Lonicera maackii EVM0006572.1 gene and application thereof

Abstract

The application discloses a Lonicera maackii EVM0006572.1 gene and application thereof, relates to the technical field of genetic engineering, and the Lonicera maackii EVM0006572.1 has the sequence shown in SEQ ID NO:1. The gene expresses an amino acid sequence shown in SEQ ID NO:2. Overexpression of the gene can improve the salt tolerance and oxidation resistance of a plant. Through the functional interpretation of the gene, the genetic mechanism of the salt tolerance and oxidation resistance of the Lonicera maackii is further clarified, and a foundation is laid for improving the salt tolerance and oxidation resistance of the Lonicera maackii.

Description

Technical Field

[0001] This invention relates to the field of genetic engineering technology, and more specifically to honeysuckle. EVM0006572.1 Genes and their applications. Background Technology

[0002] Honeysuckle (Golden and Silver Honeysuckle) Lonicera maackii Lonicera japonica, also known as honeysuckle, is a deciduous shrub belonging to the genus Lonicera in the family Caprifoliaceae. It is an important woody plant with ornamental value, ecological adaptability, and resilience, and has significant application value in landscaping and maintaining ecosystem stability. Compared to the widely studied honeysuckle, research on Lonicera japonica is still in its early stages. Existing research is mostly limited to epigenetic studies such as chemical composition, pharmacological activity, and cultivation management, with very little focus on functional gene mining, functional verification, and genetic breeding applications. Its endogenous breeding gene resources have not been developed, and the molecular regulatory mechanisms of its growth and environmental adaptation remain unclear.

[0003] Soil salinization severely threatens normal plant growth. Salt stress induces the accumulation of reactive oxygen species (ROS) in plants, causing oxidative damage and posing a significant abiotic stress limiting agricultural and forestry production and ecological restoration. To combat the damage caused by salt stress, plants have evolved a complex antioxidant regulatory network, relying on antioxidant enzyme systems such as superoxide dismutase (SOD) and catalase (CAT) to scavenge excess ROS and maintain intracellular redox homeostasis. Therefore, identifying key genes for stress resistance and elucidating their functions are crucial for enhancing plant salt tolerance and antioxidant capacity.

[0004] Ubiquitin receptor proteases are key components of the ubiquitin-proteasome pathway, playing a crucial regulatory role in plant growth, development, and stress responses. Currently, only limited basic research has been conducted in herbaceous plants such as Arabidopsis thaliana, and their growth-regulating functions have been systematically elucidated. However, research on *Lonicera japonica* is still lacking. EVM0006572.1 No research has been reported on gene cloning and its application in regulating plant growth and development and improving plant abiotic stress characteristics. Summary of the Invention

[0005] This invention provides honeysuckle and honeysuckle. EVM0006572.1 Genes and their applications. This invention aims to address, to a certain extent, one of the technical problems in related technologies. This invention provides an EVM0006572.1 protein isolated from *Lonicera japonica* and its encoding gene, which are obtained for the first time from *Lonicera japonica*. *Lonicera japonica* was also discovered... EVM0006572.1 The expression level of this gene in the overexpressed transgenic lines was significantly higher than that in the wild-type plants, and at the same time EVM0006572.1 The overexpressed transgenic lines exhibited significantly greater salt tolerance and antioxidant capacity than the wild type, confirming that... EVM0006572.1 Application of genes in improving plant resistance to abiotic stresses.

[0006] To solve the above-mentioned technical problems, this application adopts the following technical solution:

[0007] The first aspect of the present invention provides honeysuckle. EVM0006572.1 A gene having the sequence shown in SEQ ID NO: 1 or a sequence complementary to the sequence shown in SEQ ID NO: 1.

[0008] According to an embodiment of the present invention, the gene can be used to encode the honeysuckle ubiquitin receptor protease protein.

[0009] A second aspect of the invention provides a construct comprising the genes described above.

[0010] A third aspect of the present invention provides a host cell comprising the above-described construct.

[0011] A fourth aspect of the invention provides a honeysuckle EVM0006572.1 protein having the sequence shown in SEQ ID NO:2.

[0012] According to an embodiment of the present invention, the protein is encoded by the sequence shown in SEQ ID NO:1.

