MONOCLONAL ANTIBODIES FOR NT-PROBNP POINT MUTICATIONS

DE602018092357T2Active Publication Date: 2026-07-15F HOFFMANN LA ROCHE & CO AG

Patent Information

Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
F HOFFMANN LA ROCHE & CO AG
Filing Date
2018-02-13
Publication Date
2026-07-15

AI Technical Summary

Technical Problem

Existing NT-proBNP assays are ineffective for diagnosing heart failure in subjects with specific mutations in the amino acid sequence of NT-proBNP, as current antibodies bind to an epitope affected by these mutations, leading to inaccurate results.

Method used

Development of antibodies that specifically bind to mutated NT-proBNP with R46H and E43D mutations, ensuring high affinity and specificity while avoiding binding to wild-type NT-proBNP, allowing for accurate diagnosis.

Benefits of technology

The antibodies provide precise detection of NT-proBNP mutations, enhancing the accuracy of heart failure diagnosis by minimizing cross-reactivity with wild-type NT-proBNP, thus improving diagnostic reliability.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

[0001] The present invention relates to an antibody according to claim 1 that specifically binds a mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine, and an antibody according to claim 1 that specifically binds a mutated NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid. Moreover, the present invention relates to a mutated NT-proBNP. Further envisaged by the present invention are kits comprising the antibody of the present invention, or the mutated NT-proBNP of the present invention. The present invention also concerns a method for diagnosing heart failure.

[0002] Heart failure (HF) is among the leading causes of morbidity and mortality in many countries worldwide. Measurement of natriuretic peptide markers, such as B-type natriuretic peptide (BNP), or its amino-terminal fragment N-terminal proBNP (NT-proBNP), has emerged as an important tool for the diagnosis and risk stratification of patients with HF.

[0003] Brain natriuretic peptide (BNP) is a 32-amino acid polypeptide. BNP is synthesized as a 134-amino acid pre-prohormone ("pre-proBNP"). Removal of the N-terminal signal peptide which has a length of 26 amino acids generates the prohormone ("proBNP", 108 aa long). The prohormone is subsequently cleaved into NT-proBNP (N-terminal of the prohormone brain natriuretic peptide, 76 aa long) and the biologically active brain natriuretic peptide (BNP). NT-proBNP and BNP are produced in equimolar amounts. Several studies showed that assays for BNP and NT-proBNP can be reliably used for the diagnosis of heart failure (see e.g. Prontera et al., Clinica Chimica Acta 400 (2009) 70-73).

[0004] BNP is metabolized in the blood. It has a short half life due to a rapid degradation rate both in vivo and in vitro. NT-proBNP circulates in the blood as an intact molecule and as such is eliminated renally. It has a higher half life and is more stable in vitro than the active peptide BNP. Preanalytics are thus more robust with NT-proBNP allowing easy transportation of the sample to a central laboratory (Mueller 2004, Clin Chem Lab Med 42: 942-4). Blood samples can be stored at room temperature for several days or may be mailed or shipped without recovery loss. In contrast, storage of BNP for 48 hours at room temperature or at 4° Celsius leads to a concentration loss of at least 20% (Mueller loc.cit.; Wu 2004, Clin Chem 50: 867-73).

[0005] Due to the advantages of NT-proBNP, the biologically inactive peptide NT-proBNP is currently the preferred marker for the diagnosis of heart failure. The marker is routinely used in laboratory testing, but also in the point-of-care setting.

[0006] Katrukha et al. disclose a method for detecting NT-proBNP or the NT-proBNP / proBNP ratio (WO 2009 / 066010 A1).

[0007] Foo et al. disclose the use of circulating fragments of N-terminal pro-B-type natriuretic peptides in the plasma of heart failure patients (Foo et al, Clinical Chemistry 59:10 1523-1531 (2013).

[0008] Lee et al. disclose that an antibody which is reactive to the G63-K68 epitope of NT-proBNP exhibits O-glycosylation-independent binding (Lee et al, Experimental & Molecular Medicine 46 1-9 (2014)).

[0009] All NT-proBNP assays currently on the market are sandwich-immunoassays using a capture and a signal antibody. Some of the NT-proBNP assays currently on the market contain antibodies which bind to an epitope comprising amino acids 42 to 46 of NT-proBNP (see Saenger et al, Clinical Chemistry 63:1 351-358 (2017), e.g. supplemental table 2, or Clerico et al., Crit Rev Clin Lab Sci, 2015; 52(2): 56-69).

