Application of lotus NnXTH6 gene in improving flower stem quality of plants

Abstract

This invention discloses lotus flowers NnXTH6 The application of genes in improving the quality of plant flower stems belongs to the field of biotechnology. NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4. This invention has found that overexpression... NnXTH6 The transgenic tobacco lines with the overexpressed gene showed significantly enhanced floral stem mechanical properties, indicating that overexpression of the gene... NnXTH6 Genes can significantly enhance the mechanical properties of plant flower stems, increasing their strength and making them less prone to breakage, without affecting the plant's external appearance, thus better meeting the plant shape and flower stem quality requirements of cut flowers. This invention is the first to clearly define... NnXTH6 The function of genes in regulating plant shape and flower stem mechanics provides new genetic resources and theoretical basis for cultivating high-quality cut flower plants with less broken flower stems and higher ornamental value.

Description

Technical Field

[0001] This invention relates to the field of biotechnology, and in particular to lotus. NnXTH6 Application of genes in improving the quality of plant flower stems. Background Technology

[0002] lotus ( Nelumbo nucifera As a member of the Nelumbonaceae family and the genus Nelumbo ( Nelumbo Lotus, a perennial aquatic plant, has been cultivated in China for over 2,500 years. Renowned as the "gentleman among flowers" for its noble character of "rising from the mud unsullied" and its high ornamental value, it is highly prized. With the rapid expansion of the cut flower market, the commercial value of cut lotus flowers is attracting increasing attention. In particular, selecting cut flower varieties with excellent vase performance through scientific evaluation systems has become an urgent need for industry development. However, the short vase life and easily broken stems of cut lotus flowers severely limit their market promotion, necessitating breakthroughs at the molecular breeding level.

[0003] Plant cell walls are the core structures determining stem mechanical forces, and xyloglucan endotransglucosylase / hydrolase (XTH), as key enzymes in cell wall remodeling, can dynamically regulate cell wall relaxation and rigidity by catalyzing the breakage and reconnection of xyloglucan chains. Xyloglucan is the most abundant hemicellulose component in the primary cell walls of dicotyledonous plants, and its content and structural changes are directly related to cell elongation capacity and tissue mechanical properties. Members of the XTH family possess both xyloglucan endotransglucosylase (XET) and xyloglucan endohydrolase (XEH) catalytic activities, and have been shown to participate in cell elongation, organ development, and stress responses in various plants. For example, in apples, MdXTH15 Not only does it participate in cell wall remodeling, but it also enhances the plant's overall resistance to drought, salinity, and pathogens by regulating the expression of downstream stress-resistance genes. Its protein is located in the plasma membrane, and the gene's expression level is highest in the stem, suggesting it may have a significant impact on stem development. In Arabidopsis, the differences in secretion pathways among different XTH members determine their final cell wall localization. AtXTH29 Delivered to the apoplast via unconventional secretion pathways and significantly upregulated under abiotic stress, XTH genes suggest a unique role in cell wall remodeling. These results indicate that XTH family genes can promote plant organ development and resistance to abiotic stress by altering cell wall composition and remodeling; simultaneously, XTH genes have the potential to improve plant flower stems. However, in lotus... NnXTH6 No reports have yet been found regarding the link between genes and flower stem quality. Summary of the Invention

[0004] The purpose of this invention is to provide lotus flowers. NnXTH6This invention relates to the application of genes in improving the quality of plant flower stems to address the problems existing in the prior art. The research found that overexpression... NnXTH6 The transgenic tobacco lines with significantly enhanced flower stem mechanical properties clearly demonstrate that... NnXTH6 The function of genes in regulating the mechanical properties of plant flower stems provides new genetic resources and theoretical basis for cultivating high-quality cut flower plants with flower stems that are less prone to breakage and have higher ornamental value.

[0005] To achieve the above objectives, the present invention provides the following solution: This invention provides NnXTH6 The application of genes in enhancing plant stem mechanics or cultivating plant lines with high cut flower quality, the aforementioned NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0006] The present invention also provides a method comprising NnXTH6 The application of gene expression cassettes in enhancing plant flower stem mechanical properties or cultivating plant lines with high cut flower quality. NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0007] The present invention also provides a method comprising NnXTH6 The application of gene recombinant vectors in enhancing plant flower stem mechanical properties or cultivating plant lines with high cut flower quality, the aforementioned NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0008] The present invention also provides a method comprising NnXTH6 The application of recombinant microorganisms in enhancing plant stem mechanics or cultivating plant lines with high cut flower quality. NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0009] Furthermore, the enhancement of plant stem mechanics refers to increasing the mechanical strength of plant stems to make them less prone to breakage.

