Application of CaGBPB1 gene in regulating pepper drought stress response
Patent Information
- Application Number
- CN202611208809.2
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2026-08-11
- Publication Date
- 2026-09-15
Smart Images

Figure CN122750751A_ABST
Abstract
Description
Technical Field
[0001] This invention belongs to the field of genetic engineering technology, specifically involving the application of the CaGBPB1 gene in regulating the drought stress response of peppers. Background Technology
[0002] Chili pepper (Capsicum annuum L.) is a plant belonging to the genus Capsicum in the Solanaceae family. It is an annual or short-lived perennial herb or shrub. As a widely cultivated vegetable and cash crop globally, chili peppers occupy an important position in my country's agricultural industrial structure. The United Nations' "Global Drought Bulletin 2023" indicates that 15%–20% of my country's population will face more frequent moderate to severe droughts in the 21st century, and the intensity of drought in my country is projected to increase by 80% by 2100. Drought is a major environmental stress in chili pepper production, affecting its vegetative growth, such as plant height, leaf area, and photosynthetic rate. It also affects yield and quality, and in severe cases, can cause the entire chili pepper plant to die, resulting in large-scale yield reductions or even crop failure and significant economic losses.
[0003] Currently, research on drought resistance in chili peppers mainly focuses on changes in growth and development, physiological and biochemical indicators, and photosynthesis. In contrast, research on the location and mechanism of action of drought-resistant genes is relatively weak. Therefore, researching and identifying key genes in chili peppers that respond to drought stress and studying their molecular mechanisms in this response will not only provide important genetic resources for stress-resistant breeding of chili peppers but also lay a theoretical foundation for achieving a balanced year-round supply of chili peppers in my country in the future. Summary of the Invention
[0004] To address the aforementioned problems, this invention has discovered a drought-resistance-related gene in chili peppers, CaGBPB1, and its encoded protein. CaGBPB1 and its encoded protein positively regulate drought-resistance-related properties in chili peppers. This invention provides the application of the nucleic acid molecule of the chili pepper drought-resistance-related gene CaGBPB1 and its encoded protein, primer pairs for amplifying the nucleic acid molecule, or biological materials containing the nucleic acid molecule in regulating drought-resistance-related properties in chili peppers.
[0005] The technical solution of the present invention is as follows: The application of the CaGBPB1 gene in regulating the drought stress response of pepper, the nucleotide sequence of the CaGBPB1 gene is shown in SEQ ID NO 1; the CaGBPB1 gene in pepper is silenced by virus-induced gene silencing technology to obtain silent peppers with weakened drought resistance.
[0006] The English name for virus-induced gene silencing is Virus-induced gene silencing (VIGS).
[0007] In some embodiments, the amino acid sequence of the protein expressed by the CaGBPB1 gene is shown in SEQ ID NO 2.
[0008] In some embodiments, the virus-induced gene silencing technology involves transferring a recombinant vector that silences the CaGBPB1 gene into peppers, thereby silencing the CaGBPB1 gene in the peppers and reducing their drought resistance.
[0009] In some embodiments, the recombinant vector for silencing the CaGBPB1 gene is a CaGBPB1 gene silencing vector constructed using a VIGS viral vector.
[0010] In some embodiments, the recombinant vector for silencing the CaGBPB1 gene includes a VIGS viral vector and the CaGBPB1 gene inserted into the VIGS viral vector.
[0011] In some embodiments, the VIGS viral vector includes a tobacco brittle virus pTRV1 vector or a tobacco brittle virus pTRV2 vector.
[0012] Among them, the tobacco brittle virus pTRV1 vector is also known as the TRV1 vector, and the tobacco brittle virus pTRV2 vector is also known as the TRV2 vector.
[0013] In some embodiments, the recombinant vector for silencing the CaGBPB1 gene is used to construct a VIGS silencing system for the CaGBPB1 gene in chili peppers.
[0014] In some embodiments, the pepper CaGBPB1 gene VIGS silencing system includes Agrobacterium bacterial suspension containing an auxiliary vector and Agrobacterium bacterial suspension containing the recombinant vector for silencing the CaGBPB1 gene; the auxiliary vector is the tobacco brittle virus pTRV2 vector.