[0010] In the studies underlying the present invention, a point mutation was identified in the amino acid sequence of NT-proBNP (Arg46His, R46H). This point mutation is within the epitope of the signal antibodies of various NT-proBNP assays. The point mutation can be found in Ensembl-database (Yates et al. Ensembl 2016, Nucleic Acids Res. 2016 44 Database issue:D710-6, release 87, Dec 2016, dbSNP Cluster ID: rs61761991. Search of databases revealed a second point mutation Glu43Asp (E43D) within amino acids 42 to 46 of NT-proBNP (dbSNP Cluster ID: rs74613227).

[0011] It is an object of the present invention to provide means and methods for diagnosing heart failure in subjects having mutations in the amino acid sequence of NT-proBNP. The technical problem is solved by the embodiments characterized in the claims and herein below.

[0012] Accordingly, the present invention relates to an antibody as specified in claim 1 that specifically binds a mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine. Further, the present invention relates to an antibody as specified in claim 1 that specifically binds a mutated NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid.

[0013] The term "NT-proBNP" (N-terminal fragment of pro-brain natriuretic peptide) is well known in the art. As used herein, the term relates to the 76 amino acid N-terminal fragment of pro brain natriuretic peptide (proBNP) which is a secreted protein which, after cleavage, functions as a cardiac hormone. NT-proBNP is human NT-proBNP. Thus, said mutated NT-proBNP shall be mutated human NT-proBNP.

[0014] The sequence of the wild-type human NT-proBNP (herein also referred to as "unmutated" NT-proBNP) is well known in the art and has been described already in detail in the prior art, e.g., WO 02 / 089657, WO 02 / 083913, Bonow 1996, New Insights into the cardiac natriuretic peptides. Circulation 93: 1946-1950. Preferably, the wild-type NT-proBNP has an amino acid sequence as shown in SEQ ID NO: 3.

[0015] The positions of the mutations given herein are the amino acid positions in the sequence of NT-proBNP having a sequence as shown in SEQ ID NO: 3. Thus, the R46H mutation is at position 46 of NT-proBNP. In the longer precursor polypeptide, preproBNP, the corresponding mutation is at position 72. Therefore, the R46H mutation is herein, e.g. in the Examples section, also referred to as R72H mutation, and the E43D mutation as E69D mutation.

[0016] The mutations referred to above are substitutions. It is to be understood that the mutations / substitutions are mutations / substitutions compared to the wild-type NT-proBNP having a sequence as shown in SEQ ID NO: 3. For example, the wild-type human NT-proBNP comprises an arginine residue at position 46, whereas the mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine comprises a histidine residue at this position.

[0017] One or more further mutations may be present in the mutated NT-proBNP. However, these one or more mutations shall not be located in the epitope specifically bound by the antibody of the present invention.

[0018] In an embodiment of the present invention, the mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine comprises an amino acid sequence as shown in SEQ ID NO: 1. The sequence is also shown in Table A. The histidine residue at position 46 is indicated in bold.

[0019] In another embodiment, the mutated NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid comprises an amino acid sequence as shown in SEQ ID NO: 2. The sequence is also shown in Table A. The aspartic acid residue at position 43 is indicated in bold.

[0020] The term "antibody" is known in the art. As used herein, the term refers to any immunoglobulin (Ig) molecule comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains. As used herein, the term "antibody" also includes an antigen-binding fragment of the antibody. The term "antigen-binding fragment" is explained elsewhere herein. The definition applies accordingly.

[0021] The antibody in accordance with the present invention can be a polyclonal or monoclonal antibody. In a preferred embodiment, the antibody is a monoclonal antibody. The term "monoclonal antibody" is well known in the art. As used herein, the term preferably refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and / or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts. A monoclonal antibody of the present invention can be made by the well-known hybridoma method described by Kohler and Milstein, Nature, 256:495 (1975), or can be made by recombinant DNA methods.

[0022] In a preferred embodiment of the present invention, the antibody is prepared by applying a mutated NT-proBNP or fragment of the present invention (as described elsewhere herein in more detail) to a mammal, preferably a mouse, more preferably to a sheep. In particular, it is envisaged that NT-proBNP or fragment thereof comprises (and thus is operably linked) to a carrier protein (for a definition of the term "carrier protein" see elsewhere herein). Depending on the host species, various adjuvants can be used to increase the immunological response. Such adjuvants encompass, preferably, Freund's adjuvant, mineral gels, e.g., aluminum hydroxide, and surface active substances, e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Monoclonal antibodies according to the invention can be subsequently prepared using the well known hybridoma technique. Further details on the preparation of an antibody of the invention are described in the accompanying Examples below.

