Cosmetic composition comprising endolysin and hydrophobic silica aerogel particles

Abstract

Cosmetic compositions comprising endolysins and hydrophobic silica aerogel particles are disclosed. The invention relates to a composition, in particular a cosmetic composition, comprising in a physiologically acceptable medium at least one endolysin, in particular an endolysin derived from a Staphylococcus aureus bacteriophage, and at least hydrophobic silica aerogel particles. The invention also relates to the use of such a composition for preventing and / or treating a skin disorder associated with colonization by Staphylococcus aureus, in particular for preventing and / or treating acne and / or eczema in an individual in need thereof, and to a non-therapeutic cosmetic process for caring for keratin materials, in particular the skin, comprising at least one step of topical application to said keratin materials of such a composition.

Description

Technical Field

[0001] This invention relates to a composition, particularly a cosmetic composition, comprising, in a physiologically acceptable medium, at least one endolysin, particularly an endolysin derived from Staphylococcus aureus bacteriophage, and at least hydrophobic silica aerogel particles.

[0002] The present invention also particularly relates to the use of the compositions of the invention for the prevention and / or treatment of skin diseases associated with Staphylococcus aureus colonization in individuals in need, particularly for the prevention and / or treatment of acne and / or eczema in individuals in need.

[0003] Finally, the present invention relates to a non-therapeutic cosmetic method for caring for keratin materials, particularly skin, comprising topically applying a composition according to the invention to these keratin materials. Background Technology

[0004] Human skin is permanently home to a variety of different microorganisms (bacteria, yeasts, and fungi). The resident microbiota, which is essential for good skin health, mainly consists of Propionibacterium acnes (Propionibacterium acnes), Staphylococcus (Staphylococcus epidermidis and Staphylococcus hominis), Corynebacteria and Streptococcus, as well as a fungal community mainly composed of Malassezia.

[0005] Some skin conditions are often caused by a disruption of the ecological balance of the resident flora after the dominant colonization of opportunistic microorganisms that are not beneficial to the skin, such as Staphylococcus aureus. These opportunistic microorganisms are known to be associated with atopic dermatitis (eczema), oily or seborrheic skin, and acne.

[0006] To counteract this over-colonization of these unhelpful micro-opportunists, a common practice is to use broad-spectrum antimicrobial agents or bacteriostatic agents. However, the use of these compounds introduces problems such as non-specific targeting of both unwanted opportunistic bacteria and resident beneficial bacteria, the risk of bacterial resistance or imbalance due to selection against resistant bacteria, and skin tolerance issues (irritation, allergies, etc.).

[0007] Therefore, there is a need to find novel compounds that possess good antimicrobial efficacy, do not have the aforementioned drawbacks, and have good skin tolerance.

[0008] Therefore, it has been demonstrated that endolysins derived from anti-Staphylococcus phages (i.e., phages infecting Staphylococcus aureus) can specifically target and lyse (and thus specifically destroy) Staphylococcus aureus while preserving the resident skin flora (WO 2012 / 150858). However, it is well known that one of the major obstacles to the application of endolysins targeting Staphylococcus species is the stability of these proteins and / or their enzymatic activities (especially the maintenance of this activity over time).

[0009] In fact, it has been observed that, particularly when endosomalins are introduced into formulations (especially cosmetic formulations), the cleavage of these enzymes is significantly impaired due to their interaction with the raw materials.

[0010] Therefore, there is a need for raw materials that possess a variety of cosmetic properties (such as filler and sebum absorbent properties) and can be used in compositions, especially cosmetic compositions, without reducing the antimicrobial activity of endosomalins also present in these compositions.

[0011] In addition, there is a need for raw materials that possess a variety of cosmetic properties (such as fillers and sebum absorbers) and can be used in compositions, especially cosmetic compositions, without reducing (i) the antimicrobial activity of the endosomalin used, and (ii) the specificity of these endosomalins against target bacteria (especially Staphylococcus aureus in this invention).

[0012] We also need raw materials that possess various cosmetic properties (such as fillers and sebum absorbers) and can be used in compositions, especially cosmetic compositions:

[0013] - without reducing the antimicrobial activity of the endolysin used;

[0014] - Simultaneously maintaining the specificity of these endolysins for target bacteria (particularly Staphylococcus aureus in this invention); and

[0015] - At the same time, it provides the composition with good sensory properties. Summary of the Invention

[0016] The purpose of this invention is to solve at least one of the aforementioned technical problems.

[0017] In particular, the inventors have now discovered that hydrophobic silica aerogel particles have been shown to maintain the good Staphylococcus aureus killing properties of the associated endolysin even one week or six months after composition preparation. Invention Overview

[0018] As mentioned above, the present invention therefore relates to a composition, particularly a cosmetic composition, comprising, in a physiologically acceptable medium:

[0019] (i) at least one endolysin, particularly an endolysin derived from Staphylococcus aureus bacteriophages; and

[0020] (ii) At least hydrophobic silica aerogel particles.

[0021] As illustrated in the examples below, the applicant unexpectedly discovered that the composition according to the invention, comprising endolysin derived from Staphylococcus aureus phage and at least hydrophobic silica aerogel particles, advantageously enables the maintenance of the endolysin's Staphylococcus aureus-killing properties even after six months.

[0022] Therefore, the present invention also relates to the use of the compositions of the invention for the prevention and / or treatment of skin diseases associated with Staphylococcus aureus colonization in individuals in need, particularly for the prevention and / or treatment of acne and / or eczema in individuals in need.

[0023] Furthermore, the present invention relates to a non-therapeutic cosmetic method for caring for keratin materials, particularly skin, comprising topically applying a composition according to the invention to these keratin materials. Detailed Implementation

[0024] The term "cosmetics" refers to compositions compatible with keratinous materials, particularly skin, mucous membranes, and the epidermis. The compositions according to the invention are non-therapeutic.

[0025] The term "keratin material" specifically refers to skin, mucous membranes, fibers, eyelashes, and skin appendages.

[0026] The term “skin” means all the skin of the body, and preferably the skin of the face, scalp, collar, neck, arms and forearms, eyelids, around the mouth or behind the ears, elbow crease, back of the knee, hands, wrists and ankles, or even more preferably the skin of the face (especially the forehead, nose, cheeks and chin), collar and neck.

[0027] The compositions according to the invention comprise a physiologically acceptable medium, i.e., a medium having a pleasant color, odor, and feel and not producing any unacceptable discomfort (i.e., stinging, tightness, or redness) that would easily prevent the user from applying the composition. Needless to say, those skilled in the art will carefully select a physiologically acceptable medium such that the advantageous properties of the endolysin of the invention are not adversely affected, or are substantially not adversely affected. Thus, for example, a physiologically acceptable medium may consist primarily of water and / or one or more water-miscible solvents. A physiologically acceptable medium according to the invention more particularly has a pH of 4 to 8, more particularly 4.5 to 7.5. Therefore, the compositions according to the invention may comprise one or more pH adjusters, such as arginine.

[0028] As used herein, the term “treat / treatment” is intended to indicate the relief and / or elimination of symptoms associated with a particular disorder or condition, and the complete disappearance of the disorder or condition in question.

[0029] In the context of this invention, the term "prevent / prevention" indicates that the risk or probability of a given phenomenon occurring has been reduced to a lesser extent.

[0030] endolysin

[0031] The compositions according to the invention, especially cosmetic compositions, are primarily characterized by containing at least one endolytic agent.

[0032] In the embodiments described herein, the endolysin may be a natural phage endolysin or a recombinant endolysin, and may be any endolysin known to those skilled in the art. As used herein, the terms phage endolysin, phage endolysin, and endolysin are used interchangeably. Endolysins can be selected from the following group: endolysins as defined in documents WO 2011 / 023702, WO 2012 / 146738, WO 2003 / 082184, WO 2010 / 011960, WO 2010 / 149795, WO 2010 / 149792, WO 2012 / 094004, WO2011 / 023702, WO 2011 / 065854, WO 2011 / 076432, WO 2011 / 134998, WO 2012 / 059545, WO2012 / 085259, WO 2012 / 146738, and WO 2018 / 091707, Exebacase™ (Lysin CF-301); SAL200™ or Tonabacase; Auresine™ (Sigma-Aldrich SAE0083) and Ectolysin™ P128 (these patents are incorporated herein by reference in their entirety).

[0033] In the embodiments presented herein, the endolysin is a Staphylococcus aureus-specific endolysin, meaning it will effectively lyse Staphylococcus aureus but will not substantially lyse bacteria other than Staphylococcus aureus. Specifically, the endolysin used according to the present invention will lyse Staphylococcus aureus but will not lyse Staphylococcus epidermidis.

[0034] Most native Staphylococcal phage endolysins with peptidoglycan hydrolase activity (such as endolysin Ply2638) consist of a C-terminal cell wall binding domain (CBD), a central N-acetylmuracil-L-alanine amidase domain, and a cysteine-containing N-terminal alanyl-glycyl endopeptidase domain (in the case of Ply2638, the N-terminal glycyl-alanyl-glycine endopeptidase domain homologous to peptidase_M23). The latter three domains each exhibit peptidoglycan hydrolase activity and have different target binding specificities, and are usually referred to as enzyme activity domains.

[0035] Endolysins can be recombinant endolysins, such as recombinant Staphylococcus aureus-specific endolysins, especially recombinant chimeric Staphylococcus aureus-specific endolysins containing one or more heterologous domains.

[0036] Generally, endolysins are composed of different subunits (domains), such as a cell wall-binding domain (CBD) and one or more enzyme domains with peptidoglycan activity, such as an amidase domain, an M23 domain, and a CHAP domain (cysteine- and histidine-dependent amidase / peptidase). An example of a Staphylococcus aureus-specific chimeric endolysin containing one or more heterologous domains is an endolysin containing the amidase domain of phage Ply2638, the M23 domain of lysostaphin (mimicking Staphylococcus), and the cell wall-binding domain of phage Ply2638.

[0037] This Staphylococcus aureus-specific chimeric endosomal is a preferred endosomal and is described in detail in WO 2012 / 150858 (which is incorporated herein by reference in its entirety). Other preferred endosomals are described in detail in WO 2013 / 169104 (which is incorporated herein by reference in its entirety). Other preferred endosomals are described in detail in WO 2016 / 142445 (which is incorporated herein by reference in its entirety). Other preferred endosomals according to the invention are extensively described in WO2017 / 046021 (which is incorporated herein by reference in its entirety). Other preferred endosomal formulations according to the invention are extensively described in WO 2012 / 146738, WO 2003 / 082184, WO 2010 / 011960, WO 2010 / 149795, WO2011 / 076432, WO 2011 / 134998, WO 2012 / 085259, WO 2012 / 146738 and WO 2018 / 091707 (which are incorporated herein by reference in their entirety).

[0038] The endosomal used according to the present invention may contain a domain having at least 80% sequence identity with the domains described in WO 2012 / 150858, WO 2013 / 169104, WO2016 / 142445, WO 2017 / 046021, WO 2012 / 146738, WO 2003 / 082184, WO 2010 / 011960, WO2010 / 149795, WO 2011 / 076432, WO 2011 / 134998, WO 2012 / 085259, WO 2012 / 146738 or WO2018 / 091707.

[0039] The endosomal used according to the present invention may have at least 80% sequence identity with the endosomal described in WO 2012 / 150858, WO 2013 / 169104, WO 2016 / 142445, WO 2017 / 046021, WO 2012 / 146738, WO 2003 / 082184, WO 2010 / 011960, WO 2010 / 149795, WO 2011 / 076432, WO 2011 / 134998, WO 2012 / 085259, WO 2012 / 146738, and WO 2018 / 091707 (such as the endosomal having the amino acid sequence of reference SEQ ID NO: 29 in WO 2012 / 150858).

[0040] In a particular embodiment, the endolysin is an endolysin derived from Staphylococcus aureus bacteriophage.

[0041] For the purposes of this invention, "endolysin derived from Staphylococcus aureus phage" means a natural or recombinant protein, such as an enzyme or a nucleic acid molecule encoding it, derived from one or more bacteriophages capable of cleaving the bacterial wall of Staphylococcus aureus species.

[0042] Endolysins particularly include one or more domains for binding to the bacterial wall of Staphylococcus aureus and / or one or more domains for lysing the bacterial wall of Staphylococcus aureus, wherein the binding and lysing domains for the bacterial wall of Staphylococcus aureus are derived from one or more bacteriophages of the same or different species capable of lysing the bacterial wall of Staphylococcus aureus.

[0043] In the context of this invention, endolysins may be in natural or recombinant form, particularly recombinant form.

[0044] According to a specific embodiment, the endolysin comprises a first protein sequence containing a domain for binding to the cell wall of a Staphylococcus species.

[0045] Specifically, the first protein sequence is derived from the endolysin of Staphylococcus aureus Φ2638a phage.

[0046] For each of the target amino acid or nucleic acid sequences, a reference sequence is described herein. This specification also covers amino acid or nucleic acid sequences (e.g., enzyme amino acid sequences) that have a specific percentage of amino acid or nucleotide identity with the reference sequence.

[0047] For obvious reasons, throughout this specification, adherence to specific nucleic acid sequences or specific amino acid sequences that conform to the considered nucleotide or amino acid identity must also result in the production of proteins (or enzymes) exhibiting the desired biological activity. As used herein, the “percentage of identity” between two nucleic acid sequences or two amino acid sequences is determined by comparing two best-aligned sequences through a comparison window.

[0048] Therefore, the portion of the nucleotide or amino acid sequence in the comparison window can include these additions or deletions (e.g., vacancies) relative to the reference sequence (which does not contain additions or deletions) to achieve optimal alignment between the two sequences.

[0049] The terms “sequence homology” or “sequence identity” or “homology” or “identity” are used interchangeably herein. For the purposes of this invention, this means that sequences are aligned for optimal comparison in order to determine the percentage of sequence homology or sequence identity between two amino acid sequences or two nucleic acid sequences. To optimize the alignment between two sequences, vacancies may be introduced in either of the two sequences being compared. This alignment can be performed over the entire length of the sequences being compared. Alignment can also be performed over shorter lengths (e.g., over about 20, 50, 100 or more nucleic acid / base or amino acid pairs). Sequence identity is the percentage of identical matches between two sequences in the reported aligned region.

[0050] Sequence comparison and determination of the percentage of sequence identity between two sequences can be performed using mathematical algorithms. Those skilled in the art will know that several different computer programs are available for comparing two sequences and determining their identity (Kruskal, JB (1983), An overview of sequence comparison, in D. Sankoff and JB Kruskal, Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1-44, Addison Wesley).

[0051] The percentage of sequence identity between two amino acid sequences or two nucleotide sequences can be determined using the Needleman-Wunsch algorithm for aligning two sequences (Needleman, SB and Wunsch, CD (1970) J. Mol. Biol. [Journal of Molecular Biology], 48, 443-453). This algorithm allows for the alignment of both amino acid and nucleotide sequences. The Needleman-Wunsch algorithm is implemented in the NEEDLE computer program.