[0015] The beneficial effects of this invention are: This invention utilizes virus-induced gene silencing technology to construct CaGBPB1 gene-silenced pepper plants. The relative water content, proline content, malondialdehyde content, flavonoid content, and stomatal aperture of the CaGBPB1 silent pepper leaves were measured to demonstrate the function of the CaGBPB1 gene in pepper drought stress (silencing the CaGBPB1 gene reduces pepper drought resistance, and the CaGBPB1 gene positively regulates pepper drought resistance). This invention provides gene resources for breeding new drought-resistant pepper varieties and provides a theoretical basis for elucidating the molecular mechanism of CaGBPB1 in pepper drought stress signal response. Attached Figure Description
[0016] Figure 1 This is a clone of the chili pepper CaGBPB1 gene in this invention; Figure 2 The CaGBPB1 in pepper tissue in this invention ( Figure 2 Expression and subcellular localization of A) Figure 2 B); Figure 3 The arid conditions (no watering) in this invention are as follows: Figure 3 A) and simulated drought (300 mM mannitol, Figure 3 B) Expression level of CaGBPB1 in pepper leaves after treatment; Figure 4 Construction of the CaGBPB1 gene silencing vector in this invention ( Figure 4 A) Vector sequencing results ( Figure 4 B), and the expression of the CaGBPB1 gene in the leaves of CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and control TRV2:00 pepper plants (B), and the expression of the CaGBPB1 gene in leaves of CaGBPB1 gene-silenced plants (TRV2:CaGBPB1 and control TRV2:00). Figure 4 C); Figure 5 The CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and control TRV2:00 pepper plants before and 12 days after drought in this invention ( Figure 5 Phenotype A), relative water content in leaves of CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and control TRV2:00 pepper plants after 12 days of drought ( Figure 5 B) Malondialdehyde content ( Figure 5 C) and proline content ( Figure 5 D); Figure 6 The stomatal phenotype and aperture of leaves of the CaGBPB1 gene-silenced plant TRV2:CaGBPB1 and the control TRV2:00 pepper plants after 12 days of drought in this invention. Figure 7 The figures show the flavonoid content and flavonoid synthesis gene expression levels in the leaves of CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and control TRV2:00 pepper plants after 12 days of drought. Detailed Implementation
[0017] The present invention will be further described in detail below with reference to the embodiments.
[0018] Example 1: Full-length cloning of the CaGBPB1 gene 1. Total RNA was extracted from pepper using the plant RNA extraction kit provided by TIANGEN.
[0019] Among them, the plant-derived RNA extraction kit is RNAprep Pure Plant Kit, catalog number DP432.
[0020] 2. cDNA Synthesis Methods Using the total RNA extracted above as a template, the first-strand cDNA was obtained by reverse transcription using a reverse transcription kit provided by Acrylic Company.
[0021] Among them, the reverse transcription kit is the Evo M-MLV reverse transcription kit, catalog number AG11705.
[0022] 3. Nucleotide sequence alignment was performed using the Zunla-1 chili pepper genome sequence (http: / / www.bioinformaticslab.cn / PepperBase / ) to obtain the chili pepper CaGBPB1 gene sequence (ZLC08G0025940). Based on this sequence, specific primers were designed, and chili pepper leaf cDNA obtained by the above method was used as a template for amplification using a high-fidelity enzyme from Novizan. The amplification system is shown in Table 1.
[0023] Table 1 PCR amplification system
[0024] The high-fidelity enzyme is: 2 × Phanta Flash Master Mix, catalog number P520.
[0025] The PCR amplification program was as follows: 98℃ pre-denaturation for 30s, 98℃ denaturation for 10s, 55℃ annealing for 30s, 72℃ extension for 5s, for a total of 30 cycles, and a final extension at 72℃ for 1min.
[0026] The primer sequences are as follows: Forward primer CaGBPB1-F: ATGGTCGCTACTCAGACTGT; Reverse primer CaGBPB1-R: GATCACACTTCTGTGCCCA.
[0027] PCR products were detected by 1% agarose gel electrophoresis, and the results are as follows: Figure 1 As shown.