[0023] A preferred antibody of the present invention is an IgG antibody.

[0024] In an embodiment, the antibody of the present invention is an isolated antibody. Thus, the antibody shall be an antibody which has been purified. Purification of an antibody can be achieved by methods well known in the art such as Size Exclusion Chromatography (SEC). Accordingly, the antibody shall have been isolated from the cells in which the antibody was produced. In some embodiments, an isolated antibody is purified to greater than 70% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 80%, 90%, 95%, 96%, 97%, 98% or 99% by weight. In one preferred embodiment the isolated antibody according to the present invention is purified to greater than 90% purity as determined by SDS-PAGE under reducing conditions using Coomassie blue staining for protein detection.

[0025] Preferably, the monoclonal antibody as described herein is selected from a group consisting of a sheep monoclonal antibody, a mouse monoclonal antibody, a rabbit monoclonal antibody, a goat monoclonal antibody, a horse monoclonal antibody, a chicken monoclonal antibody. More preferably, the monoclonal antibody is a mouse monoclonal antibody. Most preferably, the monoclonal antibody is a sheep antibody.

[0026] The antibody of the present invention can be used in a sandwich assay as capture or detection (signal) antibody in combination with at least one other antibody binding to a different, i.e. second NT-proBNP epitope. Preferably, the second antibody derived from a species which differs from the species from which the antibody of the present invention has been obtained. For example, if the antibody of the present invention is a sheep antibody, the second antibody could be a mouse antibody.

[0027] The signal and the capture antibody can be used in sandwich assays. Sandwich assays are among the most useful and commonly used assays encompassing a number of variations of the sandwich assay technique. For example, in a typical assay, an unlabeled (capture) binding agent is immobilized or can be immobilized on a solid substrate, and the sample to be tested is brought into contact with the capture binding agent. After a suitable period of incubation, for a period of time sufficient to allow formation of a binding agent-biomarker complex, a second (detection) binding agent labeled with a reporter molecule capable of producing a detectable signal is then added and incubated, allowing time sufficient for the formation of another complex of binding agent-biomarker-labeled binding agent. Any unreacted material may be washed away, and the presence of the biomarker is determined by observation of a signal produced by the reporter molecule bound to the detection binding agent. The results may either be qualitative, by simple observation of a visible signal, or may be quantitated by comparison with a control sample containing e.g. known amounts of the mutated NT-proBNP (as standard or calibrator as described elsewhere herein).

[0028] The incubation steps of a typical sandwich assay can be varied as required and appropriate. Such variations include for example simultaneous incubations, in which two or more of binding agent and biomarker are co-incubated. For example, both, the sample to be analyzed and a labeled binding agent are added simultaneously to an immobilized capture binding agent. It is also possible to first incubate the sample to be analyzed and a labeled binding agent and to thereafter add an antibody bound to a solid phase or capable of binding to a solid phase.

[0029] The formed complex between a specific binding agent and the biomarker shall be proportional to the amount of the biomarker present in the sample. It will be understood that the specificity and / or sensitivity of the binding agent to be applied defines the degree of proportion of at least one marker comprised in the sample which is capable of being specifically bound. Further details on how the measurement can be carried out are also found elsewhere herein. The amount of formed complex shall be transformed into an amount of the biomarker reflecting the amount indeed present in the sample.

[0030] An antibody as set forth herein may be comprised by a test strip.

[0031] The antibody as described herein, or antigen binding fragment thereof, specifically binds to the corresponding antigen (e.g. the mutated NT-proBNP, or fragment thereof as defined elsewhere herein). An antibody that "binds" or "specifically binds" to an antigen, thus, is intended to refer to an antibody (or antigen-binding fragment thereof) that specifically binds to the antigen. The expression "specific binding" or "specifically binding" well understood and is used to indicate that an antibody (or antigen binding fragment thereof) does not significantly bind to other biomolecules. In particular, an antibody that specifically binds to a mutated NT-proBNP as set forth herein (or fragment thereof) does not bind to wild-type NT-proBNP (and thus to NT-proBNP not comprising a mutation substituting arginine at position 46 with histidine and / or a mutation substituting glutamic acid at position 43 with aspartic acid). The expression that "an antibody does not bind wild-type NT-proBNP" or that "a fragment of the antibody does not bind wild-type-NT-proBNP", means that the antibody (or fragment thereof) does not significantly bind wild-type NT-proBNP.