[0013] The fifth aspect of the present invention provides the application of the above-mentioned gene, or the above-mentioned construct, or the above-mentioned host cell, or the above-mentioned protein, said application being the regulation of plant salt tolerance and antioxidant stress resistance under salt stress; said plant being poplar or honeysuckle.

[0014] A sixth aspect of the present invention provides a method for improving plant resistance to salt stress and antioxidant stress under salt stress, the method comprising introducing the above-described construct or the above-described host cell into the plant; Screening yielded honeysuckle with overexpression EVM0006572.1 The plants with the gene; the plants are poplar and honeysuckle.

[0015] Preferably, the method involves introducing the aforementioned construct or the aforementioned host cell into the plant via Agrobacterium transformation.

[0016] Compared with the prior art, the present invention has the following beneficial effects: The present invention provides a gene encoding the honeysuckle ubiquitin receptor protease. (The last sentence appears to be incomplete and unrelated to the preceding text.) EVM0006572.1 Transgenic lines with overexpressed genes showed significantly higher resistance to salt stress and greater oxidative stress resistance under salt stress compared to wild-type plants. EVM0006572.1 Genes can be used to improve plant resistance to salt stress and oxidative stress under salt stress. Attached Figure Description

[0017] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the description of the embodiments or the prior art will be briefly introduced below. Obviously, the drawings described below are only embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on the provided drawings without creative effort.

[0018] Figure 1 Provided according to embodiments of the present invention EVM0006572.1 Gene expression in wild-type and overexpressed poplar trees.

[0019] Figure 2 WT under salt stress and EVM0006572.1 Phenotype of the aboveground parts of transgenic poplar plants.

[0020] Figure 3 WT under salt stress and EVM0006572.1 Root phenotype of transgenic poplar plants.

[0021] Figure 4 WT and under salt stress EVM0006572.1 Physiological indicators of transgenic poplar plants were measured.

[0022] Figure 5 For WT, EVM0006572.1 Statistical analysis of relative fluorescence intensity of transgenic poplar roots under different salt treatment times; error bars represent standard deviation (SD). This indicates a highly significant difference compared to WT (Student's t-test). p<0.01). Detailed Implementation

[0023] The technical solutions of the embodiments of the present invention will be clearly and completely described below with reference to the accompanying drawings. Obviously, the described embodiments are only some embodiments of the present invention, and not all embodiments. Based on the embodiments of the present invention, all other embodiments obtained by those skilled in the art without creative effort are within the scope of protection of the present invention.

[0024] The present invention provides an isolated nucleic acid molecule that encodes the honeysuckle ubiquitin receptor protease EVM0006572.1, and the nucleic acid molecule has the sequence shown in SEQ ID NO: 1.

[0025] The sequence represented by SEQ ID NO:1 is as follows:

[0026] According to a specific implementation method, the nucleic acid is cDNA.

[0027] The present invention also provides a protein having honeysuckle ubiquitin receptor protease activity, the protein having the amino acid sequence shown in SEQ ID NO: 2.

[0028] The sequence shown in SEQ ID NO:2 is as follows: MGWLTKILKGSSHKISEGQYLGKYDDEKIWEGPSTVVDPWPDSDHEDIDRAIALSLAEEDQKDQAIALSLAEEDQKDQAIALPLSEEDQKGKKVLDDESHLEEDEQLAKALQESLNMDSPPRNDHGSL FPPYPYLYPSGYRICTGCNAEIGHGRFLSCLGGVWHPECFRCHACNLPISDYEFSVSDNHPFHKSCYKERHHPKCDVCNNFIPTNAAGLIEYRAHPFWSQKYCPSHEHDGTPRCCSCERMEARDTRYLL LDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQIPLLLVERQALNEAMEGEKNGHHHMPETRGLCLSEEQTVSTIIRRPRIGANYRIMDMFTEPLRLVRRCEVTAILILYSLPRLLTGS ILAHEMMHAWLRLKGYPNLSPDVEEGICQVLAHMWLESEIMAGSSSTTVASTSSSSSSSPVPASSKKGKRSDFEKKLGEFFIHQIKSDTSAAYGDGFREGNKAVDKYGLRSTLDHIRLTGTFPC (SEQ ID NO:2).