[0010] Optionally, the plant may be lotus or tobacco.

[0011] This invention also provides a method for enhancing the mechanical properties of plant flower stems, including using genetic transformation technology to... NnXTH6 Genes are introduced into plants to enable NnXTH6 Stable overexpression of genes enhances the mechanical properties of plant flower stems; The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0012] This invention also provides a method for cultivating plant lines with high-quality cut flowers, utilizing genetic transformation technology to... NnXTH6 Genes are introduced into plants to obtainNnXTH6 A transgenic plant line with stable gene overexpression; the flower stems of the transgenic plant line are not easily broken; The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.4.

[0013] Optionally, the plant may be lotus or tobacco.

[0014] The present invention discloses the following technical effects: This invention clones from lotus flowers NnXTH6 Genes, through the construction of overexpression vectors, were transformed into tobacco plants to... NnXTH6 The function of the gene was studied, and it was found that overexpression NnXTH6 The transgenic tobacco lines with the gene showed significantly enhanced floral stem mechanical properties, specifically increased stem mechanical strength. This indicates that overexpression of the gene... NnXTH6 Genes can significantly enhance the mechanical properties of plant flower stems, increasing their strength and making them less prone to breakage, without affecting the plant's external appearance, thus better meeting the plant shape and flower stem quality requirements of cut flowers. This invention is the first to clearly define... NnXTH6 The function of genes in improving the quality of plant flower stems provides new genetic resources and theoretical basis for cultivating high-quality cut flower plants with flower stems that are less prone to breakage and have higher ornamental value. Attached Figure Description

[0015] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on these drawings without creative effort.

[0016] Figure 1 For lotus flowers NnXTH6 Genes and Arabidopsis AtXTH6 The results of the amino acid sequence alignment of the gene; Figure 2 pGWB418 (4xMyc) - NnXTH6 -Schematic diagram of NOS carrier structure and NnXTH6 Schematic diagram of gene structure; Figure 3 pGWB418 (4xMyc) - NnXTH6 -Flowchart of NOS vector construction; Figure 4 A flowchart illustrating Agrobacterium-mediated genetic transformation of tobacco leaf discs; Figure 5 For tobacco NnXTH6 Identification results and expression level analysis results of positive seedlings of overexpressing transgenic lines; where A is...NnXTH6 Electrophoresis diagram of PCR amplification products from overexpressing transgenic positive seedlings; B is... NnXTH6 In overexpression of transgenic positive seedlings NnXTH6 Results of expression level detection; Figure 6 for NnXTH6 Plant architecture and floral stem mechanical properties of the overexpressing transgenic T2 generation lines; where A represents the wild-type (WT) and... NnXTH6 (OE) Plant type observation diagram; B represents wild-type WT and NnCIGR1 Results of stem puncture force determination for (OE) strains. Detailed Implementation

[0017] Various exemplary embodiments of the present invention will now be described in detail. This detailed description should not be considered as a limitation of the present invention, but rather as a more detailed description of certain aspects, features, and embodiments of the present invention.

[0018] It should be understood that the terminology used in this invention is merely for describing particular embodiments and is not intended to limit the invention. Furthermore, with respect to numerical ranges in this invention, it should be understood that each intermediate value between the upper and lower limits of the range is also specifically disclosed. Any stated value or intermediate value within a stated range, as well as each smaller range between any other stated value or intermediate value within said range, is also included in this invention. The upper and lower limits of these smaller ranges may be independently included or excluded from the range.

[0019] Unless otherwise stated, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. While only preferred methods and materials have been described herein, any methods and materials similar or equivalent to those described herein may be used in the implementation or testing of this invention. All references to this specification are incorporated by way of citation to disclose and describe methods and / or materials associated with those references. In the event of any conflict with any incorporated reference, the content of this specification shall prevail.