[0032] Accordingly, the level of binding to wild-type NT-proBNP results in a negligible binding affinity by means of ELISA or an affinity determination e.g. using a Biacore T200 instrument. As shown in the Examples, kinetic measurements do not show any determinable association rate constant ka (1Ms) of such antibody versus wild-type NT-proBNP, even at high analyte concentrations.

[0033] K D is the dissociation constant which can be determined with a binding assay, such as surface plasmon resonance techniques (BIAcore ®< , GE-Healthcare Uppsala, Sweden). As described in the Examples section, two monoclonal antibodies, named S-22.2.195 and S-23.4.66, were generated and tested in the studies underlying the present invention. Antibody S-22.2.195 binds to NT-proBNP with the R46H mutation. Antibody S-23.4.66 binds to NT-proBNP with the E43D mutation. The K D , k a and k d values of these antibodies for wild-type NT-proBNP, NT-proBNP with the R46H mutation, and NT-proBNP with the E43D mutation were determined in Example 3 of the Examples section.

[0034] In particular, the antibody (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP R46H, as referred to herein, preferably has a K D value for the antigen (i.e. the NT-proBNP comprising a mutation substituting arginine at position 46 with histidine) of not more than 0.05 nM at 13 °C, in particular of not more than 0.08 nM at 25 °C and / or not more than 0.15 nM at 37°C.

[0035] In particular, the antibody of the present invention (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP E43D, as referred to herein, preferably has a K D value for the antigen (NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid) of not more than 0.4 nM at 13 °C, in particular of not more than 3 nM at 25 °C and / or not more than 20 nM at 37°C.

[0036] It is in particularly envisaged that the antibody (or antigen binding fragment) of the present invention specifically binds to its genuine antigen and does not show detectable off-target interactions as investigated by means of SPR (Surface Plasmon Resonance).

[0037] The antibody of the present invention (or the antigen-binding fragment thereof) shows lower affinity interactions versus recognizing wild-type NT-proBNP (as compared to the interactions versus its antigen, i.e. the mutated NT-proBNP).

[0038] Another means to describe the kinetic binding properties of an antibody to its antigen is the resolution of the dissociation constant into its kinetic rate contributions, as there are the association rate k a constant and the dissociation rate constant k d . The association rate k a constant characterizes the velocity of the antibody / antigen complex formation and is time and concentration dependent.

[0039] The association rate constant of an antibody (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP R46H, as referred to herein, has a k a value (for its antigen) of more than 4.0E+05 1 / Ms at 13 °C, in particular more than 7.5E+05 1 / Ms at 25 °C and / or more than 1.0E+06 1 / Ms at 37°C.

[0040] The association rate constant of an antibody (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP E43D, as referred to herein, has a k a value of more than 6.0E+04 1 / Ms at 13 °C, in particular more than 5.5E+04 1 / Ms at 25 °C and more than 1.0E+05 1 / Ms at 37°C.

[0041] Antibodies specifically binding mutated NT-proBNP as referred to herein, preferably show at least 1.6-fold slower association rate constants versus wild-type NT-proBNP at 25°C.

[0042] The dissociation rate constant indicates the dissociation rate of an antibody from its antigen. Thus, the dissociation rate constant indicates the probability that the complex will fall apart in a unit of time. The lower the dissociation rate constant, the more tightly bound the antibody is to its antigen.

[0043] The dissociation rate constant of an antibody (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP R46H, as referred to herein, has a k d value of less than 1.0E-05 1 / s at 13 °C, in particular less than 3E-05 1 / s at 25 °C and less than 9E-05 1 / s at 37°C.

[0044] The dissociation rate constant of an antibody (or antigen binding fragment thereof) that specifically binds to mutated NT-proBNP E43D as referred to herein, has a k d value of less than 1.0E-05 1 / s at 13 °C, in particular less than 1.5E-04 1 / s at 25 °C and / or less than 2.0E-03 1 / s at 37°C.

[0045] Antibodies specifically binding mutated NT-proBNP as referred to herein, preferably show at least hundredfold faster dissociation rate constants versus wild-type NT-proBNP at 25°C (as compared to the dissociation rate constants versus the mutated NT-proBNP).

[0046] The kinetic rate constants are changing in a temperature gradient. The temperature-dependent binding kinetics at 13 °C and 37°C can be used to characterize antibody antigen interactions. The quotient of the association rate velocities at k a 37°C and k a 13°C (Velocity Factor, US20140256915) is a means to characterize antibody interactions. If the quotient is below a value of 10, the antibody antigen binding is enthalpy dominated, whereas a velocity factor VF > 10 increases the likelihood of an entropy-driven kinetic.