[0029] This invention also provides a construct comprising the aforementioned nucleic acid molecules. The constructed entity can be a cloning vector, such as a T-vector, a λ phage vector, a P1 phage vector, a granular vector, a bacterial artificial chromosome, a yeast artificial chromosome, pGEM-T, or pUC18; or an expression vector, such as an adenovirus vector, a retroviral vector, or a plasmid vector. The plasmid vector can be a plant expression vector, for example, selected from plant expression vectors pBIN19, pBI121, pBI221, pCAMBIA1300, pGreen, etc., and the type of vector can be selected according to actual needs. According to embodiments of this invention, the constructed entity is at least one of plasmids, viruses, and phages.

[0030] The present invention also provides a host cell, comprising the above-described nucleic acid molecules or the above-described constructs.

[0031] The host cells include, but are not limited to, plant, bacterial, yeast, or insect cells. According to a specific embodiment, the recombinant cells are plant cells. For example, the host cells can be honeysuckle cells or other plant cells, which can be monocotyledonous or dicotyledonous plant cells. Monocotyledonous plants include, but are not limited to, corn, wheat, sugarcane, reeds, sorghum, ginger, galangal, cardamom, amomum, turmeric, turmeric root, alpinia oxyphylla, ginger flower, and cardamom. Dicotyledonous plants include, but are not limited to, soybeans, peanuts, sunflowers, potatoes, and tomatoes.

[0032] This invention also provides a method for improving plant resistance to salt stress and oxidative stress, comprising: The nucleic acid, or the construct, or the host cell described above is introduced into the plant; Plants that overexpress the honeysuckle ubiquitin receptor protease protein were screened.

[0033] The term "overexpression" refers to a significant difference in the expression level of the honeysuckle ubiquitin receptor protease protein compared to unintroduced plants or wild plants. According to specific implementation methods, this significant difference can be p < 0.5.

[0034] For example, the isolated nucleic acid molecules or genes provided by this invention as described above can be transformed into recipient plant cells through Agrobacterium-mediated transformation or gene gun transformation, and the cells can be differentiated into complete plants to obtain plants that can resist salt stress and oxidative stress.

[0035] Of course, gene editing technologies such as zinc finger nuclease (ZFN), TALEN (Transcription activator-like effector nucleases), and CRISPR / Cas (Clustered Regularly Interspaced Short palindromic Repeat Sequences) can be used to modify the genome sequence of the recipient plant genome to contain the isolated nucleic acid molecules or genes as described above, using the isolated nucleic acid molecules or genes as described above as templates.

[0036] The aforementioned nucleic acid molecules, genes, or proteins can be used to enhance the resistance of transgenic plants to salt stress and oxidative stress. The nucleic acid molecules or genes provided by this invention can enhance the resistance of transgenic plants to salt stress and oxidative stress by at least 10 times compared to wild-type plants that have not been introduced.

[0037] Unless otherwise specified, the experimental methods used in the following examples are conventional methods, performed according to the techniques or conditions described in the literature in this field or according to the product instructions. Unless otherwise specified, the materials and reagents used in the following examples are commercially available.

[0038] Example 1: Honeysuckle EVM0006572.1 Cloning of the coding region sequence of a gene 1. RNA extraction and reverse transcription RNA extraction was performed using the EASYspin plus Plant RNA Rapid Extraction Kit (Adley, RN38). Healthy leaves and stem tissues of *Lonicera japonica* were used for RNA extraction. The samples were rapidly ground in liquid nitrogen, and total RNA was extracted according to the kit's operating procedure.

[0039] Reverse transcription was performed using the Full Gold (ER501) RNA reverse transcription kit. The reaction system and steps are as follows: Table 1 cDNA reverse transcription system

[0040] After the reaction system is prepared, gently pipette to mix the components thoroughly. Then, place the reaction tube into a PCR instrument and run the reverse transcription program. Store the cDNA product at -20°C. The program parameters are set as follows: 50°C, 5 min; 85°C, 5 sec.

[0041] 2. Target gene EVM0006572.1 Amplification and construction of the overexpression vector pCAMBIA2300-EVM0006572.1-GFP (1) Honeysuckle EVM0006572.1 Gene cloning primer design Based on the genome information retrieval of Lonicera japonica EVM0006572.1 The CDS sequence (SEQ ID NO.1) was designed using SnapGene software. Kpn I and Bam HI restriction site homologous amplification primers. Primer information is listed below: Table 2 Cloning Primer Sequences

[0042] (2) PCR cloning Using cDNA obtained from reverse transcription as a template, EVM0006572.1 Perform PCR amplification. The PCR reaction system is as follows: Table 3 PCR reaction system

[0043] PCR reaction program: 98℃ for 2 min; (98℃ for 10 s, 58℃ for 15 s, 72℃ for 50 s) for 35 cycles; extension at 72℃ for 3 min; 16℃ infinity.