[0028] 4. The nucleotide sequence of the CaGBPB1 gene in chili pepper was obtained by sequencing the PCR product, as shown in SEQ ID NO. 1: The amino acid sequence of the protein expressed by the CaGBPB1 gene is shown in SEQ ID NO. 2: MSVAELKERHMVATQTVNDLREKLKQKRLQLLDTDVAGYARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSACSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTTGL RTSVFGGEFQSGHTADVLSVSISSSNPRLFVSGSCDTTARLWDTRVASRAQRTFHGHEGDVNTVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQPHGDSDIPHVTSMAFSISGRLLFVGYSNADCYVWDTLLAKVVLNLGAVQNSHEGRISCLGLSADGSALCTTGSWDTNLKIWAFGGHRSVI (SEQ ID NO.2) Example 2: CaGBPB1 gene tissue expression profile Different tissues of chili seedlings were collected, including roots, stems, leaves, fruits, and flowers. Total RNA was extracted from chili leaves using the Plant RNA Extraction Kit (DP432) provided by TIANGEN. First-strand cDNA was obtained by reverse transcription using the reverse transcription kit (AG11705) provided by Acrylic.
[0029] The fluorescence quantitative PCR reaction system was performed using the fluorescence quantitative PCR kit (A304) provided by Kangrun Biotechnology Co., Ltd. The reaction system is shown in Table 2 below.
[0030] Table 2. Real-time PCR reaction system
[0031] The PCR amplification program was as follows: 95℃ pre-denaturation for 2 min, 95℃ denaturation for 15 s, 60℃ annealing for 30 s, 72℃ extension for 30 s, for a total of 40 cycles.
[0032] For quantitative real-time PCR, primer pairs consisting of CaGBPB1-qF and CaGBPB1-qR were used to detect the expression of the CaGBPB1 gene, and primer pairs consisting of CaACTIN1-qF and CaACTIN1-qR were used to detect the expression of the internal reference gene CaACTIN1. The primer sequences are shown in Table 3.
[0033] Table 3 Primers for quantitative real-time PCR to detect tissue expression levels of the CaGBPB1 gene
[0034] Test results as follows Figure 2 As shown in Figure A, CaGBPB1 was expressed at relatively high levels in leaves, roots, fruits, and flowers. * indicates P < 0.05, ** indicates P < 0.01, and *** indicates P < 0.001.
[0035] Example 3: Subcellular localization analysis of CaGBPB1 The full-length cDNA sequence of CaGBPB1 (excluding the stop codon) was cloned into the p3301 vector to obtain the 35S::CaGBPB1-GFP vector, which was then transformed into Agrobacterium GV3101. Tobacco leaves approximately 30 days old were selected, and Agrobacterium culture containing the 35S::CaGBPB1-GFP recombinant plasmid was injected into the leaves. The leaves were cultured in the dark for 24 hours, followed by 48 hours of further culture under light. Observation was performed using an Olympus FV3000 microscope.
[0036] Test results as follows Figure 2 As shown in B, CaGBPB1 is located in the cell membrane.
[0037] Example 4: Detection of CaGBPB1 expression after drought stress Leaf materials were collected from 30-day-old pepper seedlings after 2, 8, 12, and 16 days without watering, or after 2, 4, 8, and 12 hours of treatment with 300 mM mannitol. Total RNA was extracted from pepper leaves using the Plant RNA Extraction Kit (DP432) provided by TIANGEN. First-strand cDNA was obtained by reverse transcription using the reverse transcription kit (AG11705) provided by Aike Rui Company, using the total RNA extracted above as a template. The expression level of the CaGBPB1 gene in leaves under drought stress was detected using the real-time fluorescence kit (A304) provided by Kangrun Biotechnology. The detection primers are shown in Table 3.
[0038] Test results as follows Figure 3 As shown, CaGBPB1 expression was significantly affected by drought stress ( Figure 3 A) and mannitol ( Figure 3 Induction by B). In the figure, * indicates P < 0.05, ** indicates P < 0.01, and *** indicates P < 0.001.
[0039] Example 5: Construction and genetic transformation of CaGBPB1 gene silencing vector (1) A specific 300bp silencing fragment of the CaGBPB1 gene was designed using an online website (https: / / solgenomics.net / ). Based on this sequence, specific primers TRV2-CaGBPB1_F (gagtaaggttaccgaattcATGGTCGCTACTCAGACT) and TRV2-CaGBPB1-R (gtgagctcggtaccggatccAACCCAAGCACATGGAAG) were designed for amplification using leaf cDNA as a template. The PCR amplification reaction system is shown in Table 1.