[0052] For the purposes of this invention, the NEEDLE program of the EMBOSS software package (version 2.8.0 or later, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. Longden, J. and Bleasby, A. Trends in Genetics 16, (6) pp. 276-277, http: / / emboss.bioinformatics.nl / ) was used. For protein sequences, EBLOSUM62 was used for the substitution matrix. For nucleotide sequences, EDNAFULL was used. Optional parameters used were a vacancy opening penalty of 10 and a vacancy extension penalty of 0.5. No terminal vacancy penalty was added. In the output section, the answer to the question “Brief identity and similarity” was indicated as “Yes”, and “SRS paired” was indicated as the output alignment format.

[0053] After alignment using the NEEDLE program described above, the percentage of sequence identity between the query sequence and the sequence of this invention is calculated as follows: the total alignment length, calculated by dividing the number of matching positions of the same amino acids or nucleotides in the two sequences by the total number of vacancies in the alignment. The identity defined here can be obtained from NEEDLE using the NOBRIEF option and is marked as "Longest Identity" in the program output.

[0054] Several other known algorithms can be used, particularly the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA [Proceedings of the National Academy of Sciences] 90: 5873-5877), using hmmalign (HMMER package, http: / / hmmer.wustl.edu / ), or the CLUSTAL algorithm (Thompson, JD, Higgins, DG & Gibson, TJ (1994) Nucleic Acids Res. [Nucleic Acid Research] 22, 4673-80) (available for example at https: / / www.ebi.ac.uk / Tools / msa / clustalo / ), or the GAP program (mathematical algorithm from the University of Iowa), or the mathematical algorithm of Myers and Miller (1989- Cabios 4: 11-17), or Clone Manager. 9. Determine the similarity (i.e., percentage of sequence identity) of nucleotide and amino acid sequences through sequence alignment. The preferred parameters used are the default parameters defined in https: / / www.ebi.ac.uk / Tools / msa / clustalo / .

[0055] The degree of sequence identity (sequence matching) can be calculated using, for example, BLAST, BLAT, or BlastZ (or BlastX). A similar algorithm was introduced in the BLASTN and BLASTP programs by Altschul et al. (1990) J. Mol. Biol. [Journal of Molecular Biology], 215, 403-410. BLAST polynucleotide searches were performed using the BLASTN program (score = 100, word length = 12) to obtain polynucleotide sequences homologous to the nucleic acid encoding the target protein.

[0056] BLAST protein searches were performed using the BLASTP program (score = 50, word length = 3) to obtain amino acid sequences homologous to the SHC polypeptide. Gapped BLAST was used to obtain vacancy alignments for comparison, as described in Altschul et al. (1997) Nucleic AcidsRes. 25, 3389-3402. When using the BLAST and GappedBLAST programs, the default settings of the respective programs were used. Sequence matching analysis could be supplemented by established homology mapping techniques such as Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19, Supplement 1:154-162) or Markov random fields. When referring to percentages of sequence identity in this patent application, unless otherwise specified, these percentages are calculated relative to the total length of the longest sequence.

[0057] In a particular embodiment, the percentage of identity between two sequences is determined using CLUSTAL O (version 1.2.4).

[0058] Therefore, according to a specific embodiment, the first protein sequence comprises a protein sequence that is at least 80%, particularly at least 90%, more particularly at least 95% sequence identical to the reference amino acid sequence SEQ ID NO:1.

[0059] The term "at least 80% sequence identity between two sequences" means that the first sequence can contain 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the second sequence, regardless of whether these sequences are amino acid sequences or nucleic acid sequences.

[0060] Specifically, the first protein sequence consists of the amino acid sequence of reference SEQ ID NO:1.

[0061] The protein sequences described in this article can be encoded by one or more allele variants.

[0062] Allelic variants indicate any of two or more alternative forms of a gene occupying the same chromosomal locus. Preferred nucleic acid variants are nucleotide sequences containing one or more silent mutations. Alternatively or in combination, nucleic acid variants can also be obtained by introducing nucleotide substitutions that do not produce another amino acid sequence of the polypeptide encoded by the nucleotide sequence, but which correspond to the use of codons in the host organism intended to produce the polypeptide of the present invention. According to preferred embodiments, the nucleic acid variant encodes a polypeptide that still retains its biological function. More preferably, the nucleotide sequence variant encodes a polypeptide exhibiting cell wall binding and / or cleavage activity with Staphylococcus species. Even more preferably, the nucleic acid variant encodes a polypeptide exhibiting increased cell wall binding and / or cleavage activity with Staphylococcus species, as defined below. The nucleic acid encoding a polypeptide exhibiting cell wall binding and / or cleavage activity with Staphylococcus species can be isolated from any microorganism.

[0063] All these variants can be obtained using techniques known to those skilled in the art, such as library screening via hybridization (DNA blotting procedure) under low-to-medium-to-high hybridization conditions. Low-to-medium-to-high stringency conditions refer to pre-hybridization and hybridization at 42°C with 5X SSPE, 0.3% SDS, 200 pg / ml of cleaved and denatured salmon sperm DNA, and 25%, 35%, or 50% formamide (for low-to-medium-to-high stringency, respectively). The hybridization reaction mixture is then washed three times for 30 minutes each time, with each wash using 2X SSC, 0.2% SDS, and at 55°C, 65°C, or 75°C (for low-to-medium-to-high stringency).

[0064] According to a specific embodiment, the first protein sequence is encoded by a nucleic acid sequence that contains at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with the reference nucleic acid sequence SEQ ID NO:2.

[0065] Specifically, the first protein sequence is encoded by a nucleic acid sequence consisting of the nucleic acid sequence of reference SEQ ID NO:2.

[0066] The binding of the domain to the peptidoglycan cell wall of Staphylococcus spp. can be evaluated using assays well known to those skilled in the art. In a preferred embodiment, immunohistochemistry and / or gene fusion techniques that generate labeled constructs of any domain are used to evaluate the specific binding of peptides, polypeptides, or proteins to the peptidoglycan cell wall of Staphylococcus spp. The signal quantification methods used in the aforementioned immunohistochemical or fusion techniques are well known in the art.

[0067] In one embodiment, binding to the peptidoglycan cell wall of Staphylococcus can be quantified using a fluorescent fusion construct comprising a polypeptide containing the domains included in the first protein sequence described above. Loessner et al. (Molecular Microbiology 2002, 44(2): 335-349) describe such a cell wall binding assay in detail. In this assay, a solution containing the fluorescent fusion construct or a negative control (particularly green fluorescent protein (GFP)) is subjected to Staphylococcus cells, particularly Staphylococcus aureus cells, more preferably Staphylococcus aureus BB255, for a specified time period, followed by centrifugation to allow the cells to settle together with the bound fluorescent fusion construct. For the purposes of this invention, the measure of cell binding is the subtraction of the fluorescence signal of Staphylococcus cells exposed to the fluorescent fusion construct from the fluorescence signal of Staphylococcus cells exposed to the negative control (particularly GPF).

[0068] In particular, WO 2012 / 150858 A1 illustrates an example of evaluating the binding of endosomalin to the cell wall of a suitable Staphylococcus species according to the invention.

[0069] Specifically, in the context of this document, when an increase in fluorescence signal in sedimented cells is detected using this assay, the protein sequence is considered to contain a domain for binding to the peptidoglycan cell wall of Staphylococcus spp. This binding is specifically considered to be specific. In particular, an endolysin comprising the domain described is described, exhibiting a binding capacity (as defined herein) of at least 50%, 60%, 70%, 80%, 90%, 100%, 150%, or 200% for the binding of the Staphylococcus aureus Φ2638a phage endolysin (Ply2638), encoded by the nucleic acid sequence of reference SEQ ID NO: 5, to the peptidoglycan cell wall.

[0070] According to specific embodiments, the binding activity to the cell walls of Staphylococcus species is measured by immunohistochemistry and / or gene fusion techniques (especially fluorescence fusion techniques, and more particularly fusion with green fluorescent protein).

[0071] According to a specific embodiment, the endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of: amino acid sequences of SEQ ID NO: 3 and SEQ ID NO: 4.

[0072] According to a specific embodiment, the endolysin comprises a protein sequence encoded by a nucleic acid sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with the nucleic acid sequence of reference SEQ ID NO: 5.

[0073] In particular, the protein sequence can be encoded by a nucleic acid sequence consisting of the nucleic acid sequence of reference SEQ ID NO: 5.

[0074] According to certain embodiments, the endolysin may also contain a heterologous protein sequence.

[0075] The term “heterologous protein sequence” is intended to indicate a protein sequence, i.e., an amino acid sequence or nucleic acid sequence encoding a protein sequence, that is not naturally functionally linked to the first protein sequence as an adjacent sequence. As used herein, the term “heterologous” may mean “recombination.” The term “recombination” refers to a genetic entity that is different from a genetic entity normally found in nature. When applied to nucleotide sequences or nucleic acid molecules, this means that the nucleotide sequence or nucleic acid molecule is the product of various combinations of cloning, restriction enzyme digestion and / or ligation steps, and other procedures that result in constructs that are different from those found in nature.

[0076] Such methods of protein or nucleic acid recombination are well known to those skilled in the art.

[0077] According to a specific embodiment, the endolysin comprises a heterologous protein sequence containing a cleavage domain. In particular, the cleavage domain exhibits peptidoglycan hydrolase activity.

[0078] "Peptidoglycan hydrolase activity" (also defined herein as "lytic activity") can be evaluated using methods well known to those skilled in the art. In one embodiment, lytic activity can be evaluated spectrophotometrically by measuring the decrease in turbidity of a substrate cell suspension. In particular, lytic activity can be evaluated spectrophotometrically by measuring the decrease in turbidity of a Staphylococcus aureus suspension, which is measured by OD using a spectrophotometer (Libra S22, Biochrom Ltd., UK). 595 Quantification was performed. More preferably, 200 nM of a polypeptide encoded by a nucleic acid molecule as identified herein was incubated with a suspension of Staphylococcus aureus in PBS buffer (pH 7.4) and 120 mM sodium chloride at 37°C for 30 minutes, resulting in a suspension with an initial OD of 1 ± 0.05. 600 (As evaluated using spectrophotometry (Libra S22, British Pfizer Ltd.)). The reduction in turbidity was measured by the change in OD value 30 minutes prior to incubation. 595 Subtract the OD after 30 minutes of incubation 595The calculation is performed using this assay. In the context of this paper, a protein sequence is considered to contain a cleavage domain when a reduction in turbidity of at least 10%, 20%, 30%, 40%, 50%, or 60% is detected using this assay. Specifically, a reduction of at least 70% is detected. In particular, endolysins containing the following domains are described: those exhibiting cleavage activity of at least 50%, 60%, 70%, 80%, 90%, 100%, 150%, or 200% or greater than the cleavage activity of the Staphylococcus aureus Φ2638a phage endolysin (Ply2638) encoded by the nucleic acid sequence of reference SEQ ID NO: 5.

[0079] According to a specific embodiment, the cleavage activity of endosomalin is measured by spectrophotometry by measuring the decrease in turbidity of a Staphylococcus aureus suspension.

[0080] In one embodiment, the endolysin may not be encoded by an amino acid sequence comprising or consisting of the following: an amino acid sequence selected from the group consisting of the amino acid sequences of reference SEQ ID NO: 3 and SEQ ID NO: 4.

[0081] In particular, the endolysin may not be encoded by a nucleic acid sequence comprising or consisting of the following: the nucleic acid sequence of reference SEQ ID NO: 5 encoding the endolysin of Φ2638 phage of Staphylococcus aureus.

[0082] According to a specific embodiment, the heterologous protein sequence includes a cleavage domain, the cleavage domain comprising a second protein sequence and a third protein sequence, the second protein sequence comprising an endopeptidase M23 domain and the third protein sequence comprising an amidase domain.

[0083] As used in this paper, the endophthalase domain specifically cleaves the pentagalline cross-link (Trayer, HR and Buckley, CE (1970) Molecular properties of lysostaphin, a specific bacteriolytic agent for Staphylococcus aureus [Molecular properties of lysostaphin as a specific bacteriolytic agent for Staphylococcus aureus]. J. Biol. Chem. [Journal of Biochemistry] 245, 4842-4846), which is present in the cell walls of Staphylococcus species, particularly in the cell walls of Staphylococcus aureus, Staphylococcus mimicus, and Staphylococcus carinatum.

[0084] As used in this article, the amidase domain specifically hydrolyzes substrates containing a γ-glutamyl group.

[0085] The function and activity of such domains in a polypeptide can be demonstrated by characterizing the cleavage products of the polypeptide containing any of these domains after incubation with purified peptidoglycan.

[0086] According to a specific embodiment, the endolysin and / or amidase activities of endolysin are measured by characterizing the cleavage products.

[0087] According to specific embodiments, the endolysin and / or amidase activities of anendolysin can be measured by measuring the optical density of bacteria in the presence of anendolysin. Such methods are described in particular in Park et al. (Characterization of anendolysin, LysBPS13, from a Bacillus cereus bacteriophage), FEMS Microbiol. Lett. July 2012; 332(1): 76-83) and Grishin et al. (A Simple Protocol for the Determination of Lysostaphin Enzymatic Activity), Antibiotics (Basel). December 17, 2020; 9(12): 917).

[0088] In particular, each of the protein and nucleotide sequences encoding the second or third domain is of bacterial or bacteriophage origin.

[0089] According to a specific embodiment, the second and third protein sequences are independently derived from enzymes selected from the group consisting of: endolysin from Staphylococcus aureus Φ2638a phage and lysozyme, a staphylococcal-mimicking enzyme. Specifically, one of the second and third protein sequences is derived from the endolysin from Staphylococcus aureus Φ2638a phage, and the other sequence is derived from lysozyme, a staphylococcal-mimicking enzyme.

[0090] According to a specific embodiment, the second protein sequence contains at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with the amino acid sequence of reference SEQ ID NO: 6, and the third protein sequence contains at least 80%, particularly 90%, and more particularly 95% sequence identity with the amino acid sequence of reference SEQ ID NO: 8.

[0091] According to a specific embodiment, the second protein sequence is encoded by a nucleic acid sequence containing at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with the nucleic acid sequence of reference SEQ ID NO: 7, and the third protein sequence is encoded by a nucleic acid sequence containing at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with the nucleic acid sequence of reference SEQ ID NO: 9.

[0092] According to a specific embodiment, the second protein sequence is encoded by a nucleic acid sequence consisting of the nucleic acid sequence of reference SEQ ID NO: 7, and the third protein sequence is encoded by a nucleic acid sequence consisting of the nucleic acid sequence of reference SEQ ID NO: 9.

[0093] According to a specific embodiment, the endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of: amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11.

[0094] In particular, the endosomalin may comprise a protein sequence consisting of the amino acid sequence of reference SEQ ID NO: 10.