[0044] (3) Utilization Kpn I and Bam The pCAMBIA2300 vector was digested with HI at 37°C for 4 hours, and the amplification product and digestion product were purified using a recovery kit (manufacturer: Takara, China).

[0045] (4) Amplify the PCR reaction EVM0006572.1 Sequence recovery products and Kpn I, Bam The recovered products of pCAMBIA2300 vector digested with HI were mixed and incubated at 50°C for 15 min with homologous recombinase. The ligation product was then transformed into competent E. coli DH5α cells (purchased from Shanghai Weidi Biotechnology Co., Ltd.). 700 μL of LB medium was added, and the mixture was placed in a constant-temperature shaker at 37°C and 180 rpm for 60 min to recover the cells. The recovered E. coli were centrifuged at 5,000 rpm for 1 min, and 600 μL of the supernatant was collected and discarded. The remaining 100 μL was pipetted and mixed thoroughly, then evenly spread onto LB solid medium containing 50 µg / mL Kan. The medium was inverted and incubated at 37°C for 12–16 h. After colonies emerged, single colonies were picked and incubated in 700 µL of LB liquid medium containing 50 µg / mL Kan at 37°C for 6 h. 300 μL of the bacterial culture was sent to the company for sequencing to screen for positive clones, and the vector was named as [vector name missing]. pCAMBIA2300-35S::EVM0006572.1 .

[0046] The LB liquid culture medium was prepared as follows: Weigh 5 g tryptone, 5 g NaCl, and 2.5 g yeast extract, add ddH2O, and bring the total volume to 500 mL. Autoclave at 121℃ for 20 min, then cool to room temperature.

[0047] The preparation method for LB solid medium is the same as that for LB liquid medium. Before making up to volume, add 5 g of agar powder, autoclave at 121℃ for 20 min, and cool to room temperature.

[0048] (5) CarrierpCAMBIA2300-35S::EVM0006572.1 Transformed Agrobacterium GV3101 (purchased from Shanghai Weidi Biotechnology Co., Ltd., refer to the instruction manual for specific operating procedures).

[0049] Example 2 for EVM0006572.1 The function of the genes was studied.

[0050] 1. Genetic transformation of the model plant 84K poplar Transformation of 84K poplar tissue culture seedlings using Agrobacterium-mediated leaf disc method: (1) Preparation of Agrobacterium infection solution: Add 20 mL of LB liquid culture medium and 500 μL of Agrobacterium-containing solution to two small conical flasks respectively. pCAMBIA2300-35S::EVM0006572.1 Agrobacterium tumefaciens culture containing the expression vector, 20 μL Kana and Rif, were incubated on a shaker for 16 hours (28℃, 200 rpm).

[0051] (2) Pretreatment: Scratches were made on the leaf veins of the tissue culture seedlings and they were placed on the differentiation medium for pre-culture for 1 day with the underside of the leaves facing up.

[0052] (3) Infection and dark culture: The pretreated leaves were immersed in Agrobacterium tumefaciens solution for 15 minutes. After removing the excess liquid, they were returned to the differentiation medium with the reverse side facing up and cultured in the dark at 25°C for 3 days.

[0053] (4) Resistance culture: Use sterile filter paper to absorb the bacterial liquid on the surface of the leaves, transfer it to the resistance differentiation medium, and culture at 25°C under long-day conditions.

[0054] (5) Subculture selection: Change the resistance medium weekly. After about 1 to 2 months, adventitious buds will appear at the wound site of the leaf. Separate the adventitious buds and transfer them to a new medium.

[0055] (6) Rooting culture: When the adventitious buds grow to 2 cm, cut them off separately and place them in a resistant rooting medium. After the roots are stable, positive identification is carried out. Positive plants can be subcultured and propagated.