[0040] The 300bp amplified sequence is as follows: ATGGTCGCTACTCAGACTGTAAATGATCTCCGTGAAAAACTTAAGCAGAAACGTCTTCAATTACTCGACACTGATGTTGCTGGGTATGCAAGGTCACAAGGTAAAACTCCGGTTACCTTTGGCCCAACAGATCTGGTTTGTTGT AGGATCCTGCAAGGACACACAGGAAAGGTCTATTCACTGGACTGGACTCCTGAAAAAAATCGTATAGTCAGTGCATCCCAAGATGGTAGATTAATAGTGTGGAATGCTCTCACAAGCCAAAAAACCCATGCAATTAAGCTTCCATGTGCTTGGGTT The PCR amplification program was as follows: 98℃ pre-denaturation for 5 min, 98℃ denaturation for 30 s, 55℃ annealing for 30 s, 72℃ extension for 5 s, for a total of 30 cycles, and a final extension at 72℃ for 1 min.
[0041] Test results as follows Figure 4 As shown ( Figure 4 (AB), obtained a 300bp correct CaGBPB1 gene silencing fragment.
[0042] (2) Construction of the CaGBPB1 gene silencing recombinant vector TRV2-CaGBPB1 The amplified CaGBPB1 gene silencing fragment was recombined into the TRV2 vector via EcoRI and BamHI restriction sites to obtain the recombinant vector TRV2-CaGBPB1. Vectors TRV2-00 (control vector) and TRV2-CaGBPB1 were transformed into Agrobacterium GV3101 and subjected to genetic transformation. The specific steps are as follows: Two 50 μL EP tubes containing competent Agrobacterium GV3101 cells were pre-thawed on ice. 2 μL of TRV1 vector, TRV2 vector, and recombinant vector TRV2-CaGBPB1 (200 ng / μL concentration) were added to each of the three Agrobacterium competent cells. The EP tubes were then rapidly immersed in liquid nitrogen for 5 min, removed, and thawed in a 37°C water bath for 5 min. 500 μL of LB broth was added, and the culture was incubated at 28°C with shaking at 200 rpm for 2 h. The culture was then plated onto LB solid medium containing 25 μg / mL rifamycin and 50 μg / mL kanamycin. Positive single clones were screened, and colony PCR was performed using the primers TRV2-CaGBPB1_F and TRV2_CaGBPB1_R to identify positive clones. Agrobacterium GV3101 containing TRV1 vector, TRV2 vector, and plant expression vector TRV2-CaGBPB1 was obtained.
[0043] It should be noted that the recombinant vector for silencing the CaGBPB1 gene is a silencing vector for the CaGBPB1 gene constructed using a VIGS viral vector. The recombinant vectors for silencing the CaGBPB1 gene include VIGS viral vectors and the CaGBPB1 gene inserted into the VIGS viral vector. VIGS viral vectors include tobacco flaking virus pTRV1 vector or tobacco flaking virus pTRV2 vector. The tobacco flaking virus pTRV1 vector is also known as the TRV1 vector, and it serves as an auxiliary vector; the tobacco flaking virus pTRV2 vector is also known as the TRV2 vector, and it serves as a control group; the plant expression vector TRV2-CaGBPB1 is the recombinant vector TRV2-CaGBPB1.
[0044] A recombinant vector silencing the CaGBPB1 gene was used to construct a VIGS silencing system for the CaGBPB1 gene in chili peppers. The CaGBPB1 gene VIGS silencing system consisted of Agrobacterium-mediated bacterium suspension containing a helper vector and Agrobacterium-mediated bacterium suspension containing the recombinant vector silencing the CaGBPB1 gene. The helper vector was the tobacco flaking virus pTRV2 vector.