[0020] Various modifications and variations can be made to the specific embodiments described in this specification without departing from the scope or spirit of the invention, as will be apparent to those skilled in the art. Other embodiments derived from this specification will also be apparent to those skilled in the art. This specification and embodiments are merely exemplary.

[0021] The terms “include,” “including,” “have,” “contain,” etc., used in this article are all open-ended terms, meaning that they include but are not limited to.

[0022] Unless otherwise specified, the experimental methods used in the following examples are conventional methods. Unless otherwise specified, the instruments and equipment used in the following examples are all conventional laboratory instruments and equipment; unless otherwise specified, the experimental materials used in the following examples were all purchased from conventional biochemical reagent stores.

[0023] Example 1 NnXTH6 Gene isolation and cloning The lotus variety 'Shennüzi' (provided by the National Lotus Germplasm Resource Bank of Southwest Forestry University) was selected as the experimental material, and Eastep was used. ® Total RNA was extracted from various tissues of lotus flower using the Super Total RNA Extraction Kit (Promega, USA). After extraction, RNA was treated with DNase I (Promega kit). RNA integrity was assessed by 1% (w / v) agarose gel (EtBr) electrophoresis (5 V / cm). Nucleic acid concentrations were determined using an IMPLEN NanoPhotometer-N50 series ultra-micro UV spectrophotometer (Germany). RNA with a 260 / 280 ratio between 1.9 and 2.1, a 260 / 230 ratio greater than 2.0, and a concentration greater than 500 ng / μL was used for further analysis. cDNA synthesis was performed using the Hiscript® II Q RT SuperMix for qRNA (+gDNA wiper) kit (purchased from Vazyme, China). Using 1 μg total RNA as a template, it was mixed with 4 μL of 4×gDNA wiper Mix and DEPC-water to a total volume of 16 μL. The mixture was incubated at 42℃ for 2 min, then quenched on ice for 2-3 min. Next, 4 μL of 5×Hiscript II qRT Super Mix II was added and mixed to a total volume of 20 μL. The mixture was then incubated at 50℃ for 15 min, followed by 85℃ for 5 sec. Each cDNA sample was diluted to 200 μL and stored at -20℃ for later use.

[0024] Using In-fusion cloning primers NnXTH6 -418F / NnXTH6The target band was amplified using -418R and amplified using TransTaq HiFi DNA Polymerase (Beijing TransGen Biotech Co., Ltd.). The PCR reaction conditions were: 94℃ pre-denaturation for 3 min; 94℃ for 30 sec, 58℃ for 30 sec, 72℃ for 1 min 30 sec, 32 cycles; extension at 58℃ for 1 min. The PCR product was then cloned into the pGWB418 vector. The recovery of the target fragment was performed using the UNIQ-10 column-based DNA gel extraction kit (Sangon Biotech (Shanghai) Co., Ltd.). The ligation system for the target fragment and the pGWB418 linearized vector was: 4.5 μL target fragment, 0.5 μL pGWB418 vector, and 5 μL Solution I (Takara Bio Engineering (Dalian) Co., Ltd.), ligated overnight at 16℃. The ligation product was transformed into DH5α competent cells using a heat shock method (30 min on ice followed by 90 sec heat shock at 42°C). The bacterial culture was then evenly spread on LB agar plates containing 100 mg / L Kan and incubated for approximately 10-12 h. Regularly shaped single colonies were selected and identified by colony PCR using universal primers 418F / R. Colonies confirmed positive by agarose gel electrophoresis were sent to Sangon Biotech (Shanghai) Co., Ltd. for sequencing, and the integrity of the target fragment was finally confirmed by sequence alignment.

[0025] NnXTH6 -418F: 5' GACTTGAACGGTAGCGCT CCCCACCCATACATTTT 3', SEQ ID NO.1 (underlined is 418 connector).

[0026] NnXTH6 -418R: 5' TCGGGGAAATTCGAGCTC GGGCCACATTTGAACAC 3', SEQ ID NO.2 (underlined is the 418 adapter, non-underlined is the R primer of the gene, where the R primer is reverse complementary: GTGTTCAAATGTGGCCC).

[0027] The positive colonies were sent to Sangon Biotech (Shanghai) Co., Ltd. for sequencing. Sequencing revealed that the amplified nucleotide sequence of this gene was 1107 bp in length and contained an open reading frame of 870 bp.