[0095] According to a specific embodiment, the endolysin comprises a protein sequence encoded by a nucleic acid sequence having at least 80%, particularly at least 90%, and more particularly at least 95% sequence identity with the nucleic acid sequence of reference SEQ ID NO: 12. Specifically, the endolysin may comprise a protein sequence encoded by a nucleic acid sequence comprising the nucleic acid sequence of reference SEQ ID NO: 12.

[0096] The endolysin containing the protein sequence encoded by the nucleic acid sequence of reference SEQ ID NO: 12 differs from the endolysin of Staphylococcus aureus Φ2638a phage in that the N-terminal M23 endophthalase domain is replaced by the M23 endophthalase domain of lysostaphin from Staphylococcus aureus.

[0097] The endolysin suitable for use in this invention can be obtained by any method known to those skilled in the art for producing recombinant proteins. In particular, the endolysin according to the invention can be obtained by introducing one or more target genes (such as the nucleic acid sequences described above) into the genome of a host organism via a vector.

[0098] On the other hand, a nucleic acid construct comprising at least one nucleic acid sequence as previously defined is described. This nucleic acid construct may comprise a first nucleic acid sequence encoding a polypeptide containing a cell wall-binding domain, and may also comprise a second and a third nucleic acid sequence as previously defined.

[0099] Expression vectors comprising such nucleic acid constructs are also described. In particular, the expression vectors comprise nucleotide sequences as previously mentioned, which are operatively linked to one or more control sequences that direct the production or expression of the encoded polypeptide in cells, subjects, or cell-free expression systems.

[0100] The expression vector can be considered a recombinant expression vector. This vector can consist of plasmids, granules, bacteriophages, or viruses, which are transformed by introducing a nucleic acid molecule according to the invention. Such transformation vectors based on the host organism to be transformed are well known to those skilled in the art and are extensively described in the literature.

[0101] Another subject described herein is a method for transforming a host organism by integrating at least one nucleic acid sequence as described herein, which can be carried out by any suitable means known and widely described in the professional literature, and more particularly by the aforementioned vector.

[0102] In another aspect, a cell comprising a nucleic acid construct or expression vector as previously defined is described. The cell can be any microbial, prokaryotic, or eukaryotic cell suitable for expressing endolysins suitable for use in this invention. In a preferred embodiment, the cell is an *E. coli* cell. In an even more preferred embodiment, the cell is *E. coli* CL1blue MRF.

[0103] The obtained endolysin can then be purified using purification methods known in the art, such as column chromatography, high performance liquid chromatography, etc.

[0104] In certain embodiments, one or more protein sequences, as defined herein, may include sequences encoding a tag to facilitate the purification of the resulting endolysin. Specifically, the tag is selected from, but is not limited to, the group consisting of FLAG tags, His tags, HA tags, and Myc tags. More preferably, the tag is a 6xHis tag. Even more preferably, the tag is the same N-terminal 6xHis tag as SEQ ID NO: 13.

[0105] The endosomalin used in accordance with the present invention and the method for its production are particularly described in patent application WO 2012 / 150858 A1.

[0106] The endolysin derived from Staphylococcus aureus phage suitable for use according to the present invention can be present in the composition in a freshly prepared form or a lyophilized form.

[0107] In this paper, the term “freshly prepared” is specifically defined as prepared in 1.63 mg / mL in lyophilization buffer (50 mM Tris, 500 mM sucrose, 200 mM mannitol, 0.05% polysorbate 20 + 50% glycerol), stored at -20°C for no more than 2 days, and then thawed immediately before evaluating lysis activity in the assays identified herein.

[0108] The term "lyophilized" refers to endosomal proteins that have been dehydrated through lyophilization, which involves freezing proteins and then dehydrating them to remove water.

[0109] After lyophilization, the lyophilized form of endosomalin can be reconstituted by adding water. In one embodiment, lyophilization and reconstitution can be performed by dialyzing aliquots of the sample against three 300 ml lyophilization buffer solutions (50 mM phosphate or Tris, 500 mM sucrose, 200 mM mannitol, pH 7.4) and freezing in the gas phase of liquid nitrogen. Lyophilization can be performed under standard conditions (particularly at -40°C and 75 mTorr vacuum) for 60 minutes, followed by raising the temperature to -10°C over 5 hours at the same vacuum level, and then further raising it to -10°C over 60 minutes. As a final step, the temperature is specifically raised to 25°C over 10 hours. The sample is reconstituted by adding water.

[0110] The compositions according to the invention may contain an amount of endosomalin derived from Staphylococcus aureus phage ranging from 0.0001 wt% to 0.1 wt% relative to the total weight of the composition, particularly from 0.0005 wt% to 0.01 wt% relative to the total weight of the composition, and more particularly from 0.001 wt% to 0.005 wt% relative to the total weight of the composition.

[0111] Hydrophobic silica aerogel particles

[0112] The compositions according to the present invention comprise at least hydrophobic silica aerogel particles.

[0113] Aerogels are ultralight porous materials, first produced by Kristler in 1932.

[0114] The term "hydrophobic silica" refers to both pure hydrophobic silica and particles that are completely or partially coated with hydrophobic silica.

[0115] The hydrophobic silica that can be used is preferably amorphous and derived from a fumed process. It is preferably provided in powder form.

[0116] Amorphous hydrophobic silica derived from the fumed phase is typically obtained from hydrophilic fumed silica. Hydrophilic fumed silica is obtained by pyrolyzing silicon tetrachloride (SiCl4) in a continuous flame at 1000°C in the presence of hydrogen and oxygen. It is subsequently made hydrophobic, for example, by treatment with halosilanes, alkoxysilanes, or silazanes. The hydrophobic silica differs from the initial hydrophilic silica, particularly in the lower density of silanol groups and less adsorption of water vapor.

[0117] According to a specific embodiment, the composition according to the invention may comprise hydrophobically treated fumed silica aerogel particles.

[0118] The hydrophobic group can be trimethylsiloxy (which is obtained, in particular, by treating fumed silica in the presence of hexamethyldisilazane) or dimethylsiloxy (which is obtained, in particular, by treating fumed silica in the presence of dimethyldichlorosilane).

[0119] The hydrophobic silica aerogel particles used in this invention are preferably silylated silica aerogel particles (INCI name: silylated silica).

[0120] Hydrophobic silica aerogel particles modified with trimethylsilyl groups, i.e., trimethylsiloxylated silica particles, can also be used.

[0121] The hydrophobic silica aerogel particles that can be used in this invention preferably have a size (expressed as average diameter (D[0.5])) of less than 1500 μm, and preferably range from 1 μm to 30 μm, preferably from 2 μm to 25 μm, even more preferably from 2 μm to 20 μm and even more preferably from 2 μm to 15 μm.

[0122] The preferred material to use is an aerogel sold by Dow Corning under the name VM-2270 (INCI name: silylated silica), whose particles have an average size ranging from 5 micrometers to 15 micrometers and a specific surface area per unit mass ranging from 600 m2 / g to 800 m2 / g.

[0123] As a hydrophobic silica aerogel that can be used in this invention, reference may also be made to the aerogel sold by Dow Corning under the name VM-2260 (INCI name: silylated silica), whose particles have an average size of about 1000 micrometers and a specific surface area per unit mass ranging from 600 m2 / g to 800 m2 / g.

[0124] As hydrophobic silica aerogels that can be used in this invention, references may also be made to aerogels sold by Cabot Chemical Company under reference models Aerogel TLD 201, Aerogel OGD 201 and Aerogel TLD 203, EnovaAerogel MT 1100 and Enova Aerogel MT 1200, and aerogels sold by Toyukama Rubber Co., Ltd. under reference models Airlica TL3 and Airlica TL5.

[0125] More specifically, the hydrophobic silica aerogel particles present in the compositions according to the invention are selected from hydrophobic silica aerogel particles obtained from Dow Corning under the trade name Dowsil® VM-2270 Aerogel Fine Particles (INCI name: silylated silica) or from Cabot Chemicals under the trade name Fine Particle Aerogel TLD201 (INCI name: silylated silica).

[0126] Hydrophobic silica aerogel particles may be present in the composition according to the invention in an active material content ranging from 0.01% to 5% by weight, preferably from 0.1% to 3% by weight, and even more preferably from 1% to 2% by weight relative to the total weight of the composition.

[0127] The compositions according to the invention may contain water, and optionally a water-miscible organic solvent.

[0128] In particular, the composition according to the invention may include at least 10% by weight of water relative to the total weight of the composition, particularly ranging from 10% to 98% by weight, more particularly from 20% to 95% by weight, especially from 30% to 90% by weight, and even more particularly from 35% to 85% by weight relative to the total weight of the composition.

[0129] The water may be sterile demineralized water and / or floral water and / or natural spring water or mineral water.

[0130] According to the present invention, the term "water-miscible organic solvent" means a compound that is a liquid at room temperature and has a water miscibility of more than 50% by weight at 25°C and atmospheric pressure.

[0131] The water-miscible organic solvents that can be used in the compositions of the present invention can be, in particular, volatile.

[0132] Among the water-miscible organic solvents that can be used in the compositions of the present invention, examples include lower monohydric alcohols (such as ethanol and isopropanol) and polyhydric alcohols containing 2 to 5 carbon atoms.

[0133] A water-miscible organic solvent may be present in the composition according to the invention in an amount ranging from 5% to 20% by weight relative to the total weight of the composition, preferably from 10% to 15% by weight relative to the total weight of the composition.

[0134] According to one embodiment, the composition according to the invention may be free of lower monohydric alcohols containing 2 to 5 carbon atoms.

[0135] The compositions according to the invention may contain less than 2% by weight of ethanol relative to the total weight of the composition, particularly less than 1% by weight, more particularly less than 0.5% by weight, particularly less than 0.1% by weight of ethanol, and may particularly be ethanol-free.

[0136] Additional ingredients

[0137] In addition to the compounds described above, the compositions according to the present invention may of course contain one or more additional ingredients.

[0138] It goes without saying that those skilled in the art will carefully select one or more additional ingredients so that the advantageous properties of the endosomal in this invention are not adversely affected or are substantially unaffected.

[0139] Additional ingredients are present in the composition at their usual levels in cosmetic compositions, particularly at levels where they are usually present and which enable them to retain their cosmetic properties, and even more particularly at levels where they are usually present and which enable them to retain their cosmetic properties when they are the only ingredients in the composition according to the invention that have this property.

[0140] Therefore, the compositions according to the invention may contain one or more of the following additional ingredients selected from: surfactants; fatty substances; colorants; preservatives; fragrances; pH adjusters, such as organic acids, for example citric acid; antioxidants; hydrophilic gelling agents, such as hydroxypropyl methylcellulose; amino acids, such as arginine; carbohydrates; chelating agents; sugar alcohols; cosmetic surfactants; and mixtures thereof.

[0141] It goes without saying that those skilled in the art will carefully select such or such optional additional ingredients and / or their amounts so that the advantageous properties of the compositions according to the invention are not or substantially not adversely affected by the contemplated additives.

[0142] Additional components, different from those listed below, may be present in the compositions according to the invention at a concentration of 0.001% to 20% by weight, particularly 0.01% to 10% by weight, and more particularly 0.1% to 5% by weight relative to the total weight of the composition.

[0143] According to specific embodiments, the compositions according to the invention may contain at least one additional ingredient selected from: oils, aromatic alcohols of formula (I), organic fillers, nonionic surfactants, and mixtures thereof.

[0144] Oil

[0145] The compositions according to the present invention may contain at least one oil.

[0146] For the purposes of this invention, the term "oil" indicates oil at 25°C and atmospheric pressure (1.013 × 10⁻⁶). 5 A water-immiscible compound that is a liquid at Pa.

[0147] The term "immiscible" means that, under the temperature and pressure conditions mentioned above, the mixing of equal amounts of water and oil after stirring does not produce a stable solution containing only one phase. If necessary, observe the mixture obtained after thoroughly stirring 100 g of the mixture with a Rayneri mixer to create eddies (as a guideline, 200 to 1000 rpm) by eye or using a phase contrast microscope. Before observation, allow the resulting mixture to stand in a closed flask at room temperature for 24 hours.

[0148] The term "hydrocarbon oil" refers to an oil that primarily contains carbon and hydrogen atoms and possibly one or more functional groups selected from hydroxyl, ester, ether, and carboxylic acid functional groups. Hydrocarbon oils therefore do not contain any silicon or fluorine atoms.

[0149] The term "silicone oil" refers to an oil containing at least one silicon atom, and in particular at least one Si-O group, and more particularly an organopolysiloxane.

[0150] The term "fluorinated oil" refers to an oil containing at least one fluorine atom.

[0151] The term "nonpolar hydrocarbon oil" refers to hydrocarbon oils that contain only carbon and hydrogen atoms, and are in particular non-aromatic (also known as hydrocarbons).

[0152] The term "polar hydrocarbon oil" refers to a hydrocarbon oil that primarily contains carbon and hydrogen atoms and one or more functional groups selected from hydroxyl, ester, ether, and carboxylic acid functional groups.

[0153] In particular, the composition according to the invention may contain at least one oil selected from the following: volatile and non-volatile oils, especially excluding liquid paraffin.

[0154] Volatile oils

[0155] The term "volatile oil" refers to an oil (or non-aqueous medium) that evaporates upon contact with skin in less than an hour at room temperature and atmospheric pressure. Volatile oils are volatile cosmetic oils that are liquid at room temperature and have a non-zero vapor pressure, particularly ranging from 0.13 Pa to 40,000 Pa (10⁻⁶ Pa). -3 Vapor pressures ranging from 1.3 Pa to 13,000 Pa (0.01 to 100 mmHg), and even more particularly from 1.3 Pa to 1300 Pa (0.01 to 10 mmHg).

[0156] According to a particular embodiment of the invention, the volatile oil is such that it has a flash point of less than 120°C and a vapor pressure of less than 5 Pa, more particularly a flash point of less than 90°C and a vapor pressure of greater than 1 Pa, even more particularly a flash point of less than or equal to 60°C and a vapor pressure of greater than 5 Pa, and even more particularly a flash point of less than 60°C and a vapor pressure of greater than 100 Pa.

[0157] Volatile oils can be selected from volatile hydrocarbon-based oils, such as:

[0158] - Hydrocarbon-based oils containing 8 to 16 carbon atoms, and especially:

[0159] a) Branched C8-C, alone or as a mixture 16 Alkanes, such as isoalkanes (also known as isoparaffins) such as C8-C9 isoparaffins, C 13 -C 16 Isoparaffins, isododecane, isodecane, isohexadecane, and oils sold, for example, under the trade names Isopar or Permethyl, particularly isododecane (also known as 2,2,4,4,6-pentamethylheptane), such as isododecane sold by Ineos, and more particularly isododecane;

[0160] b) Straight-chain C6-C, alone or as a mixture 16 Alkanes, such as hexane, decane, undecane, tridecane, isoparaffins, or n-dodecane (C64-24-24) sold by Sasol under the corresponding reference models Parafol 12-97 and Parafol 14-97. 12 ) and n-tetradecane (C 14 Undecane-tridecane mixture, obtained from Examples 1 and 2 of Cognis patent application WO 2008 / 155059, consisting of n-undecane (C11) and n-tridecane (C21). 13 A mixture of ), and mixtures thereof, and n-undecane (C) from BASF. 11) and n-tridecane (C 13 A mixture of Cetiol Ultimate®;

[0161] c) Volatile C5-C12 cyclic non-aromatic alkanes;

[0162] - Short-chain esters containing a total of 3 to 8 carbon atoms, such as methyl acetate, ethyl acetate, propyl acetate, n-butyl acetate, or isobutyl acetate, for example, sold by Solvay, Dow, or Oxea.