[0056] Table 4. Culture medium for woody plants (1 L)

[0057] 2. Expression analysis of EVM0006572.1 in wild-type and overexpressed poplar trees. To further screen overexpressing transgenic lines, the relative expression levels of the EVM0024577 gene in each transgenic line were detected, and WT and [other gene expression levels] were extracted. EVM0006572.1 The RNA of the transgenic plant is reverse transcribed into cDNA. (Design) EVM0006572.1Quantitative primers were used to select the 18S gene as the endogenous reference gene for quantitative analysis of specific cDNA sequences in the test samples. qRT-PCR reactions were performed using ChamQ SYBR qPCR Master Mix from Nanjing Novizan Biotechnology Co., Ltd.

[0058] The primers are designed as follows: EVM0006572.1-F:GATCTGCACGGGTTGCAATG (SEQ ID NO:5), EVM0006572.1-R:TGATGGCGCTCTTTGTAGCA (SEQ ID NO:6); 18S-F: AAACTGTAATGGTCCTCCCTCCG (SEQ ID NO:7), 18S-R: AAACTGTAATGGTCCTCCCTCCG (SEQ ID NO: 8).

[0059] qRT-PCR reaction system: Table 5

[0060] The experiment was repeated three times, and the relative expression levels were calculated using the 2-ΔΔCT method.

[0061] The results are attached. Figure 1 As shown, in the L1, L2 and L5 transgenic lines EVM0006572.1 The relative expression levels of genes were significantly increased, with L1, L2, and L5 representing respectively... EVM0006572.1 Different transgenic lines of poplar trees overexpressing transgenic expression.

[0062] Example 3: Identification of phenotypic characteristics and salt and oxidative stress resistance of transgenic plants Statistical analysis of poplar phenotypes and physiological indicators under salt stress: (1) Phenotypic record of whole plants under salt stress: Two-month-old WT and EVM0006572.1 Poplar trees were treated with 200 mM NaCl for 20 days. Phenotypic changes in the aboveground parts were recorded by photographing at 0 and 20 days to visually compare the stress responses of different materials.

[0063] The results are attached. Figure 2 The results showed that under salt treatment conditions, WT plants exhibited significant wilting and leaf yellowing, while EVM0006572.1 Plants overexpressing the gene showed better growth, with leaves remaining green and the plant morphology intact. In conclusion, EVM0006572.1 Overexpression significantly enhances the tolerance of poplar to salt stress.

[0064] (2) Statistical analysis of root phenotypes under salt stress: WT of two-month-old plants and EVM0006572.1 The root phenotype of poplar trees overexpressing the gene was photographed and recorded after treatment with 200 mM NaCl for 20 days. The results show (see appendix) Figure 3 ), WT plants have relatively short root systems and fewer branches, while EVM0006572.1 The transgenic lines have more developed root systems, with root lengths significantly longer than the WT (whole weight) values, and their root weights are also significantly higher than the WT values. Comprehensive analysis indicates that under salt stress conditions, EVM0006572.1 Overexpressing plants maintain longer root length and higher root biomass compared to WT, thus sustaining the plant's root growth capacity.

[0065] (3) Statistical analysis of physiological and biochemical indicators under salt stress: WT of two-month-old infants and EVM0006572.1 After overexpressing poplar seeds and treating them with 200 mM NaCl for 10 days, the effects on WT and EVM0006572.1 SOD and CAT activities were measured in overexpressing poplar samples, and the data from each group were summarized to evaluate the antioxidant capacity under salt stress.

[0066] The results show (see appendix) Figure 4 ), WT and EVM0006572.1 The physiological indicators of transgenic poplar trees showed significant differences. The activities of SOD and CAT in the transgenic lines were both higher than those in the WT line, indicating that the transgenic plants had a stronger ability to scavenge reactive oxygen species. In summary, EVM0006572.1 Overexpression of [a specific substance] enhanced the antioxidant capacity and tolerance of poplar under high salt stress.