[0028] The sequence of the target band is shown in SEQ ID NO.3. Further analysis revealed that the gene is... NnXTH6The gene, with a full-length nucleotide sequence of 1107 bp, contains an 870 bp open reading frame (positions 84-953 of SEQ ID NO.3). Amino acid sequence alignment using ClustalX (Thompson JD, Gibson TJ, Plewniak F, et al. The ClustalX windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Research, 1997, 25: 4876-82.) revealed that this target band was highly homologous at the amino acid level to AtXTH6 in Arabidopsis thaliana (63.39% similarity), consistent with the results obtained from alignment on NCBI. Figure 1 ). NnXTH6 The amino acid sequence encoded by the gene is shown in SEQ ID NO.4.

[0029] SEQ ID NO.3: (The underlined part is the primer amplification sequence, and the bold part is the CDS) CCCCACCCATACATTTTGTGTTCAAATGTGGCCC .

[0030] SEQ ID NO.4: MATATRSLLKLMLVHIFSLVVSVWARPVTFLQDFRITWADSHIRQIEGGRSIQLILDQNSGCGFASKNQYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDTVRDELDFEFLGNRTGQPYTVQTNVYVHGKGDREQRINLWFDPAA EYHTYSILWNHYHVVFYVDDVPIRVYKNNEAKGLPFPKFQPMGVYSTLWEADDWATRGGLEKIDWTKAPFYAYYKDFDIEGCAAPGAASCASNPNNWWEGAGYQKLDELQARKYRWVRMNHMIYDYCVDKSRYPVTPPECLAGI.

[0031] Example 2 Overexpression NnXTH6 Obtaining transgenic tobacco plants (1) Construction of plant overexpression vectors Add to both ends of the cloning amplification primers Afe I and Sac I. Enzyme cleavage site, i.e., primer NnXTH6 -418F and NnXTH6 -418R, using the pGWB418 vector Afe I and Sac I was subjected to double digestion. The digestion system consisted of: 15 μL of pGWB418 (1700 ng / μL) and 5 μL of rCutsmartt Buffer. Afe I (10000 U / L) 1 μL, Sac Add 1 μL of I (20000 U / L) and sterile water to a final volume of 50 μL. Digest overnight at 37°C. After 1% agarose gel electrophoresis, recover the single linearized vector fragment.

[0032] The PCR products obtained from the above amplification were ligated into the pGWB418 (4xMyc) vector using an in-fusion enzyme. The construction procedure is as follows: Figure 3 Positive clones were screened and sequenced for identification, yielding lotus flowers. NnXTH6 Transgenic overexpression vector pGWB418(4xMyc) - NnXTH6 -NOS ( Figure 2 It contains a gene sequence for resistance to kanamycin in its T-DNA region. NnXTH6 The overexpressed promoter is the D35s promoter.

[0033] (2) Genetic transformation of tobacco (K326) The recombinant plasmid (i.e., the overexpression vector) pGWB418(4xMyc) was introduced using the conventional leaf disc infection method. NnXTH6 NOS was transferred into Agrobacterium GV3101, and the cells were screened and differentiated into seedlings. The specific steps are as follows (see the flowchart). Figure 4 ): a. Infection: Wash the tender terminal leaves of wild tobacco shoots with 75% alcohol for 1 min, then wash with 0.1% mercuric chloride solution for 5 min, and finally wash three times with sterile water. Use sterile tweezers and scissors to remove the leaf margins and midribs, cutting the leaves to a size of 1×1 cm. Place the leaves in the pre-shaken bacterial solution for 10 min. After infection, carefully remove the leaves and lay them flat on sterilized filter paper, turning them over to air dry. After most of the infection solution has been filtered out and excess bacterial solution has been absorbed, place the leaves flat at the four corners on a petri dish, with the leaf surface facing up, and incubate in the dark for 3 days.

[0034] b. Differentiation: After 3 days of dark culture, the explants were transferred to differentiation medium (MS inorganic salts and trace elements 4.404 g / L, sucrose 30 g / L, Agar 6.8 g / L, 6-BA 2.25 mg / L, NAA 0.3 mg / L, pH adjusted to 5.8-5.9, sterilized and cooled, and then antibiotics 50 mg / L Kan and 400 mg / L Cef were added). The medium was cultured at 24°C for 16 h of light and 8 h of dark.