[0045] (3) Genetic transformation of CaGBPB1 gene-silenced pepper plants 4 μL of Agrobacterium suspension containing the aforementioned TRV1 vector, TRV2-00 vector, and recombinant vector TRV2-CaGBPB1 were inoculated into 10 mL of LB medium containing 25 μg / mL rifamycin and 50 μg / mL kanamycin. The culture was incubated at 28°C and 220 rpm in a shaker. After approximately 20 hours, the OD value was measured using a spectrophotometer. When the OD600 value reached 1.0, the culture was centrifuged at 3500 rpm for 10 min, and the supernatant was discarded. 10 mL of infection solution was added, and the resuspended bacterial cells were dispersed using a pipette to ensure thorough mixing. The Agrobacterium suspension containing the TRV1 vector was then mixed in equal proportions with the Agrobacterium suspension containing the recombinant vector TRV2-CaGBPB1 and the TRV2-00 vector, respectively. After standing for 4 hours, the mixture was injected into the underside of pepper (e.g., Zunla) leaves using a syringe to construct the CaGBPB1 gene-silenced plant TRV2:CaGBPB1 and the control plant TRV2:00.
[0046] The formulation of the inoculum solution is: MS + 10 mM / L MES + 200 μM / L AS + 10 mM / L MgCl2, pH=5.6. MES is 2-morpholine ethanesulfonic acid; AS is acetylsuccinone.
[0047] Example 6: Detection of gene silencing efficiency in CaGBPB1 silent plants Leaves from 30-day-old CaGBPB1 gene-silenced plants (TRV2:CaGBPB1) and control plants (TRV2:00) were collected, and total RNA was extracted from the pepper leaves using the Plant RNA Extraction Kit (DP432) provided by TIANGEN. Using the extracted total RNA as a template, first-strand cDNA was obtained by reverse transcription using the Reverse Transcription Kit (AG11705) provided by Acrel Biotech. The expression level of CaGBPB1 was detected using the Real-Time PCR Kit (A304) provided by Kangrun Biotechnology. The real-time PCR system is shown in Table 2, and the CaGBPB1 gene primers are shown in Table 3.
[0048] Test results as follows Figure 4 As shown in Figure C, the results indicate that the CaGBPB1 gene count in the CaGBPB1 gene-silenced plant TRV2:CaGBPB1 was significantly lower than that in the control plant TRV2:00, indicating that the silencing plant was successfully constructed. *** P < 0.001 in the figure.
[0049] Example 7: Application of CaGBPB1 Silent Plants in Chili Peppers under Drought Stress (TRV2:CaGBPB1) 1. Analysis of the drought phenotype of CaGBPB1 gene-silenced chili pepper plants using TRV2:CaGBPB1. The CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and the control plants TRV2:00 were placed in a culture room for cultivation. Pepper seedlings with uniform growth were selected and treated without watering, while pepper seedlings that were watered normally served as controls. During the period, the growth of pepper seedlings was observed, and the relative water content and proline content of the leaves were analyzed.
[0050] Depend on Figure 5 It can be seen that under drought conditions, the leaves of the CaGBPB1 gene-silenced plant TRV2:CaGBPB1 peppers were more wilted than those of the control plant TRV2:00. Furthermore, the relative water content and proline content of the leaves of the TRV2:CaGBPB1 peppers were lower than those of the control plant TRV2:00, while the malondialdehyde content was higher, which led to a decrease in the drought resistance of the CaGBPB1 gene-silenced plants.
[0051] 2. Analysis of stomatal aperture in leaves of CaGBPB1 gene-silenced pepper plants (TRV2:CaGBPB1) Leaves of the CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and the control plant TRV2:00 after the above stress treatment were selected, and the stomatal aperture was analyzed.
[0052] Depend on Figure 6 It can be seen that under drought conditions, the stomatal aperture in the leaves of the TRV2:CaGBPB1 chili pepper plants with the CaGBPB1 gene silenced was significantly greater than that in the control plants TRV2:00, which is consistent with the wilting phenotype.
[0053] 3. Flavonoid content in CaGBPB1 gene-silenced chili pepper plants under drought conditions (TRV2:CaGBPB1) After the above treatment and sampling, the flavonoid content in the leaves of the CaGBPB1 gene-silenced plants TRV2:CaGBPB1 and the control TRV2:00 under drought stress was analyzed using the plant flavonoid enzyme-linked immunosorbent assay kit provided by Suzhou Keming Biotechnology Co., Ltd.
[0054] Among them, the plant flavonoid enzyme-linked immunosorbent assay kit has the product number LHT-2-G.
[0055] The results are as follows Figure 7 As shown, the results indicate that under drought stress, the flavonoid content in the leaves of the CaGBPB1 gene-silenced plant TRV2:CaGBPB1 was significantly lower than that in the leaves of the control plant TRV2:00. Figure 7 A).
