSL-0035-CA 302 phosphatidylethanolamine polyethylene glycol 2000 (DSPE-PEG2000), dimyristoylglycero- 3-methoxypolyethylene glycol 2000 (DMG-PEG2000), methoxypolyethylene glycol ditetradecylacetamide (ALC-0159), and any combination thereof.
13. The composition according to claim 8, wherein the RNA of the VZV has an effective dose of 25 μg to 200 μg; preferably the VZV has an effective dose of 50 μg to 100 μg; or, the vaccine is an injection, preferably the vaccine is a liquid preparation or a lyophilized preparation.
14. A method for preparing the composition as defined in any one of claims 8 to 13, comprising: mixing the RNA of the VZV with the pharmaceutically acceptable carrier; preferably, the method comprises encapsulating at least a portion of the RNA in lipid nanoparticles.
15. A use of the composition as defined in any one of claims 1 to 6, 8 to 13 in the preparation of a medicament for inducing a protective immune response against VZV in a subject; preferably, the protective immune response comprises the production of a neutralizing antibody.
16. The composition as defined in claim 1, for use in inducing a protective immune response against VZV in a subject in need thereof; preferably, the protective immune response comprises the production of a neutralizing antibody.