[0035] c. Bud strengthening: After adventitious buds emerge, remove as much callus tissue as possible and transfer the bud strengthening medium (MS inorganic salts and trace elements 4.404 g / L, sucrose 30 g / L, Agar 6.8 g / L, 6-BA 2.25 mg / L, NAA 0.3 mg / L, adjust the pH of the medium to 5.8-5.9, sterilize and cool, then add 50 mg / L Kan and 400 mg / L Cef antibiotics) for 30 days of culture under the following conditions: 24℃, 16 h light / 8 h dark culture.

[0036] d. Rooting culture: Once the roots are robust and healthy, transfer them to a solid rooting medium (MS inorganic salts and trace elements 4.404 g / L, sucrose 30 g / L, Agar 6.8 g / L, sterilized and cooled with the addition of Kan 50 mg / L and Cef 400 mg / L antibiotics) to promote rooting.

[0037] (3) Identification of transgenic plants a. Extraction of genomic DNA from wild-type tobacco leaves DNA extraction was performed using the standard CTAB method. The specific steps were as follows: Young wild-type tobacco leaves (1-2 cm in length) were placed in a pre-cooled mortar and ground with liquid nitrogen 2-3 times until a fine paste was formed. The paste was then transferred to a 1.5 mL centrifuge tube, and 700 μL of 2× CTAB solution was added. The mixture was incubated at 70°C for 30 min, with gentle shaking every 6 min, followed by another 30 min incubation at 70°C with gentle shaking every 10 min. After cooling to room temperature, 700 μL of a 25:24:1 Tris-saturated phenol:chloroform:isoamyl alcohol mixture was added, and the mixture was repeatedly inverted and gently shaken approximately 40 times. The mixture was centrifuged at 3100 rpm for 15 min at room temperature. Approximately 500 μL of the supernatant was collected, and an equal volume of a 24:1 chloroform:isoamyl alcohol mixture was added. The mixture was then centrifuged at 3100 rpm for 15 min at room temperature. Discard the supernatant, add 1 mL of frozen -20℃ anhydrous ethanol, incubate at -20℃ for 30 min, then centrifuge at 12000 rpm for 10 min at room temperature. Wash with 75% ethanol and repeatedly pipette the precipitate for 3 min to remove salt. Discard the ethanol, air dry, and dissolve each sample in 30-50 μL of ddH2O. Analyze the extracted tobacco genomic DNA concentration using a Nanodrop micro-nucleic acid analyzer.

[0038] b. Detection of positive transgenic plants Young leaves of the transformed plants were collected, and DNA was extracted using the CTAB method. The pGWB418- vector was then amplified using PCR. NnXTH6 Gene-positive seedlings were identified, with a control group consisting of non-transgenic wild-type plants (K326). The primer sequences used are as follows: pGWB418-F: 5' GACTTGAACGGTAGCGCT 3'; SEQ ID NO.5; pGWB418-F / NnXTH6 -418R: 5' TCGGGGAAATTCGAGCTCGGGCCACATTTGAACAC 3'; SEQ ID NO. 2.

[0039] The test results show that ( Figure 5 In the A strain, the expected-sized electrophoretic band (1107 bp) was amplified in all 6 strains, while no electrophoretic band was observed in the wild type and ddH2O control, indicating that the transgenic tobacco genome already contains exogenous gene DNA fragments.

[0040] (4) Overexpression NnXTH6 qRT-PCR identification of transgenic tobacco a. Extraction of genomic RNA from wild-type tobacco leaves Take advantage of Eastep ®Super Total RNA Extraction Kit (purchased from Promega, USA), extracting EVs and the RNA identified in step (3). NnXTH6 Total RNA was measured from leaves of overexpressing positive lines. Hiscript was then used to analyze the RNA. ® The II Q RT SuperMix for qRNA (+gDNA wiper) kit (Vazyme, China) reverse transcribes RNA into cDNA.