[0163] - A volatile carbonate hydrocarbon-based oil with the structure R'1-OC(O)-O-R'2, wherein R'1 and R'2 can be the same or different, independently indicating straight-chain, branched, or cyclic C4-C8 alkyl groups, particularly straight-chain C4-C8 alkyl groups. Preferably, R'1 and R'2 are the same. In particular, R'1 and R'2 indicate straight-chain butylalkyl or pentyl. Advantageously, the ether oil is selected from dibutyl carbonate and dipentyl carbonate;

[0164] - A volatile ether oil of the formula R1-O-R2, wherein R1 and R2 may be the same or different, independently indicating straight-chain, branched, or cyclic C4-C8 alkyl groups, particularly straight-chain or branched C4-C8 alkyl groups. Preferably, R1 and R2 are the same. Straight-chain alkyl groups may include butyl and pentyl. Branched alkyl groups may include 1-methylpropyl, 2-methylpropyl, tert-butyl, and 1,1-dimethylpropyl.

[0165] Specifically, the hydrocarbon-based volatile oils are selected from C8-C. 16 Alkanes, especially straight-chain alkanes, and more particularly selected from C9-C... 12 Alkanes, and even more specifically, those selected from C9-C. 12 Mixtures of alkanes, such as Vegelight Silk® sold by BioSynthIs.

[0166] Volatile oils can be selected from volatile silicone oils, such as:

[0167] - Silicone oils containing 2 to 7 silicon atoms, optionally including alkyl or alkoxy groups containing 1 to 10 carbon atoms. Among the volatile silicone oils that can be used in this invention are polydimethylsiloxane, cyclopentanedimethylsiloxane, dodecylpentane, cyclohexanedimethylsiloxane, octamethylcyclotetrasiloxane, decamethylcyclopentane, dodecylcyclohexasiloxane, heptamethylhexyltrisiloxane, heptamethyloctyltrisiloxane, hexamethyldisiloxane, octamethyltrisiloxane, decamethyltetrasiloxane, and dodecylpentane, and mixtures thereof, with viscosities of 5 and 6 cSt. Dodecylpentane, such as DM-Fluid-2cs sold by Shin-Etsu, or cyclohexanedimethylsiloxane, such as reference model Xiameter PMX-0246 cyclohexanesiloxane sold by Dow Chemical, are particularly noteworthy.

[0168] Non-volatile oils

[0169] The term "non-volatile oil" refers to an oil whose vapor pressure at 25°C and atmospheric pressure is non-zero and less than 2.66 Pa, and more specifically less than 0.13 Pa. For example, the vapor pressure can be measured by static methods or by the permeability method via isothermal thermogravimetric analysis, depending on the vapor pressure of the oil (standard OCDE 104).

[0170] Non-volatile oils can be of natural or synthetic origin, especially natural origin.

[0171] Among non-volatile oils, the following can be mentioned:

[0172] - Non-volatile fluorinated oils, which may be particularly selected from fluorinated polyethers, and also from fluorosilicone oils and fluorosilicones as described in EP-A-847752;

[0173] - Non-volatile silicone oils, which may be particularly selected from non-volatile silicones having the following INCI names: polydimethylsiloxane, polydimethylsiloxane alcohol, trimethylpentaphenyltrisiloxane, tetramethyltetraphenyltrisiloxane, diphenylpolydimethylsiloxane, trimethylsiloxyphenylpolydimethylsiloxane, phenylpolytrimethylsiloxane, diphenylsiloxyphenylpolytrimethylsiloxane; and mixtures thereof.

[0174] These products, in particular, are sold by Dow Corning under the names PH-1555 HRI Cosmetic Fluid (trimethylpentaphenyltrisiloxane) and Dow Corning 556 Cosmetic Grade Fluid (phenyl polytrimethylsiloxane); diphenyl polydimethylsiloxanes, such as KF-54, KF54HV, KF-50-300CS, KF-53d and KF-50-100CS or diphenylsiloxyphenyl polytrimethylsiloxane KF56 A sold by Shin-Etsu Chemical Co., Ltd.; and Belsil PDM 1000 and Belsil PDM 20 (trimethylsiloxyphenyl polydimethylsiloxane) sold by Wacker Chemie, individually or as mixtures.

[0175] - Nonpolar, nonvolatile hydrocarbon-based oils, which may be particularly selected from straight-chain or branched compounds of mineral or synthetic origin, such as: i) squalanes, such as reference name Neossance Squalane, isoeicoecane, sold by Amyris; ii) mixtures of straight-chain saturated hydrocarbons, particularly C14-C30 hydrocarbons and more particularly C15-C28 hydrocarbons, such as mixtures whose INCI names are, for example, mixtures of (C15-C19) alkanes, (C18-C21) alkanes, (C21-C28) alkanes, such as Gemseal 40, Gemseal 60 and Gemseal 120 sold by Total, Emogreen L19 sold by SEPPIC, and Emogreen L15 sold by SEPPIC; iii) hydrogenated or non-hydrogenated polybutenes, such as those produced by Ineos Oligomers. Products from the Indopol series sold by Oligomers, namely products with the INCI name hydrogenated polyisobutene; iv) hydrogenated or non-hydrogenated (especially hydrogenated) polyisobutene, such as non-volatile compounds from the Parleam® series sold by Nippon Oil Fats; v) hydrogenated or non-hydrogenated polydecene, such as non-volatile compounds from the Puresyn® series sold by ExxonMobil; vi) decene / butene copolymers, butene / isobutene copolymers, and vii) mixtures thereof;

[0176] - Polar, non-volatile hydrocarbon-based oils, which may be selected from:

[0177] i) Saturated, unsaturated, straight-chain or branched C64 molecules that are liquid at room temperature (25°C)10 -C 26 Fatty alcohols, especially monohydric alcohols. Particularly, C 10 -C 26 The alcohol is a fatty alcohol, which is particularly branched when it contains at least 16 carbon atoms; in particular, fatty alcohols contain 10 to 24 carbon atoms, and more particularly 12 to 22 carbon atoms, especially such as lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecylpentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecyl alcohol and mixtures thereof;

[0178] ii) Triglycerides composed of fatty acid esters of glycerol, particularly those whose fatty acids can have a range from C4 to C6. 36 And especially from C 18 To C 36 The chain length of these oils may vary; they may be straight-chain or branched, and saturated or unsaturated. Examples, in particular, include heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame seed oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, pumpkin oil, zucchini oil, blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, candelilla oil, passion fruit oil, musk rose oil, peanut oil, coconut oil, argan oil, passion fruit oil, torreya nut oil; the liquid fraction of shea butter and the liquid fraction of cocoa butter; and mixtures thereof.

[0179] iii) A straight-chain aliphatic hydrocarbon ester of formula RC(O)-OR', wherein RC(O)- represents a carboxylic acid residue containing 2 to 40 carbon atoms and R' represents a hydrocarbon chain containing 1 to 40 carbon atoms, an aliphatic hydrocarbon ester of alkylene glycol, particularly ethylene glycol or propylene glycol, advantageously having a total number of at least 10 carbon atoms. Examples of such esters may include isoamyl laurate, cetearyl octanoate, isopropyl stearate or isostearyl octanoate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoate, decanoate or ricinoleate of alcohols or polyols such as propylene glycol dioctanoate, cetyl octanoate, cocoyl octanoate / decanoate, tridecyl octanoate, 2-ethylhexyl palmitate, alkyl benzoate, polyethylene glycol diheptanoate, etc. Propylene glycol bis(2-ethylhexanoate) and mixtures thereof, hexyl laurate, neopentanoates such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate or 2-octyldodecyl neopentanoate, isononanoates such as isononyl isononanoate, isotridecyl isononanoate or octyl isononanoate, oleic acid ester, isopropyl lauroyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl behenate or myristyl myristate; and mixtures thereof;

[0180] iv) Hydroxylated esters, such as polyglycerol-2-triisostearate;

[0181] v) Aromatic esters, such as tridecyl trimellitate, C 12 -C 15 Alcohol benzoates, 2-phenylethyl benzoate, and butyl octyl salicylate;

[0182] vi) Straight-chain fatty acid esters with a total carbon number ranging from 35 to 70, such as pentaerythritol tetranonanoate;

[0183] vii) C 24 -C 28 Esters of branched-chain fatty acids or fatty alcohols, such as triisoarachidyl citrate, pentaerythritol tetraisonononate, triisostearate, glyceryl tri(2-decyltetradecanoate), pentaerythritol tetraisostearate, polyglycerol-2-tetraisostearate, or pentaerythritol tetra(2-decyltetradecanoate).

[0184] viii) Polyesters obtained by condensation of dimers and / or trimers of unsaturated fatty acids and diols, such as those with INCI names of dilinoleic acid / butanediol copolymers or dilinoleic acid / propylene glycol copolymers; polyesters obtained by condensation of fatty acid dimers and diol dimers, such as dilinoleyldimer dilinoleate.

[0185] ix) Synthetic ethers of the formula R1-O-R2, wherein R1 and R2 may be the same or different, independently indicating straight-chain, branched, or cyclic C6-C 24 Alkyl groups, particularly C6-C 18 Alkyl groups, and more specifically C8-C 12 Alkyl groups. Preferably, R1 and R2 are the same. Straight-chain alkyl groups that may be mentioned include hexyl, heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl, tetradecyl, pentadecyl, hexadecyl, heptadecanyl, octadecyl, nonadecanyl, eicosyl, behenyl, dodecyl, tridecyl, and tetradecyl. Branched alkyl groups that may be mentioned include 1,1-dimethylpropyl, 3-methylhexyl, 5-methylhexyl, ethylhexyl, 2-ethylhexyl, 5-methyloctyl, 1-ethylhexyl, 1-butylpentyl, 2-butyloctyl, isotriadecyl, 2-pentylnonyl, 2-hexyldecyl, isostearyl, 2-heptylundecyl, 2-octyldodecyl, 1,3-dimethylbutyl, 1-(1-methylethyl)-2-methylpropyl, 1,1,3,3-tetramethylbutyl, 3,5,5-trimethylhexyl, 1-(2-methylpropyl)-3-methylbutyl, 3,7-dimethyloctyl, and 2-(1,3,3-trimethylbutyl)-5,7,7-trimethyloctyl. As cyclic alkyl groups, cyclohexyl, 3-methylcyclohexyl, and 3,3,5-trimethylcyclohexyl, dilauryl ether, diisostearyl ether, dioctyl ether, nonylphenyl ether, dodecyl dimethyl butyl ether, cetyl dimethyl butyl ether, cetyl isobutyl ether, and mixtures thereof may be mentioned. Among non-volatile ether oils, dioctyl ether, such as the reference designation Cetiol OE sold by BASF, may be mentioned;

[0186] x) Carbonates of the formula R8-OC(O)-O-R9, wherein R8 and R9 may be the same or different, representing straight-chain or branched C4 to C6. 12 And specifically C6 to C 10 Alkyl chain; these carbonate oils may be dicaprylyl carbonate (or dioctyl carbonate) sold by BASF under the name Cetiol CC®, bis(2-ethylhexyl) carbonate sold by Evonik under the name Tegosoft DEC®, dipropylheptyl carbonate (from BASF's Cetiol 4 AII), dibutyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, diisononyl carbonate or dinonyl carbonate and more particularly dioctyl carbonate;

[0187] xi) Vinylpyrrolidone copolymers such as vinylpyrrolidone / 1-hexadecene copolymers (INCI name);

[0188] xii) Higher C6-C26 fatty acids that are liquid at room temperature (25°C), such as oleic acid, linoleic acid, linolenic acid, or isostearic acid; and

[0189] xiii) Their mixture.

[0190] According to a specific embodiment, the composition comprises at least one oil selected from volatile C8-C oils. 16 Alkane-based oils, non-volatile silicone oils, non-polar non-volatile hydrocarbon oils other than liquid paraffin, polar non-volatile hydrocarbon oils as defined above, and mixtures thereof, more particularly selected from polar non-volatile hydrocarbon oils and mixtures thereof.

[0191] According to a specific embodiment, the composition comprises at least one oil selected from polar nonvolatile hydrocarbon oils; more particularly, the composition according to the invention comprises at least one oil selected from polar nonvolatile hydrocarbon oils and does not contain any nonpolar nonvolatile hydrocarbon oils; even more particularly, the composition according to the invention comprises at least one oil selected from polar nonvolatile hydrocarbon oils and does not contain any nonpolar nonvolatile hydrocarbon oils, fluorinated nonvolatile oils, silicone-based nonvolatile oils, or volatile oils.

[0192] According to a specific embodiment, the polar non-volatile hydrocarbon-based oil is selected from:

[0193] i) Saturated, unsaturated, straight-chain or branched C64 molecules that are liquid at room temperature (25°C) 10 -C 26 Fatty alcohols, especially monohydric alcohols. Particularly, C 10 -C 26 The alcohol is a fatty alcohol, which is particularly branched when it contains at least 16 carbon atoms; more particularly, fatty alcohols contain 10 to 24 carbon atoms, and even more particularly 12 to 22 carbon atoms, especially such as lauryl alcohol, isostearyl alcohol, oleyl alcohol, 2-butyloctanol, 2-undecylpentadecanol, 2-hexyldecyl alcohol, isocetyl alcohol, octyldodecyl alcohol and mixtures thereof;

[0194] ii) Triglycerides composed of fatty acid esters of glycerol, particularly those whose fatty acids can have a range from C4 to C6. 36 And especially from C 18 To C 36The chain length of these oils may vary; they may be straight-chain or branched, and saturated or unsaturated. Examples, in particular, include heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame seed oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, pumpkin oil, zucchini oil, blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, candelilla oil, passion fruit oil, musk rose oil, peanut oil, coconut oil, argan oil, passion fruit oil, torreya nut oil; the liquid fraction of shea butter and the liquid fraction of cocoa butter; and mixtures thereof.