[0047] Preferably the quotient of an antibody (or antigen binding fragment thereof) that specifically binds to wild-type NT-proBNP or fragments or muteins thereof is below 10.

[0048] The antibodies of the present invention comprises at least one light chain, in particular two light chains, and at least one heavy chain, in particular two heavy chains.

[0049] The light chain comprising the amino acid sequence as shown in SEQ ID NO: 4 is preferably encoded by a polynucleotide comprising a nucleic acid sequence as shown in SEQ ID NO: 10. The heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 5 is preferably encoded by a polynucleotide comprising a nucleic acid sequence as shown in SEQ ID NO: 11.

[0050] The light chain comprising the amino acid sequence as shown in SEQ ID NO: 12 is preferably encoded by a polynucleotide comprising a nucleic acid sequence as shown in SEQ ID NO: 14. The heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 13 is preferably encoded by a polynucleotide comprising a nucleic acid sequence as shown in SEQ ID NO: 15.

[0051] Antibodies comprising the above light chains and heavy chains were produced in the studies underlying the present invention: The antibody S-22.2.195 specifically binds to NT-proBNP with the R46H mutation. This antibody comprises light chains having a sequence as shown in SEQ ID NO: 4, and heavy chains having a sequence as shown in SEQ ID NO: 5.

[0052] The antibody S-23.4.66 specifically binds to NT-proBNP with the E43D mutation. This antibody comprises light chains having a sequence as shown in SEQ ID NO: 12, and heavy chains having a sequence as shown in SEQ ID NO: 13.

[0053] The amino acid sequences of the heavy and the light chains of the produced antibodies are also shown in Table A.

[0054] Table A further shows the complementary determining regions (CDRs) which are primarily responsible for the binding affinity of the antibody. Each light chain and heavy chain has three CDRs '(CDR1, CDR2, and CDR3). Thus, each antibody has a total of six different CDRs.

[0055] The CDRs of the heavy and the light chain of the two antibodies generated in the studies of the present invention are indicated in bold in Table A below (in order from N-terminus to C-terminus). The CDRs were annotated in silico (Lefranc, M.-P., IMGT, the International ImMunoGeneTics Information System Cold Spring Harb Protoc. 2011 Jun 1;2011(6)).

[0056] The antibody (or antigen binding fragment thereof) of the present invention comprises the six CDRs comprised by S-22.2.195 or the six CDRs comprised by S-23.4.66 ( in the same order as in the light chain / heavy chain of the respective antibody).

[0057] Accordingly, it is envisaged that the antibody (or antigen-binding fragment thereof) comprises in the light chain (preferably in both light chains): a CDR1 having the sequence LLDDAY (as shown in SEQ ID NO: 16) a CDR2 having the sequence KDS, and a CDR3 having the sequence LSVDSSEYSV (as shown in SEQ ID NO: 17), and in the heavy chain (preferably in both heavy chains): a CDR1 having the sequence GFSLIGEY (as shown in SEQ ID NO: 18), a CDR2 having the sequence MASGGTI (as shown in SEQ ID NO: 19),and a CDR3 having the sequence VRSSVSPGDDRDV (as shown in SEQ ID NO: 20).

[0058] The above antibody of the invention specifically binds to NT-proBNP with the R46H mutation. Thus, the antibody which specifically binds to NT-proBNP with the R46H mutation is characterized in that the light chain variable domain comprises a CDR1 having the sequence LLDDAY (SEQ ID NO: 16), a CDR2 having the sequence KDS, and a CDR3 having the sequence LSVDSSEYSV (SEQ ID NO: 17), and the heavy chain variable domain comprises a CDR1 having the sequence GFSLIGEY (SEQ ID NO: 18), a CDR2 having the sequence MASGGTI (SEQ ID NO: 19), and a CDR3 having the sequence VRSSVSPGDDRDV (SEQ ID NO: 20).

[0059] Further, it is envisaged that the antibody (or antigen-binding fragment thereof) of the present invention comprises in the light chain (preferably in both light chains): a CDR1 having the sequence SSNVGYGNY (as shown in SEQ ID NO: 21) a CDR2 having the sequence SAT, and a CDR3 having the sequence VSYDSSSKFGV (as shown in SEQ ID NO: 22), and in the heavy chain (preferably in both heavy chains): a CDR1 having the sequence GFSVTNSG (as shown in SEQ ID NO: 23), a CDR2 having the sequence INNDGVA (as shown in SEQ ID NO: 24),and a CDR3 having the sequence GTRDLPSDVRYGNMYINY (as shown in SEQ ID NO: 25).