[0041] b. Real-time quantitative PCR In order to determine NnXTH6 To determine whether overexpression was observed in tobacco, quantitative real-time PCR (qRT-PCR) was used to analyze the transgenic plants identified in step (3). qRT-PCR was performed using SYBR. ® Green Realtime PCR MasterMix-Plus Kit (Takara Bio Engineering (Dalian) Co., Ltd.), qPCR-specific primers designed based on the nucleotide sequences obtained from sequencing in Example 1, and primers synthesized by Nanjing Genscript Biotech Co., Ltd.

[0042] NnXTH6 The qRT-PCR primers for the gene are as follows: Q- NnXTH6 -F: 5' TCAGGATGTGGGTTTGCCTC 3'; SEQ ID NO.6; Q- NnXTH6 -R: 5' GTGTAAGGCTGCCCAGTTCT 3'; SEQ ID NO.7.

[0043] PCR program: 95℃ pre-denaturation for 30 sec, followed by 40 cycles (95℃ 10 sec, 60℃ 10 sec, 72℃ 26 sec). The transgenic plants identified in step (3) were analyzed, and the overexpressing plants were numbered with OE (abbreviation for overexpression) added before their names.

[0044] like Figure 5 As shown in B, the OE-1, OE-2, OE-4, OE-5, OE-10, and OE-16 strains NnXTH6 The expression levels were significantly higher than those of the non-transgenic wild-type control, with the most significant increase observed in the OE-5 line, which showed a 31.99% increase in expression compared to the wild-type. This indicates that these lines are independent expression levels. NnXTH6 Overexpression transgenic lines.

[0045] Example 3 NnXTH6 Overexpression of transgenic tobacco T2 generation enhances flower stem mechanical properties The piercing force of the terminal first node of the flower stalk of wild-type tobacco (WT) and its three transgenic lines (OE-4, OE-5, and OE-16) in their T2 generation was measured using a stem strength tester (YYD-1, Beijing Shunkeda Technology Co., Ltd.). The results showed that the stem mechanical strength of the transgenic lines was significantly increased compared to WT: OE-5 increased by 35.42%, OE-16 by 38.38%, and OE-4 showed the highest increase of 40.22%. Figure 6 This indicates that... NnXTH6 The gene demonstrated excellent application effects on lotus flower stem quality, significantly improving the mechanical strength of the stem and providing an effective molecular tool for cultivating high-quality flower stem varieties. Simultaneously, this research responds to the urgent need in the cut flower industry for varieties with long vase life, and has significant practical guiding value for improving cut flower quality and promoting varieties.

[0046] The embodiments described above are merely preferred embodiments of the present invention and are not intended to limit the scope of the present invention. Various modifications and improvements made by those skilled in the art to the technical solutions of the present invention without departing from the spirit of the present invention should fall within the protection scope defined by the claims of the present invention.

Claims

1. NnXTH6 The application of genes in enhancing plant stem mechanics or cultivating plant lines with high cut flower quality is characterized by, The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

2. Includes NnXTH6 The application of gene expression cassettes in enhancing plant stem mechanics or cultivating plant lines with high cut flower quality is characterized by, The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

3. Includes NnXTH6 The application of gene recombinant vectors in enhancing plant flower stem mechanical properties or cultivating plant lines with high cut flower quality is characterized by, The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

4. Includes NnXTH6 The application of recombinant microorganisms in enhancing plant stem mechanics or cultivating plant lines with high cut flower quality is characterized by, The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

5. The application according to any one of claims 1-4, characterized in that, The enhancement of plant stem mechanics refers to increasing the mechanical strength of plant stems to make them less prone to breakage.

6. The application according to any one of claims 1-4, characterized in that, The plant in question is either lotus or tobacco.

7. A method for enhancing the mechanical properties of plant flower stems, characterized in that, This includes using genetic transformation technology to... NnXTH6 Genes are introduced into plants to enable NnXTH6 Stable overexpression of genes enhances the mechanical properties of plant flower stems; The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

8. A method for cultivating plant lines with high-quality cut flowers, characterized in that, Using genetic transformation technology, NnXTH6 Genes are introduced into plants to obtain NnXTH6 A transgenic plant line with stable gene overexpression; the flower stems of the transgenic plant line are not easily broken; The NnXTH6 The gene encodes a protein as shown in SEQ ID NO.

4.

9. The method according to claim 7 or 8, characterized in that, The plant in question is either lotus or tobacco.

Images