[0067] (4) DCFH-DA staining: The fluorescence of reactive oxygen species (ROS) in poplar root tissue was detected using the DCFH-DA probe. Poplar seedlings with roots 5-10 cm in length were selected as experimental materials. Before the experiment, the seedlings were allowed to acclimatize in the dark for 30 min to reduce interference from chlorophyll autofluorescence. Before the experiment, the DCFH-DA powder was dissolved in anhydrous DMSO to prepare a 10 mM stock solution, which was stored in the dark. During the experiment, the solution was diluted with 10 mM PBS buffer at pH 7.2-7.4 to a final concentration of 20 μM in the root tissue. The solution was prepared fresh and stored in the dark for 5 min. The root tip was cut off and 2-3 cm was rinsed three times with sterile water and dried. The treated root tissue was placed in the DCFH-DA working solution and incubated at room temperature in the dark for 20-30 min, with the tissue shaken periodically to promote probe penetration. After incubation, the samples were rapidly rinsed three times with PBS for 1 minute each time to remove free probes. Immediately after slide preparation, the samples were placed under a fluorescence confocal microscope, and fluorescence images were captured at an excitation wavelength of 488 nm and an emission wavelength of 525 nm. Three replicate fields were captured for each sample. Blank controls, negative controls (pretreated with 10 mM NAC), and positive controls (pretreated with 100 μM H2O2) were set up to verify fluorescence specificity. The average fluorescence intensity was measured using ImageJ software, and significance analysis was performed using SPSS software. All procedures were conducted in the dark, and experimental equipment was autoclaved to avoid ROS contamination. Salt stress typically leads to the large production and accumulation of reactive oxygen species (ROS) in plants, causing severe oxidative damage. To investigate... EVM0006572.1 To investigate whether genes enhance plant salt tolerance by regulating ROS scavenging capacity, this study used the specific fluorescent probe DCFH-DA to stain transgenic plants and wild-type (WT) plants before and after salt treatment. DCFH-DA reacts with intracellular ROS to generate a green fluorescent substance; a stronger fluorescence signal indicates a greater accumulation of ROS. To further quantify this phenotype, we performed statistical analysis on the relative fluorescence intensity of different tissues (see Appendix). Figure 5 The bar chart results further confirmed the conclusions of the microscopic fluorescence observations: at various time points of salt treatment, the root of poplar showed... EVM0006572.1 The relative fluorescence intensity of the overexpression lines was significantly lower than that of the wild type at the same time point (p<0.01). At 3 h of salt stress, ROS accumulation in WT reached its peak, while ROS accumulation in the overexpression lines was significantly inhibited. In conclusion, under salt stress, EVM0006572.1 The average fluorescence intensity of the roots of overexpressing poplar plants was significantly lower than that of wild-type plants, indicating that overexpression... EVM0006572.1 By reducing ROS accumulation in different tissues of plants under salt stress, oxidative damage can be mitigated, thereby enhancing the salt tolerance of plants and providing a basis for further salt production. EVM0006572.1 Research on the mechanisms by which genes regulate plant salt tolerance and antioxidant capacity provides intuitive experimental evidence.

[0068] The various embodiments in this specification are described in a progressive manner, with each embodiment focusing on the differences from other embodiments. The same or similar parts between the various embodiments can be referred to each other.

[0069] The above description of the disclosed embodiments enables those skilled in the art to make or use the invention. Various modifications to these embodiments will be readily apparent to those skilled in the art, and the general principles defined herein may be implemented in other embodiments without departing from the spirit or scope of the invention. Therefore, the invention is not to be limited to the embodiments shown herein, but is to be accorded the widest scope consistent with the principles and novel features disclosed herein.

Claims

1. Honeysuckle EVM0006572.1 Genes, characterized by, The gene has the sequence shown in SEQ ID NO:1 or a sequence complementary to the sequence shown in SEQ ID NO:

1.

2. A construct, characterized in that, The construct includes the gene as described in claim 1.

3. A host cell, characterized in that, The host cell comprises the construct of claim 2.

4. Honeysuckle EVM0006572.1 protein, characterized in that, The protein has the sequence shown in SEQ ID NO:

2.

5. The application of the gene of claim 1, or the construct of claim 2, or the host cell of claim 3, or the protein of claim 4, characterized in that, The application is to regulate the salt tolerance and antioxidant stress resistance of plants under salt stress; the plants are poplar and honeysuckle.

6. A method for improving plant resistance to salt stress and antioxidant capacity under salt stress, characterized in that, The method includes introducing the construct of claim 2 or the host cell of claim 3 into the plant; Screening yielded honeysuckle with overexpression EVM0006572.1 The plants with the gene; the plants are poplar and honeysuckle.

7. The method according to claim 6, characterized in that, The construct or the host cell is introduced into the plant via Agrobacterium-mediated transformation.

Images