[0195] iii) A straight-chain aliphatic hydrocarbon ester of formula RC(O)-OR', wherein RC(O)- represents a carboxylic acid residue containing 2 to 40 carbon atoms and R' represents a hydrocarbon chain containing 1 to 40 carbon atoms, an aliphatic hydrocarbon ester of alkylene glycol, particularly ethylene glycol or propylene glycol, advantageously having a total number of at least 10 carbon atoms. Examples of such esters may include isoamyl laurate, cetearyl octanoate, isopropyl stearate or isostearyl octanoate, ethyl palmitate, 2-ethylhexyl palmitate, isostearyl isostearate, octyl stearate, isostearyl heptanoate, octanoate, decanoate or ricinoleate of alcohols or polyols such as propylene glycol dioctanoate, cetyl octanoate, cocoyl octanoate / decanoate, tridecyl octanoate, 2-ethylhexyl palmitate, alkyl benzoate, polyethylene glycol diheptanoate, etc. Propylene glycol bis(2-ethylhexanoate) and mixtures thereof, hexyl laurate, neopentanoates such as isodecyl neopentanoate, isotridecyl neopentanoate, isostearyl neopentanoate or 2-octyldodecyl neopentanoate, isononanoates such as isononyl isononanoate, isotridecyl isononanoate or octyl isononanoate, oleic acid ester, isopropyl lauroyl sarcosinate, diisopropyl sebacate, isocetyl stearate, isodecyl neopentanoate, isostearyl behenate or myristyl myristate; and mixtures thereof;

[0196] ix) Synthetic ethers of the formula R1-O-R2, wherein R1 and R2 may be the same or different, independently indicating straight-chain, branched, or cyclic C6-C 24 Alkyl groups, particularly C6-C 18 Alkyl groups, and more specifically C8-C 12Alkyl groups. Preferably, R1 and R2 are the same. Straight-chain alkyl groups that may be mentioned include hexyl, heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl, tetradecyl, pentadecyl, hexadecyl, heptadecanyl, octadecyl, nonadecanyl, eicosyl, behenyl, dodecyl, tridecyl, and tetradecyl. Branched alkyl groups that may be mentioned include 1,1-dimethylpropyl, 3-methylhexyl, 5-methylhexyl, ethylhexyl, 2-ethylhexyl, 5-methyloctyl, 1-ethylhexyl, 1-butylpentyl, 2-butyloctyl, isotriadecyl, 2-pentylnonyl, 2-hexyldecyl, isostearyl, 2-heptylundecyl, 2-octyldodecyl, 1,3-dimethylbutyl, 1-(1-methylethyl)-2-methylpropyl, 1,1,3,3-tetramethylbutyl, 3,5,5-trimethylhexyl, 1-(2-methylpropyl)-3-methylbutyl, 3,7-dimethyloctyl, and 2-(1,3,3-trimethylbutyl)-5,7,7-trimethyloctyl. As cyclic alkyl groups, cyclohexyl, 3-methylcyclohexyl, and 3,3,5-trimethylcyclohexyl, dilauryl ether, diisostearyl ether, dioctyl ether, nonylphenyl ether, dodecyl dimethyl butyl ether, cetyl dimethyl butyl ether, cetyl isobutyl ether, and mixtures thereof may be mentioned. Among non-volatile ether oils, dioctyl ether, such as the reference designation Cetiol OE sold by BASF, may be mentioned;

[0197] x) Carbonates of the formula R8-OC(O)-O-R9, wherein R8 and R9 may be the same or different, representing straight or branched C4 to C12 and particularly C6 to C10 alkyl chains; these carbonate oils may be dicaprylyl carbonate (or dioctyl carbonate) sold by BASF under the name Cetiol CC®, bis(2-ethylhexyl) carbonate sold by Evonik under the name Tegosoft DEC®, dipropylheptyl carbonate (from BASF's Cetiol 4 AII), dibutyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, dipentyl carbonate, diisononyl carbonate or dinonyl carbonate and more particularly dioctyl carbonate.

[0198] More specifically, the polar non-volatile hydrocarbon-based oils are selected from:

[0199] ii) Triglycerides composed of fatty acid esters of glycerol, particularly those whose fatty acids can have a range from C4 to C6. 36 And especially from C 18 To C 36The chain length of these oils may be linear or branched, and saturated or unsaturated; by way of example, particularly mentionable are heptanoic or caprylic triglycerides, caprylic / capric triglycerides, vegetable oils such as wheat germ oil, sunflower oil, grapeseed oil, sesame seed oil, corn oil, almond oil, castor oil, shea butter, avocado oil, olive oil, soybean oil, sweet almond oil, palm oil, rapeseed oil, cottonseed oil, hazelnut oil, macadamia nut oil, jojoba oil, alfalfa oil, pumpkin oil, zucchini oil, blackcurrant oil, evening primrose oil, millet oil, barley oil, quinoa oil, rye oil, safflower oil, candelilla oil, passion fruit oil, musk rose oil, peanut oil, coconut oil, argan oil, passion fruit oil, torreya nut oil; the liquid fraction of shea butter and the liquid fraction of cocoa butter; and mixtures thereof.

[0200] According to a particular embodiment, the composition comprises at least one oil selected from the group consisting of:

[0201] - Triglyceride-type polar nonvolatile hydrocarbon oils composed of fatty acid esters of glycerol, particularly whose fatty acids can have a range from C4 to C6. 36 And especially from C 18 To C 36 These oils, with varying chain lengths, may be straight-chain or branched, saturated or unsaturated, and are selected from soybean oil, jojoba seed oil, shea butter, caprylic and caprylic triglycerides, and mixtures thereof.

[0202] - Volatile C8-C 16 Alkane oils, such as C9-C 12 Alkanes and isoalkanes,

[0203] - Non-polar, non-volatile oils, such as squalane.

[0204] - Synthetic ether-type polar nonvolatile hydrocarbon oils of formula R1-O-R2, wherein R1 and R2 can be the same or different, independently indicating straight-chain, branched, or cyclic C6-C... 24 Alkyl groups, particularly C6-C 18 Alkyl groups, and more specifically C8-C 12 Alkyl groups, such as dioctyl ether,

[0205] - Non-volatile silicone oils, such as polydimethylsiloxane,

[0206] - Saturated, unsaturated, straight-chain or branched C64 molecules that are liquid at room temperature (25°C) 10 -C 26 Fatty alcohol-type polar non-volatile hydrocarbon oils, such as octyl dodecyl alcohol.

[0207] - Polar, non-volatile hydrocarbon-based oils, such as carbonates of the formula R8-OC(O)-O-R9, where R8 and R9 can be the same or different, representing straight-chain or branched C4 to C6 chains. 12 Especially C6 to C 10 Alkyl chains, such as dioctyl carbonate, and

[0208] - A mixture of them.

[0209] According to a specific embodiment, the oil is selected from the group consisting of: octyldodecanoate, soybean oil, shea butter, dioctyl carbonate, polydimethylsiloxane, jojoba oil, isoparaffins, isononyl isononanoate, caprylic / capric triglyceride, C9-C 12 Alkanes, squalane, dioctyl ether, and mixtures thereof.

[0210] According to a specific embodiment, the oil is selected from the group consisting of: soybean oil, shea butter, jojoba oil, isononyl isononanoate, caprylic / capric triglyceride, and mixtures thereof.

[0211] In a preferred embodiment, the composition according to the invention does not contain nonpolar, nonvolatile hydrocarbon oils.

[0212] In a preferred embodiment, the composition according to the invention does not contain a nonpolar, nonvolatile hydrocarbon oil selected from straight-chain or branched compounds of mineral or synthetic origin, such as: i) squalane, such as reference name Neossance Squalane, isoeicosane, sold by Amyris; ii) mixtures of straight-chain saturated hydrocarbons, particularly C14-C30 hydrocarbons and more particularly C15-C28 hydrocarbons, such as mixtures whose INCI names are, for example, mixtures of (C15-C19) alkanes, (C18-C21) alkanes, and (C21-C28) alkanes, such as Gemseal 40, Gemseal 60, and Gemseal 120 sold by Total, Emogreen L19 sold by SEPPIC, and Emogreen L15 sold by SEPPIC; iii) Hydrogenated or non-hydrogenated polybutene, such as the Indopol series of products sold by Ineos Oligomers, i.e., products with the INCI name hydrogenated polyisobutene; iv) hydrogenated or non-hydrogenated (especially hydrogenated) polyisobutene, such as the Parleam® series of non-volatile compounds sold by Nippon Oil Fats; v) hydrogenated or non-hydrogenated polydecene, such as the Puresyn® series of non-volatile compounds sold by ExxonMobil; vi) decene / butene copolymers, butene / isobutene copolymers; vii) paraffin oils; and viii) mixtures thereof.

[0213] In a preferred embodiment, the composition according to the invention does not contain paraffin oil.

[0214] In a preferred embodiment, the composition according to the invention does not contain petrolatum.

[0215] In a preferred embodiment, the composition according to the invention does not contain paraffin oil, petrolatum, or mixtures thereof.

[0216] Oils according to the invention can advantageously be present in compositions according to the invention at levels conventional for cosmetic compositions, particularly at levels that allow them to exert their cosmetic effects in compositions according to the invention (especially in cosmetic compositions according to the invention), and more particularly at levels that allow them to exert their cosmetic effects when they are the only oils exerting cosmetic effects in compositions according to the invention.

[0217] Oils can perform various cosmetic functions, such as thickening agents, factors that affect the behavior of emulsions in cold conditions, or to give compositions a smooth appearance (especially in the case of emulsions). They can also help promote the spread and smoothness of compositions on the skin and their penetration. Finally, oils may act on the skin through their occlusive effect, their lubricating effect (touch), or their emollient / moisturizing effect.

[0218] The compositions according to the invention may contain a total oil content ranging from 1 wt% to 80 wt% relative to the total weight of the composition, particularly from 2 wt% to 60 wt% relative to the total weight of the composition, more particularly from 5 wt% to 40 wt%, and even more particularly from 10 wt% to 30 wt% relative to the total weight of the composition.

[0219] The term "total oil content" refers to the sum of the contents of each of the previously mentioned oils present in the composition, or, when only one of these oils is present in the composition, the content of that oil.

[0220] Aromatic alcohols

[0221] The compositions according to the invention may further comprise at least one aromatic alcohol of formula (I), its salt (especially a salt of an organic or inorganic base), its optical isomer, its geometric isomer, or a solvate thereof, such as a hydrate:

[0222] [Chemical Formula 1]

[0223]

[0224] in:

[0225] - R 1 Groups selected from the following groups:

[0226] a) Straight-chain or branched hydroxy (C1-C4) alkyl groups, especially hydroxy (C1-C2) alkyl groups.

[0227] b) Selected from -OR 5 -C(O)R 6 -C(O)OR 7 and -(CH2) n -C(H)(R 8 )-C(O)R 9 group,

[0228] in:

[0229] R 5 This indicates a straight-chain or branched (C3-C4) alkyl group optionally substituted with one or more hydroxyl (OH) groups.

[0230] R 6Represents a hydrogen atom, or a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group optionally substituted with one or more hydroxyl groups.

[0231] R 7 This indicates a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group optionally substituted with one or more hydroxyl groups.

[0232] R 8 Represents a hydrogen atom or a straight-chain or branched (C1-C4) alkyl group, such as methyl or ethyl, particularly R 8 Represents a hydrogen atom;

[0233] R 9 Representing a hydrogen atom, or optionally substituted with one or more hydroxyl groups, a straight or branched chain, particularly a straight chain (C1-C2). 12 Alkyl groups, or linear or branched groups optionally substituted with one or more hydroxyl groups, particularly linear (C2-C4) 12 alkenyl,

[0234] n can be 0, 1, or 2, and in particular, n can be 1.

[0235] - R 2 This represents a hydrogen atom; a halogen atom, especially a chlorine atom; or a hydroxyl group; and

[0236] - R 3 Represents a hydrogen atom, or a group selected from hydroxyl and straight-chain or branched (C1-C6) alkoxy groups, especially (C1-C4) alkoxy groups (such as methoxy-OCH3 or ethoxy-OC2H5); in particular, R 3 Represents a hydrogen atom or an ethoxy group; and

[0237] - R 4 It is a hydrogen atom or a hydroxyl group;

[0238] It should be understood that group R 1 R 2 R 3 or R 4 At least one of them contains or represents a hydroxyl group.

[0239] More specifically, the aromatic alcohol of formula (II) of the present invention is as follows:

[0240] - When R 1 The group -C(O)OR represents 7 When, then R 2 It is an -OH group;

[0241] - When R 1 The group -C(O)R represents 6 When, then R 2 R 3 and R4 At least one of them is an -OH group;

[0242] - When R 1 Represents the group –(CH2). n -C(H)(R 8 )-C(O)R 9 When, then R 2 It is an -OH group.

[0243] In particular, aromatic alcohols can have the following formula (I):

[0244] [Chemical Formula 2]

[0245]

[0246] in:

[0247] R 1 Choose from the following groups:

[0248] i) Straight-chain or branched hydroxy (C1-C4) alkyl groups, especially hydroxy (C1-C2) alkyl groups, such as hydroxymethyl or hydroxyethyl.

[0249] ii) Group -OR 5 , where R 5 It indicates (C3-C4) hydroxyalkyl, especially -OR 5 It represents -O-CH2-CH(OH)-CH2OH.

[0250] iii) Group -C(O)R 6 , where R 6 Indicates straight-chain or branched (C1-C4) alkyl, especially -C(O)R 6 It represents -C(O)-CH3,

[0251] iv) Group -C(O)OR 7 , where R 7 Indicates straight-chain or branched (C1-C4) alkyl, especially R 7 Indicates methyl, ethyl, propyl, isopropyl, butyl, isobutyl, or benzyl, and

[0252] v) Group -CH2-CH2-C(O)R 9 , where R 9 Indicates a straight-chain or branched (C1-C6) alkyl group, particularly -CH2-CH2-C(O)R 9 This indicates the -CH2-CH2-C(O)CH3 group;

[0253] R 2 Choose from the following groups: hydrogen atoms; halogen atoms, especially chlorine atoms; and hydroxyl groups;

[0254] R 3 It is a hydrogen atom, a methoxy group, or an ethoxy group; and

[0255] R 4 It is a hydrogen atom or a hydroxyl group;

[0256] It should be understood that group R 1 R 2 or R 4 At least one of them contains or represents a hydroxyl group.

[0257] Such compounds often act as preservatives, particularly in cosmetic compositions. Some also function as fragrances, especially in cosmetic compositions.

[0258] The term "organic or inorganic base salt" means a salt of a base or basic reagent as defined below. Examples of base salts may include alkali metal hydroxides such as sodium hydroxide, potassium hydroxide, and lithium hydroxide; alkaline earth metal hydroxides such as calcium hydroxide and magnesium hydroxide; hydroxides of other metals such as aluminum hydroxide and zinc hydroxide; ammonia and organic amines such as unsubstituted or hydroxylated mono-, di-, or tri-alkylamines; dicyclohexylamine; tributylamine; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono-, bis-, or tri-(2-hydroxyalkylamines) such as mono-, bis-, or tri-(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, tri(hydroxymethyl)methylamine; N,N-dialkyl-N-(hydroxyalkyl)amines such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucosamine; and amino acids such as arginine and lysine.