[0056] 4. Expression analysis of flavonoid synthesis genes in CaGBPB1 gene-silenced plants (TRV2:CaGBPB1) under drought conditions. After the above-mentioned sampling, RNA was extracted from pepper leaves according to the instructions of the Plant RNA Extraction Kit (DP432) provided by Tiangen Biotech. Using the obtained RNA as a template, first-strand cDNA was obtained by reverse transcription using the reverse transcription kit (AG11705) provided by Acrel. The expression levels of the pepper CaACTIN1 gene were detected as an internal control for key flavonoid synthesis genes CaCHS (ZLC05G0021410), CaCHI (ZLC11G0023590), CaF3H (ZLC02G0025120), and CaF3'H (ZLC03G0009060). The primer designs for these genes are shown in Table 4 below.
[0057] Table 4 Primers for Quantitative Real-Time PCR of Flavonoid Synthesis Genes
[0058] The reaction systems and fluorescence quantitative procedures described above are consistent with those shown in Table 2.
[0059] The results are as follows Figure 7 As shown, by Figure 7 It can be seen that after drought treatment, the expression levels of the above genes in the leaves of CaGBPB1 silenced plants were significantly lower than those in TRV2:00 control plants. Figure 7 (BE), this conclusion is consistent with the results of the flavonoid content determination.
[0060] In summary, this invention utilizes virus-induced gene silencing (VIGS) technology to silence the CaGBPB1 gene in chili peppers, thereby obtaining silenced chili peppers with reduced drought resistance. Specifically, the virus-induced gene silencing technology involves transferring a recombinant vector that silences the CaGBPB1 gene into chili peppers, silencing the CaGBPB1 gene and thus reducing the chili pepper's drought resistance.
[0061] The above descriptions are merely some embodiments of the present invention. For those skilled in the art, various modifications and improvements can be made without departing from the inventive concept of the present invention, and these all fall within the protection scope of the present invention.
Claims
1. Application of CaGBPB1 gene in regulating pepper drought stress response, characterized in that, The nucleotide sequence of the CaGBPB1 gene is shown in SEQ ID NO 1; the CaGBPB1 gene in chili peppers is silenced by virus-induced gene silencing technology to obtain silent chili peppers with reduced drought resistance.
2. The use of CaGBPB1 gene in regulating the response of pepper to drought stress according to claim 1, characterized in that, The amino acid sequence of the protein expressed by the CaGBPB1 gene is shown in SEQ ID NO 2.
3. The application of the CaGBPB1 gene according to claim 1 in regulating the drought stress response of pepper, characterized in that, The virus-induced gene silencing technology involves transferring a recombinant vector that silences the CaGBPB1 gene into peppers, thereby silencing the CaGBPB1 gene in peppers and reducing their drought resistance.
4. The application of the CaGBPB1 gene according to claim 3 in regulating the drought stress response of pepper, characterized in that, The recombinant vector for silencing the CaGBPB1 gene is a silencing vector for the CaGBPB1 gene constructed using a VIGS viral vector.
5. The application of the CaGBPB1 gene according to claim 4 in regulating the drought stress response of pepper, characterized in that, The recombinant vector for silencing the CaGBPB1 gene includes a VIGS viral vector and the CaGBPB1 gene inserted into the VIGS viral vector.
6. The application of the CaGBPB1 gene according to claim 5 in regulating the drought stress response of pepper, characterized in that, The VIGS viral vector includes either the tobacco brittle virus pTRV1 vector or the tobacco brittle virus pTRV2 vector.
7. The application of the CaGBPB1 gene according to claim 3 in regulating the drought stress response of pepper, characterized in that, The recombinant vector that silences the CaGBPB1 gene is used to construct a VIGS silencing system for the CaGBPB1 gene in chili peppers.
8. The application of the CaGBPB1 gene according to claim 7 in regulating the drought stress response of pepper, characterized in that, The pepper CaGBPB1 gene VIGS silencing system includes Agrobacterium bacterial suspension containing an auxiliary vector and Agrobacterium bacterial suspension containing the recombinant vector for silencing the CaGBPB1 gene; the auxiliary vector is the tobacco brittle virus pTRV2 vector.