[0259] For the purposes of this invention, the term "alkyl group" or "alkyl radical" means a saturated, straight-chain or branched, substituted or unsubstituted monovalent hydrocarbon group, particularly methyl, ethyl, propyl, isopropyl, butyl or tert-butyl.

[0260] The term "hydroxyalkyl" refers to a saturated, straight-chain or branched hydrocarbon group containing at least one -OH group. Hydroxy (C1-C4)alkyl is a saturated, straight-chain or branched C1-C4 hydrocarbon group containing at least one -OH group (particularly a single -OH group). Hydroxy (C1-C2)alkyl is a saturated C1-C2 hydrocarbon group containing at least one -OH group (particularly a single -OH group).

[0261] According to specific embodiments, the hydroxy (C1-C4)alkyl group is selected from the group consisting of: hydroxymethyl, 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 1-(hydroxymethyl)-2-methylpropyl, 2-hydroxybutyl, 3-hydroxybutyl, 4-hydroxybutyl, 2,3-dihydroxypropyl, 1-(hydroxymethyl)-2-hydroxyethyl, 2,3-dihydroxybutyl, 3,4-dihydroxybutyl, and 2-(hydroxymethyl)-3-hydroxypropyl. In particular, the hydroxy (C1-C4)alkyl group is hydroxymethyl or 2-hydroxyethyl.

[0262] The term "halogen atom" refers to one of the chemical elements in Group 17 of the periodic table, namely fluorine, chlorine, bromine, or iodine. In particular, the halogen atom is the chlorine atom.

[0263] According to a specific embodiment, R 1 Select from the following groups: (C1-C2)hydroxyalkyl, 2-hydroxyethyl, hydroxymethyl, -O-CH2-CH(OH)-CH2OH, -CH2-CH2-C(O)-CH3, and -C(O)-OCH3.

[0264] R 2 Choose from the following groups: hydrogen atoms, halogen atoms (especially chlorine atoms), and hydroxyl groups.

[0265] R 3 Choose from the group consisting of hydrogen atoms and -O-C2-H5 groups, and

[0266] R 4 It is a hydrogen atom.

[0267] According to one embodiment, R 1 R represents hydroxy(C1-C4)alkyl, more particularly hydroxy(C1-C2)alkyl. 2 R represents a hydrogen atom. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0268] According to a specific embodiment, R 1 R represents 2-hydroxyethyl. 2 R represents a hydrogen atom. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0269] According to a specific embodiment, R 1 R represents hydroxymethyl. 2 R represents a hydrogen atom. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0270] According to a specific embodiment, R 1 Represents the group -OR 5 (where R)5 Indicates a straight-chain or branched (C3-C4) alkyl group substituted with one or more hydroxyl groups; R 2 R represents a halogen atom. 3 Represents a hydrogen atom and R 4 Represents a hydrogen atom. More specifically, R 1 Represents the group -OR 5 (where R) 5 Indicates a straight-chain (C3-C4) alkyl group substituted with two hydroxyl groups, R 2 R represents a halogen atom. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0271] According to a specific embodiment, R 1 Represents the -O-CH2-CH(OH)-CH2OH group, R 2 R represents a chlorine atom. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0272] According to a specific embodiment, R 1 The group represented is -(CH2). n -C(H)(R) 8 -C(O)R 9 , where R 8 Represents a hydrogen atom or a methyl or ethyl group, and R 9 Indicates straight-chain (C1-C1) optionally substituted with hydroxyl groups. 12 )alkyl or optionally substituted with hydroxyl (C2-C 12 )alkenyl, and n as defined above, in particular n is 1, R 2 R represents a hydroxyl group. 3 It represents the -OCH3 or -OC2H5 group and R 4 Represents a hydrogen atom. More specifically, R 1 The group -CH2-CH2-C(O)R represents the radical. 9 (R) 9 Indicates a straight chain (C1-C) 12 )alkyl, especially straight-chain (C1-C6) alkyl such as methyl), R 2 R represents a hydroxyl group. 3 Represents the -OC2H5 group and R 4 It represents a hydrogen atom.

[0273] According to a specific embodiment, R 1 The group -C(O)OR represents 7 (where R) 7 Represents a straight-chain or branched (C1-C4) alkyl, phenyl, or benzyl group optionally substituted with one or more hydroxyl groups. 2R represents a hydroxyl group. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0274] According to a specific embodiment, R 1 Represents the -C(O)-OCH3 group, R 2 R represents a hydroxyl group. 3 Represents a hydrogen atom and R 4 It represents a hydrogen atom.

[0275] According to specific embodiments, the aromatic alcohols of formula (II) are selected from the group consisting of: phenethyl alcohol; benzyl alcohol; chlorophenoxy-1,2-propanediol (also known as 3-(4-chlorophenoxy)-1,2-propanediol); gingerone; ethyl gingerone (also known as 4-(3-ethoxy-4-hydroxyphenyl)but-2-one); vanillin; parabens, especially (C1-C6) alkyl esters or aryl esters of parabens, especially methylparaben, ethylparaben, propylparaben, isopropylparaben, butylparaben, isobutylparaben, or benzylparaben; their salts and mixtures thereof.

[0276] According to specific embodiments, the aromatic alcohols of formula (II) are selected from the group consisting of: phenethyl alcohol; benzyl alcohol; chlorophenoxy ether (also known as 3-(4-chlorophenoxy)-1,2-propanediol); gingerone; ethyl gingerone (also known as 4-(3-ethoxy-4-hydroxyphenyl)but-2-one); p-hydroxybenzoic acid esters, especially methyl p-hydroxybenzoate; their salts and mixtures thereof.

[0277] The compositions according to the invention specifically comprise a total content of aromatic alcohols of formula (II) ranging from 0.01 wt% to 3 wt% relative to the total weight of the composition, particularly from 0.05 wt% to 1.5 wt%, and more particularly from 0.1 wt% to 1.0 wt% relative to the total weight of the composition.

[0278] The term “total content of aromatic alcohols of formula (II)” means the total content of each of the aromatic alcohols of formula (II) present in the composition, or, when only one aromatic alcohol of formula (II) is present in the composition, the content of that aromatic alcohol of formula (II).

[0279] Organic fillers

[0280] The compositions according to the present invention may also contain one or more organic fillers.

[0281] For the purposes of this invention, the term "organic filler" is intended to refer to any form of colorless or white organic, natural or synthetic solid particles that are insoluble and dispersed in the medium of the composition.

[0282] The compositions according to the invention may further comprise at least one organic filler selected from the following: unmodified starch, N-acyl amino acids, their salts, and mixtures thereof.

[0283] Unmodified starch

[0284] The compositions according to the present invention may contain one or more unmodified starches.

[0285] For the purposes of this invention, the term "unmodified starch" means virgin starch, or starch that has not undergone chemical or physical modification, especially starch that has not been modified by one or more of the following reactions: pregelatinization, oxidation, crosslinking, esterification, etherification, amidation, or heat treatment.

[0286] The unmodified starch molecules that can be used in this invention can be derived from any plant starch source, especially cereals and tubers; more specifically, they can be starches from corn, rice, cassava, barley, potato, wheat, sorghum, peas or oats.

[0287] According to a specific embodiment, the unmodified starch is selected from corn starch, rice starch, potato starch, and mixtures thereof; in particular, the unmodified starch is selected from corn starch or potato starch.

[0288] According to specific embodiments, the compositions according to the invention are completely free of tapioca starch; in particular, the compositions according to the invention are completely free of unmodified tapioca starch.

[0289] According to a specific embodiment, the unmodified starch used in the compositions of the present invention is corn starch, such as corn starch sold by Roquette under the name Beauty-by-Roquette ST005.

[0290] Starch may be present in the composition according to the invention in a range of 0.1% to 10% by weight, particularly 0.5% to 5% by weight, more particularly 1% to 2.5% by weight, such as 1% by weight, 1.5% by weight or 2% by weight, relative to the total weight of the composition.

[0291] N-acyl amino acids and their salts

[0292] The compositions according to the invention may contain one or more N-acyl amino acids, their salts, and mixtures thereof.

[0293] The term "salt" for N-acyl amino acids according to the present invention means a salt formed from an inorganic or organic acid or an inorganic or organic base.

[0294] Examples of acid salts include sulfates, citrates, acetates, oxalates, chlorides, bromides, iodides, nitrates, hydrogen sulfates, phosphates, isonicotinates, lactates, salicylates, tartrates, tannins, pantothenates, hydrogen tartrates, ascorbic acid salts, succinates, maleates, gentianates, fumarates, gluconates, glucurons, sucrose salts, formates, benzoates, glutamates, methanesulfonates, ethanesulfonates, benzenesulfonates, p-toluenesulfonates, and aspartate salts.

[0295] Examples of alkali salts include hydroxides of alkali metals such as sodium, potassium, and lithium; hydroxides of alkaline earth metals such as calcium and magnesium; hydroxides of other metals such as aluminum and zinc; ammonia and organic amines such as unsubstituted or hydroxylated mono-, di-, or trialkylamines; dicyclohexylamine; tributylamine; pyridine; N-methyl-N-ethylamine; diethylamine; triethylamine; mono-, bis-, or tri(2-hydroxyalkylamines) such as mono-, bis-, or tri(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, tri(hydroxymethyl)methylamine, N,N-dialkyl-N-(hydroxyalkyl)amines such as N,N-dimethyl-N-(2-hydroxyethyl)amine; N-methyl-D-glucosamine; and amino acids such as arginine and lysine.

[0296] N-acyl amino acids suitable as organic fillers according to the invention comprise at least one acyl group containing 8 to 22 carbon atoms, particularly 2-ethylhexanoyl, hexanoyl, lauroyl, myristoyl, palmitoyl, stearoyl, or cocoyl, especially lauroyl.

[0297] The amino acid may be, for example, lysine, glutamic acid or alanine, preferably lysine.

[0298] Amino acids can be in D or L configuration, especially L configuration.

[0299] According to a specific embodiment of the invention, the C8-C22 N-acyl amino acid is selected from lauroyl lysine, its salts and mixtures thereof, particularly N-lauroyl-L-lysine, its salts and mixtures thereof.

[0300] N-Lauroyl-L-lysine is sold in particular by Ajinomoto Co., Ltd. of Japan under the name Amihope LL®.

[0301] N-acyl amino acids and their salts may be present in the composition according to the invention in a range of 0.1% to 15% by weight, particularly 1% to 10% by weight, more particularly 2% to 4% by weight, such as 3% by weight, relative to the total weight of the composition.

[0302] Organic fillers may be present in the compositions according to the invention in a total amount ranging from 0.1% to 15% by weight, particularly from 0.5% to 10% by weight, and more particularly from 1% to 4% by weight relative to the total weight of the composition.

[0303] The composition according to the invention may comprise one or more endosomal agents according to the invention and one or more organic fillers, wherein the mass ratio of endosomal agent to organic filler is between 0.0001 and 0.04, particularly between 0.0002 and 0.004, and more particularly between 0.0006 and 0.002.

[0304] Nonionic surfactants

[0305] The compositions according to the invention may further comprise at least one nonionic surfactant, particularly selected from nonionic surfactants containing one or more carbohydrate residues, C6-C 30 Fatty acid alkylolamide type nonionic surfactant.

[0306] For the purposes of this invention, the term "surfactant" refers to any compound that alters the surface tension between two surfaces. Surfactant compounds are amphiphilic molecules, meaning they have two parts with different polarities: one part is lipophilic (retaining fatty acids) and nonpolar, and the other part is hydrophilic (miscible with water) and polar. Therefore, they allow two immiscible phases to dissolve in such a way that they interact with the nonpolar (i.e., lipophilic and therefore hydrophobic) phase via their hydrophobic portion, while they interact with the other polar phase via their hydrophilic portion.

[0307] The term "nonionic surfactant" refers to a surfactant that has no net charge (i.e., it does not ionize in water).

[0308] A nonionic surfactant containing one or more carbohydrate residues.

[0309] The compositions according to the invention may further contain at least one nonionic surfactant comprising one or more carbohydrate residues.

[0310] For the purposes of this invention, the term "carbohydrate" refers to sugar- or carbohydrate-type compounds, corresponding to molecules that are essentially composed of carbon, hydrogen, and oxygen atoms.

[0311] According to a particular embodiment, the carbohydrate residue is a monosaccharide containing 5 to 6 carbon atoms, more particularly selected from glucose, fructose, xylose or galactose, and even more particularly glucose.

[0312] According to a specific embodiment, the nonionic surfactant containing one or more carbohydrate residues is selected from:

[0313] (i) Fatty acid esters of sugars, such as those with straight or branched chains, saturated or unsaturated C6-C... 22 Especially C 16 -C 20 Hydrocarbon-chain glucose or alkyl glucose fatty acid (poly)glycerides;

[0314] (ii) Fatty alcohol ethers of sugars, such as alkyl (poly)glycosides; and

[0315] (iii) Their mixture.

[0316] According to a specific embodiment, the nonionic surfactant comprising one or more carbohydrate residues is selected from alkyl (poly)glycosides, and C6-C glycosides having straight or branched chains, and being saturated or unsaturated. 22 Especially C 16 -C 20 Hydrocarbon-based glucose or alkyl glucose fatty acid (poly)glycerides, and mixtures thereof.

[0317] - Alkyl (poly)glycoside

[0318] Alkyl (poly)glycoside type nonionic surfactants are particularly represented by the following general formula (III):

[0319] [Chemical Formula 3]

[0320]

[0321] in:

[0322] - R 1 It means a straight-chain or branched alkyl or alkenyl group containing 6 to 24 carbon atoms, especially 8 to 20 carbon atoms, or an alkylphenyl group containing 6 to 24 carbon atoms, especially 8 to 20 carbon atoms;

[0323] - R 2 This indicates an alkylene group containing 2 to 4 carbon atoms.

[0324] - G represents a sugar unit containing 5 to 6 carbon atoms;

[0325] - t indicates values ​​from 0 to 10, and specifically from 0 to 4;

[0326] -v indicates a range from 1 to 15, and specifically from 1 to 4.

[0327] According to a specific embodiment, the alkyl (poly)glycoside surfactant is a compound of the above formula, wherein:

[0328] - R 1Indicates a straight-chain or branched, saturated or unsaturated alkyl group containing 8 to 20 carbon atoms.

[0329] - R 2 This indicates an alkylene group containing 2 to 4 carbon atoms.

[0330] -t indicates a value ranging from 0 to 3, and specifically equal to 0.

[0331] - G indicates glucose, fructose, or galactose, especially glucose.

[0332] - The degree of aggregation (i.e., the v value) may range from 1 to 15, and specifically from 1 to 4; the average degree of aggregation is more specifically from 1 to 2.

[0333] The glucosidic bonds between sugar units are usually of type 1-6 or 1-4, and especially type 1-4.

[0334] Examples of alkyl (poly)glycosides include octanoyl / decanoyl glucoside, such as the product sold by Seppic under the name Oramix CG 110L®; decyl glucoside, sold by Applechem under the name Sorbithix L-100®; arachidonic glucoside, optionally as a mixture with arachidonic alcohol and betaine alcohol, such as the product sold by Seppic under the name Montanov 202®; cetearyl glucoside, optionally as a mixture with cetearyl alcohol, such as the product sold by Seppic under the name Montanov 68MB®, by BASF under the name EmulgadePL 68 / 50®, and by Evonik Goldschmidt under the name Tego Care CG 90 MB®; and cocoyl glucoside, such as the product sold by BASF under the name Lamesoft. Products sold by PO65®; octyl dodecyl xyloside, such as those sold by Sepik under the name Fluidanov 20X.

[0335] Alkyl (poly)glycosides can be used as mixtures with at least one fatty alcohol, especially fatty alcohols containing 6 to 24 carbon atoms and more particularly 8 to 20 carbon atoms.

[0336] For example, fatty alcohols and alkyl (poly)glycosides (whose alkyl moiety is the same as that of the selected fatty alcohol) can be used in combination.

[0337] Fatty alcohol / alkyl polysaccharide emulsion mixtures as defined above are known in themselves. They are particularly described in patent applications WO 92 / 06778, WO 95 / 13863 and WO 98 / 47610, and are prepared according to the preparation methods indicated in these documents.

[0338] In fatty alcohol / alkyl (poly)glycoside mixtures, products sold by Sepik Corporation under the name Montanov® may be mentioned, such as the following mixtures:

[0339] - Arachinoyl alcohol and betaine alcohol / arachidonic glucoside—Montanov 202®

[0340] - Cetearyl alcohol / Cetearyl glucoside—Montanov 68MB®.

[0341] In certain embodiments, the compositions according to the invention comprise an alkyl (poly)glycoside surfactant selected from the following: octanoyl / decanoyl glucoside, arachidonic glucoside, and mixtures thereof.

[0342] In certain embodiments, the compositions according to the invention do not contain any decyl glucoside.

[0343] - Fatty acid (poly)glycerides of glucose or alkyl glucose

[0344] Contains straight or branched, saturated or unsaturated C6-C 22 Hydrocarbon-chain glucose or alkyl glucose fatty acid (poly)glycerides, particularly those containing straight-chain saturated C6-C groups. 22 C in particular 16 - 20 More specifically C 18 Alkyl glucose fatty acid (poly)glycerides with hydrocarbon chains.

[0345] In C6-C containing straight or branched chains, saturated or unsaturated 22 Among fatty acid (poly)glycerides of glucose or alkyl glucose with hydrocarbon chains, polyglycerol-3-methylglucose distearate is the most particularly preferred.

[0346] In commercial products, it is permissible to mention products sold by Evonik High Schmidt under the name Tego Care 450.

[0347] Nonionic surfactants containing one or more carbohydrate residues may be present in the compositions according to the invention in an amount ranging from 0.01 wt% to 10 wt% relative to the total weight of the composition, particularly from 0.05 wt% to 8 wt%, more particularly from 0.1 wt% to 5 wt%, and even more particularly from 0.2 wt% to 3 wt% relative to the total weight of the composition.

[0348] The composition according to the invention may comprise one or more endosomal agents according to the invention and one or more nonionic surfactants according to the invention comprising one or more carbohydrate residues, wherein the mass ratio of endosomal agent to nonionic surfactant comprising one or more carbohydrate residues is between 0.0001 and 0.5, particularly between 0.0002 and 0.1, more particularly between 0.0004 and 0.05, and even more preferably between 0.0006 and 0.02.

[0349] C6-C 30 Fatty acid alkanolamide

[0350] The composition according to the invention may also contain at least one component selected from C6-C. 30 Nonionic surfactants of fatty acid alkylolamides.

[0351] Such surfactants can be selected from mono- and di-alkylolamides of formula (IV):

[0352] [Chemical Formula 4]

[0353]

[0354] in:

[0355] R 1 It is a straight-chain or branched, saturated or unsaturated hydrocarbon group containing 6 to 30 carbon atoms.

[0356] R 2 and R 3 Independently hydrogen or a straight-chain or branched, saturated or unsaturated alkol group containing 1 to 10 carbon atoms, provided that R 2 and R 3 Only one of them is hydrogen.

[0357] Examples of surfactants of this type include lauric acid monoethanolamide, lauric acid diethanolamide, lauric acid monopropanolamide, lauric acid monoisopropanolamide, myristic acid monoethanolamide, myristic acid diethanolamide, palmitic acid monoethanolamide, stearic acid monoethanolamide (stearamide MEA), oleic acid monoethanolamide, oleic acid diethanolamide, oleic acid monoisopropanolamide, coconut oil fatty acid monoethanolamide (cocamide MEA), coconut oil fatty acid monopropanolamide, coconut oil fatty acid monoisopropanolamide (cocamide MIPA), erucic acid diethanolamide, palm vegetable oil fatty acid monoethanolamide, and mixtures thereof.

[0358] According to a specific embodiment, in formula (IV), R 1 It is a straight-chain or branched, saturated or unsaturated hydrocarbon group containing 8 to 18 carbon atoms.

[0359] R 2 and R 3 Independently, it is a hydrogen group or a straight-chain or branched, saturated or unsaturated alkanoic group containing 2 to 5 carbon atoms, provided that R 2 and R 3 Only one of them is hydrogen.

[0360] According to a specific embodiment, in formula (IV), R 2 It is hydrogen, and R 3 It is a saturated straight-chain or branched alkol group containing 2 to 5 carbon atoms.

[0361] According to a specific embodiment, the appropriate C6-C of formula (IV) 30 Fatty acid alkanolamides are selected from coconut oil fatty acid monoethanolamide (INCI: cocoamide MEA or cocoamide monoethanolamine), coconut oil fatty acid monoisopropanolamide (INCI: cocoamide MIPA or cocoamide monoisopropanolamine), and mixtures thereof.

[0362] Such products are commercially available, for example, coconut oil fatty acid monoethanolamide (cocamide MEA) sold by Cognis (BASF) under the name Comperlan® 100, and coconut oil fatty acid monoisopropanolamide (cocamide MIPA) sold by Innospec Active Chemicals under the trade name Empilan® CIS.

[0363] According to a specific embodiment, the C6-C 30 Fatty acid alkanolamides are cocamide monoisopropanolamines.

[0364] According to the C6-C of the present invention 30 Fatty acid alkanolamides may be present in amounts ranging from 0.5% to 10% by weight, more particularly from 0.1% to 5% by weight, relative to the total weight of the composition.

[0365] According to a particular embodiment, the composition according to the invention comprises less than 2% by weight of fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition; more particularly, the composition according to the invention comprises less than 1% by weight of fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition, or even contains no (0% by weight) fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition, and particularly does not contain any stearic acid.

[0366] According to specific embodiments, the compositions according to the invention comprise less than 0.5% by weight, more particularly less than 0.1% by weight, of benzoic acid and / or its salts (especially alkali metal or alkaline earth metal benzoates, such as sodium benzoate), sorbic acid and / or its salts (especially alkali metal or alkaline earth metal sorbates, such as potassium sorbate), or even contain (0% by weight, relative to the total weight of the composition) benzoic acid and / or its salts (such as sodium benzoate) and sorbic acid and / or its salts (such as potassium sorbate).

[0367] According to a specific embodiment, the composition according to the invention comprises carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum, hydrogenated soybean lecithin, sodium alginate, polyacrylamide methyl propane sulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and senna gum in an amount less than 0.1% by weight relative to the total weight of the composition; more particularly, according to an embodiment of the invention, the composition is free of (0% by weight relative to the total weight of the composition) carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum, hydrogenated soybean lecithin, sodium alginate, polyacrylamide methyl propane sulfonic acid, carbomer, cellulose, sodium polyacrylate, konjac gum, agar, and senna gum.

[0368] According to a particular embodiment, the composition according to the invention comprises an amount of anionic surfactant less than 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of (0% by weight relative to the total weight of the composition) anionic surfactant.

[0369] According to a particular embodiment, the composition according to the invention comprises a cationic surfactant in an amount less than or equal to 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of (0% by weight relative to the total weight of the composition) cationic surfactant.

[0370] According to a particular embodiment, the composition according to the invention comprises an amount of amphoteric surfactant less than or equal to 0.5% by weight relative to the total weight of the composition; more particularly, the composition is free of (0% by weight relative to the total weight of the composition) amphoteric surfactant.

[0371] According to a particular embodiment, the composition according to the invention comprises an amount of zwitterionic surfactant less than or equal to 0.5% by weight relative to the total weight of the composition, and more particularly contains no zwitterionic surfactant (0% by weight relative to the total weight of the composition).

[0372] According to a specific embodiment, the composition according to the invention comprises an anionic, cationic, amphoteric, and zwitterionic surfactant in an amount less than 0.5% by weight relative to the total weight of the composition, more particularly less than 0.1% by weight relative to the total weight of the composition, and even more particularly less than 0.01% by weight relative to the total weight of the composition; and more preferably, according to a specific embodiment, the composition is free of (0% by weight relative to the total weight of the composition) anionic, cationic, amphoteric, and zwitterionic surfactants.

[0373] According to a specific embodiment, the composition according to the invention comprises less than 0.5% by weight of glyceryl stearate citrate, alkyl sulfate (such as sodium lauryl sulfate), alkyl ether sulfate (such as sodium lauryl ether sulfate), disodium cocoamphodiacetate, fatty acid polyglycerol esters (such as polyglycerol-4 isostearate, polyglycerol-4 diisostearate / polyhydroxystearate / sebate), sodium stearate, glyceryl stearate citrate, alkyl sulfate (such as sodium lauryl sulfate), alkyl ether sulfate (such as sodium lauryl ether sulfate), disodium cocoamphodiacetate, fatty acid polyglycerol esters (such as polyglycerol-4 isostearate and polyglycerol-4 diisostearate / polyhydroxystearate / sebate), and sodium stearate.

[0374] According to a specific embodiment, the composition according to the invention comprises less than 1% by weight of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin, ellipsoidal amorphous hollow silica particles and mica relative to the total weight of the composition, and more particularly comprises less than 0.5% by weight of kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin and mica relative to the total weight of the composition, or even contains no (0% by weight relative to the total weight of the composition) kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin, ellipsoidal amorphous hollow silica particles and mica.

[0375] According to specific embodiments, the compositions according to the invention comprise less than 0.1% by weight of fatty acids that are solid at room temperature (25°C) relative to the total weight of the composition, and particularly do not contain any stearic acid; benzoic acid and / or its salts (especially alkali metal or alkaline earth metal benzoates, such as sodium benzoate), sorbic acid and / or its salts (especially alkali metal or alkaline earth metal sorbates, including potassium sorbate); carrageenan, gellan gum, dextran gum, gum arabic, pectin, xanthan gum, guar gum such as hydroxypropyl guar gum, hydrogenated soybean lecithin, sodium alginate, poly… Acrylamidomethylpropanesulfonic acid, carbomer, sodium polyacrylate, konjac gum, agar, and taffy gum; glyceryl stearate citrate, alkyl sulfates (such as sodium lauryl sulfate), alkyl ether sulfates (such as sodium lauryl ether sulfate), disodium cocoamphodiacetate, fatty acid polyglycerol esters (such as polyglycerol-4 isostearate and polyglycerol-4 diisostearate / polyhydroxystearate / sebaceous ester), and sodium stearate; kaolin, perlite, titanium dioxide, talc, cellulose, boron nitride, maltodextrin, ellipsoidal amorphous silica hollow particles, and mica.

[0376] According to a specific embodiment, the composition according to the invention comprises hydroxypropyl methylcellulose.

[0377] According to a particular embodiment, the composition according to the invention comprises water.

[0378] According to a specific embodiment, the composition according to the invention comprises water and hydroxypropyl methylcellulose.

[0379] The compositions according to the invention may contain a preservative in an amount of less than 2% by weight, particularly less than 1% by weight, and particularly less than 0.5% by weight relative to the total weight of the composition.

[0380] Depending on the intended application, compositions, especially cosmetic compositions, may also contain ingredients commonly used in the field under consideration, in amounts suitable for the desired presentation.

[0381] The compositions according to the invention can be in any form commonly used in the cosmetics industry.

[0382] Its form can be, in particular, aqueous or water-alcohol solutions (which may be gelled), water-based dispersions (which may be two-phase dispersions), oil-in-water or water-in-oil emulsions or multiple emulsions, gels (especially hydrogels), or dispersions of oil in an aqueous phase (especially using microspheres, which may be polymer particles or even better ionic and / or nonionic lipid vesicles). In particular, compositions according to the invention can be in the form of gels, especially hydrogels. It can also be anhydrous compositions. The term "anhydrous composition" means a composition containing less than 10% by weight of water, particularly less than 5% by weight, more particularly less than 2% by weight of water or even less than 0.5% by weight of water, and especially free of water, where the water is not added during the preparation of the composition but corresponds to residual water provided by the mixed components. The composition may have more or less fluid-liquid consistency.

[0383] The compositions according to the invention are particularly suitable for topical application.

[0384] Therefore, the compositions according to the invention can include all the ingredients commonly used in the contemplated topical applications and administrations.

[0385] The compositions according to the invention can advantageously be in emulsion form (especially obtained by dispersing an aqueous phase in a fatty phase (W / O type) or a fatty phase in an aqueous phase (O / W type)), milk-type liquid or semi-liquid consistency form, or soft consistency form, or alternatively, multiple emulsion (W / O / W or O / W / O type) form. These compositions are prepared according to methods generally known.

[0386] More specifically, the compositions according to the invention are intended for topical application and can be particularly in emulsion form, especially oil-in-water emulsions. In particular, such emulsions are not intended to be rinsed off after application.

[0387] The compositions according to the invention are more specifically intended for application to the skin.

[0388] Specifically, the skin refers to the skin of the face, scalp, collar, neck, arms, or forearms, or even more preferably the skin of the face (especially the forehead, nose, cheeks, and chin), collar, and neck.

[0389] The composition may alternatively be in the form of a facial and / or body care or cosmetic product, and may be packaged, for example, in the form of a bottled cream or tubed liquid or a pump bottle or dropper bottle.

[0390] The compositions according to the invention can be manufactured by any known method commonly used in the cosmetics industry.

[0391] The components are mixed in a sequence and under conditions that can be readily determined by those skilled in the art before molding.

[0392] According to a particular form of the invention, other agents intended to enhance the appearance and / or texture of the skin may also be added to the composition according to the invention.

[0393] Uses and methods

[0394] According to one aspect, the present invention relates to the cosmetic use of compositions according to the invention for the prevention and / or treatment of skin diseases associated with Staphylococcus aureus colonization in individuals in need, particularly for the prevention and / or treatment of acne and / or eczema in individuals in need, especially for topical use.

[0395] According to another aspect, the present invention relates to a non-therapeutic cosmetic method for caring for keratin materials, particularly skin, the method comprising topically applying a composition according to the invention to these keratin materials.

[0396] Skin may be particularly prone to acne or at risk of developing acne and / or eczema or at risk of developing eczema.

[0397] The cosmetic uses and methods considered according to the present invention are non-therapeutic.

[0398] The cosmetic uses and methods of the present invention are particularly carried out by topical application of the compositions according to the present invention.

[0399] Topical application includes applying a cosmetic composition externally to the skin using techniques commonly used with these compositions.

[0400] For example, the cosmetic use or method according to the invention can be carried out by topical (e.g., daily) application of at least one composition according to the invention, which can be formulated as, for example, cream, gel, serum, lotion, or makeup remover, particularly in gel form.

[0401] Application can be repeated, for example, once or twice a day, for one or more days, and usually for at least four weeks, or even for extended periods of four to fifteen weeks, with pauses for one or more periods if necessary.

[0402] According to one embodiment, the application is daily (once a day) and typically lasts for at least 4 weeks, or even an extended period of 4 to 15 weeks, with one or more periods of pause if necessary.

[0403] According to one embodiment, the cosmetic treatment method according to the present invention may include a single application.

[0404] Throughout this specification (including the claims), unless otherwise specified, the terms "between... and..." and "scope from... to..." shall be understood to mean including the limit.

[0405] The following examples illustrate the invention but do not limit its scope.

[0406] In this example, unless otherwise specified, the temperature is room temperature (20°C) and expressed in degrees Celsius, and the pressure is atmospheric pressure. Example

[0407] Working procedure for preparing Staphylococcus aureus from lyophilized product ATCC 6538 (according to the recommendation of standard NF EN 12353). Suspension.

[0408] The lyophilized material was rehydrated in tryptone soy broth, plated onto tryptone soy agar (TSA plates), and incubated at 32.5°C for 24 hours. The cells were then recovered and resuspended in a commercial cryoprotectant solution and stored at -80°C for up to 14 months (long-term storage of the original culture) using cryobediments.

[0409] Frozen beads from the -80°C primary strain were passaged on TSA slant agar and then incubated at 32.5°C for 24 hours to obtain the primary culture. This primary culture could be stored at 4°C for up to 9 weeks. Working cultures were obtained by passaged primary cultures on tryptone-soybean agar and incubated at 35°C for 24 hours. Working suspensions were prepared by suspending the cells of this working culture in tryptone salt dilution. The absorbance at 620 nm was measured from 1 to 3 × 10⁻⁶. 8 This suspension is calibrated between CFU (colony forming units) / mL.

[0410] Evaluation of the antimicrobial activity of the samples against Staphylococcus aureus

[0411] Four formulations were prepared based on the information given in the table below.

[0412] [Table 1]

[0413]

[0414] Table 1

[0415] These four compositions are compositions according to the invention, comprising at least silica particles according to the invention and those not according to the invention (as defined in Table 2 below), wherein X respectively corresponds to:

[0416] [Table 2]

[0417]

[0418] Table 2

[0419] At T = 1 week and 6 months of preparation, 0.2 ml of calibrated Staphylococcus aureus suspension was inoculated into 20 g aliquots of each preparation. After homogenization, the microbial content in the product is expressed as 10⁻⁶. 6 The concentration of Staphylococcus aureus in CFU / gram of product, i.e., 10 8 A 1% inoculum of CFU / mL suspension was used (inoculum content was determined by spreading the suspension onto tryptone soy agar plates and incubating at 35°C for 24 hours). After contacting at room temperature (20°C ± 3°C) for t = 30 min and t = 60 min, 1 g of the mixture was weighed and 9.0 mL of Eugon LT100 supp broth was added, followed by mixing until completely homogenized. This mixture was then serially diluted to 1 / 100 dilution in Eugon LT100 supp broth.

[0420] Spread the diluted solution onto tryptone soy agar plates and incubate at 35°C for 48 hours until surviving Staphylococcus aureus colonies are counted.

[0421] Antimicrobial activity against Staphylococcus aureus is expressed as a logarithmic decrease relative to the initial concentration and is correlated with the activity of the active compound (endolysin of sequence SEQ ID NO: 10) (by comparing the count of surviving Staphylococcus aureus in formulations containing and without endolysin in the presence of each tested compound).

[0422] This method is adapted from the challenge test method described in the standard "ISO 11930 Cosmetics - Microbiology - Evaluation of the antimicrobial protection of a cosmetic product".

[0423] In the composition of this example, silica particles are present in their usual amounts in cosmetic compositions, particularly in amounts that enable them to perform their multifunctional roles (filler and sebum absorbent) in the composition.

[0424] Results and Conclusions

[0425] The results are given as a decrease in the logarithm of the Staphylococcus aureus population. For values ​​close to 0, no Staphylococcus aureus was killed, while for values ​​of -5.4, the entire Staphylococcus aureus population was killed. Therefore, the tested formulation was particularly active when the value was close to -5.4.

[0426] The antimicrobial activity of endolysin was measured at T = 1 week and 6 months (i.e., 1 week and 6 months after the first exposure of endolysin to the compound and Staphylococcus aureus). For each measurement, log reduction was measured 30 minutes after exposure (t30 min) and then 1 hour after exposure (t1 h).

[0427] The results one week later are shown in Table 3 below.

[0428] [Table 3]

[0429]

[0430] The results showed that the combination of hydrophobic silica aerogel particles according to the invention with endolysin maintained the antibacterial activity of endolysin against Staphylococcus aureus even after 6 months of storage (as shown by the logarithmic reduction results in Table 3). sequence list

[0431] SEQ ID NO: 1 CBD-2638 (protein)

[0432] WKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK

[0433] SEQ ID NO: 2 CBD-2638 (nucleic acid)

[0434] TGGAAACAGAATAAAGATGGCATTTGGTATAAAGCTGAACATGCTTCGTTCACAGTGACAGCACCAGAGGGAATTATCACAAGATACAAAGGTCCTTGGACTGGTCACCCACAAGCTGGTGTATTACAAAAAGGTCAAACGA TTAAATATGATGAGGTTCAAAAATTTGACGGTCATGTTTGGGTATCGTGGGAAACGTTTGAGGGCGAAACTGTATACATGCCGGTACGCACATGGGACGCTAAAACTGGTAAAGTTGGTAAGTTGTGGGGCGAAATTAAATAA

[0435] SEQ ID NO: 3 PLY2638 (protein)

[0436] MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNE VLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDGGKLEV SKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK

[0437] SEQ ID NO: 4 PLY2638(protein)

[0438] MRGSHHHHHHGSMLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASV YARNNEVLWYHPTDYVEWHCGNQWANANILLFEVCESYPGRISKFLENEEATLKVAADVMKSYGLPVRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDGGK LEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK

[0439] SEQ ID NO: 5 PLY2638(nucleic acid)

[0440]

[0441] SEQ ID NO: 6 M23-LST (Protein)

[0442] AATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISSGKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGY

[0443] SEQ ID NO: 7 M23-LST (Nucleic Acid)

[0444] GCTGCAACACATGAACATTCAGCACAATGGTTGAATAATTACAAAAAAGGATATGGTTACGGTCCTTATCCATTAGGTATAAATGGCGGTATGCACTACGGAGTTGATTTTTTTATGAATATTGGAACACCAGTAAAAGCTATTTCAAGCGGAAAAATAGTTGAAGCTGGTTGGAGTAATTACGGAGGAGGTAATCAAATAGGTCTTATTGAAAATGATGGAGTGCATAGACAATGGTATATGCATCTAAGTAAATATAATGTTAAAGTAGGAGATTATGTCAAAGCTGGTCAAATAATCGGTTGGTCTGGAAGCACTGGTTATTCTACAGCACCACATTTACACTTCCAAAGAATGGTTAATTCATTTTCAAATTCAACTGCCCAAGATCCAATGCCTTTCTTAAA GAGCGCAGGATAT

[0445] SEQ ID NO: 8 AMI-2638 (Protein)

[0446] NKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDG

[0447] SEQ ID NO: 9AMI-2638 (Nucleic Acid)

[0448] GGTAACAAGATTACAGCACCAAAACCTAGTATTCAAGGTGTGGTCATCCACAATGATTATGGTAGTATGACACCTAGTCAATACTTACCATGGTTATATGCACGTGAGAATAACGGTACACACGTTAACGGTTGGGCTAGTGTTTATGCAAATAGAAACGAAGTGCTTTGGTATCATCCGACAGACTACGTAGAGTGGCATTGTGGTAATCAATGGGCAAATGCTAACTTAATCGGATTTGAAGTGTGTGAGTCGTATCCTGGTAGAATCTCGGACAAATTATTCTTAGAAAATGAAGAAGCGACATTGAAAGTAGCTGCGGATGTGATGAAGTCGTACGGATTACCAGTTAATCGCAACACTGTACGTCTGCATAACGAATTCTTCGGAACTTCTTGTCCACATCGTTCGTGGGACTTGCATGTTGGCAAAGGTGAGCCTTACACAACTACTAATATTAATAAAATGAAAGACTACTTCATCAAACGCATCAAACATTATTATGACGGT

[0449] SEQ ID NO: 10 M23-LST AMI2638 CBD2638 (Protein)

[0450] AATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISSGKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGYGKAGGTVTPTPNTGELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDGGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK

[0451] SEQ ID NO: 11 M23-LST AMI2638 CBD2638 (Protein)

[0452] MRGSHHHHHHGSAATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISSGKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQIIGWSGSTGYSTAPHLHFQRMVNSFSNSTAQDPMPFLKSAGYGKAGGTVTPTPNTGELLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQDKSKNGSVKELKHIYSNHIKGNKITAPKPSIQGVVIHNDYGSMTPSQYLPWLYARENNGTHVNGWASVYANRNEVLWYHPTDYVEWHCGNQWANANLIGFEVCESYPGRISDKLFLENEEATLKVAADVMKSYGLPVNRNTVRLHNEFFGTSCPHRSWDLHVGKGEPYTTTNINKMKDYFIKRIKHYYDGGKLEVSKAATIKQSDVKQEVKKQEAKQIVKATDWKQNKDGIWYKAEHASFTVTAPEGIITRYKGPWTGHPQAGVLQKGQTIKYDEVQKFDGHVWVSWETFEGETVYMPVRTWDAKTGKVGKLWGEIK

[0453] SEQ ID NO: 12 M23-LST AMI2638 CBD2638 (Nucleic Acid)

[0454]

[0455] SEQ ID NO: 13 6XHIS N-End Label

[0456] MRGSHHHHHHGS.

Claims

1. A composition, particularly a cosmetic composition, comprising, in a physiologically acceptable medium: (i) at least one endolysin; and (ii) At least hydrophobic silica aerogel particles.

2. The composition according to claim 1, wherein the endolysin is an endolysin derived from Staphylococcus aureus bacteriophage.

3. The composition according to claim 1 or 2, wherein the endolysin comprises a first protein sequence comprising a domain for binding to the cell wall of a Staphylococcus species.

4. The composition according to claim 3, wherein the first protein sequence is derived from the endolysin of Staphylococcus aureus Φ2638a phage.

5. The composition according to claim 3 or 4, wherein the first protein sequence comprises a protein sequence that is at least 80%, particularly at least 90%, more particularly at least 95% sequence identical to the amino acid sequence of reference SEQ ID NO:

1.

6. The composition according to any one of claims 1 to 4, wherein the endosomal comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of: amino acid sequences of SEQ ID NO: 3 and SEQ ID NO:

4.

7. The composition according to any one of claims 3 to 5, wherein the endosomal further comprises a heterologous protein sequence.

8. The composition of claim 7, wherein the heterologous protein sequence comprises a cleavage domain, the cleavage domain comprises a second protein sequence and a third protein sequence, the second protein sequence comprising an endopeptidase M23 domain and the third protein sequence comprising an amidase domain.

9. The composition according to claim 8, wherein the second protein sequence and the third protein sequence are independently derived from an enzyme selected from the group consisting of: endolysin of Staphylococcus aureus Φ2638a phage and lysostaphin that mimics Staphylococcus, particularly one of the second protein sequence and the third protein sequence is derived from endolysin of Staphylococcus aureus Φ2638a phage, and the other sequence of the second protein sequence and the third protein sequence is derived from lysostaphin that mimics Staphylococcus.

10. The composition according to claim 8 or 9, wherein the second protein sequence contains at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with the amino acid sequence of reference SEQ ID NO: 6, and the third protein sequence contains at least 80%, particularly 90%, more particularly 95% sequence identity with the amino acid sequence of reference SEQ ID NO:

8.

11. The composition according to any one of claims 1 to 4 and 6 to 9, wherein the endolysin comprises a protein sequence having at least 80%, particularly at least 90%, more particularly at least 95% sequence identity with an amino acid sequence selected from the group consisting of: the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11; particularly, the endolysin comprises a protein sequence consisting of the amino acid sequence of SEQ ID NO:

10.

12. The composition according to any one of claims 1 to 11, wherein the endolysin derived from Staphylococcus aureus phage is present in an amount ranging from 0.0001 wt% to 0.1 wt% relative to the total weight of the composition, particularly from 0.0005 wt% to 0.01 wt% relative to the total weight of the composition, and more particularly from 0.001 wt% to 0.005 wt% relative to the total weight of the composition.

13. The composition according to any one of claims 1 to 12, characterized in that The hydrophobic silica aerogel particles have a specific surface area per unit mass ranging from 600 m² / g to 800 m² / g.

14. The composition according to any one of claims 1 to 13, characterized in that The hydrophobic silica aerogel particles are silylated silica aerogel particles (INCI name is silylated silica).

15. The composition according to any one of claims 1 to 14, characterized in that... The size of the hydrophobic silica aerogel particles, expressed as an average diameter (D[0.5]), is less than 1500 μm, and preferably ranges from 1 μm to 30 μm, preferably from 2 μm to 25 μm, even more preferably from 2 μm to 20 μm and even more preferably from 2 μm to 15 μm.

16. The composition according to any one of claims 1 to 15, comprising a content of hydrophobic silica aerogel particles ranging from 0.01 wt% to 5 wt%, preferably 0.1 wt% to 3 wt%, and even more preferably 1 wt% to 2 wt% relative to the total weight of the composition.

17. The composition according to any one of claims 1 to 16, wherein the composition is suitable for topical application.

18. The composition according to any one of claims 1 to 16 is used for the prevention and / or treatment of skin diseases associated with Staphylococcus aureus colonization in individuals in need, particularly for cosmetic purposes, especially for the prevention and / or treatment of acne and / or eczema in individuals in need, and especially for topical use.

19. The cosmetic use according to claim 18, wherein the composition is suitable for topical application.

20. A non-therapeutic cosmetic method for caring for keratin materials, particularly skin, especially acne-prone skin, the method comprising topically applying the keratin material a composition according to any one of claims 1 to 16.

Images