[0060] The above described antibody of the invention specifically binds to NT-proBNP with the E43D mutation. Thus, the antibody which specifically binds to NT-proBNP with the E43D mutation is characterized in that the light chain variable domain comprises a CDR1 having the sequence SSNVGYGNY (SEQ ID NO: 21) a CDR2 having the sequence SAT, and a CDR3 having the sequence VSYDSSSKFGV (SEQ ID NO: 22), and the heavy chain variable domain a CDR1 having the sequence GFSVTNSG (SEQ ID NO: 23), a CDR2 having the sequence INNDGVA (SEQ ID NO: 24), and a CDR3 having the sequence GTRDLPSDVRYGNMYINY (SEQ ID NO: 25).

[0061] The CDRs referred to above are comprised by the variable regions of the respective long chain or short chain, in the order as shown in Table A.

[0062] The present invention also relates to an antigen-binding fragment (herein also referred to as "antibody fragment") of the antibody of the present invention according to claim 4. As used herein, an antigen-binding fragment of an antibody is capable of specifically binding to the antigen (in particular to the mutated NT-proBNP as described above, i.e. the mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine or the mutated NT-proBNP a mutation substituting glutamic acid at position 43 with aspartic acid). Thus, antigen binding fragments of antibodies are fragments retaining the ability of the (full-length) antibody to specifically bind to the antigen (e.g. the mutated NT-proBNP).

[0063] Antibody fragments comprise a portion of a full length antibody, preferably the variable domain thereof, or at least the antigen binding site thereof. In an embodiment, the antigen-binding fragment is selected from the group consisting of a Fab fragment, a Fab' fragment, a Facb fragment, a F(ab') 2 fragment, a scFv fragment, and a Fv fragment. For example, the antigen-binding fragment is a F(ab') 2 fragment.

[0064] How to produce antigen-binding fragments is well known in the art. For example, the fragments can be produced by enzymatic cleavage of an antibody of the present invention. In addition, the fragments can be generated by synthetic or recombinant techniques. Fab fragments are preferably generated by papain digestion of an antibody, Fab' fragments by pepsin digestion and partial reduction, F(ab') 2 fragments by pepsin digestion), and facb fragments by plasmin digestion. Fv or scFv fragments are preferably produced by molecular biology techniques.

[0065] The antigen binding fragment of an antibody may also be a diabody, which are small antibody fragments with two antigen-binding sites. Diabodies preferably comprise a heavy chain variable domain connected to a light chain variable domain in the same polypeptide chain.

[0066] In an embodiment of the present invention, the antibody of the present invention or the antigen-binding fragment is used as signal antibody or signal fragment (herein also referred to as detection antibody or detection fragment). The term signal antibody or signal fragment refers to an antibody or fragment that is capable of being detected either directly or through a label amplified by a detection means. In an alternative embodiment of the present invention, the antibody of the present invention or the antigen-binding fragment is used as capture antibody or capture fragment.

[0067] In a preferred embodiment, the antibody of the present invention or the antigen-binding fragment is linked to a detectable label. A detectable label as described herein is preferably a label which is not naturally linked to an antibody or antigen-binding fragment thereof. Thus, the detectable label is preferably heterologous with respect to the antibody. Suitable labels are any labels detectable by an appropriate detection method. In an embodiment said detectable label is an enzyme, biotin, a radioactive label, a fluorescent label, a chemiluminescent label, an electrochemiluminescent label, a gold label, or a magnetic label. In a preferred embodiment, the label is an electrochemiluminescent label.

[0068] Enzymatic labels include e.g. horseradish peroxidase, alkaline phosphatase, beta-galactosidase, and luciferase. The substrates for these enzymes are well known in the art. Suitable substrates for detection include di-amino-benzidine (DAB), 3,3'-5,5'- tetramethylbenzidine, NBT-BCIP (4-nitro blue tetrazolium chloride and 5-bromo-4-chloro- 3-indolyl-phosphate). A suitable enzyme-substrate combination may result in a colored reaction product, fluorescence or chemoluminescence, which can be measured according to methods known in the art. Fluorescent labels, e.g., include 5-carboxyfluorescein, fluorescein isothiocyanate, rhodamine, tetramethylrhodamine, Cy2, Cy3, and Cy5, fluorescent proteins such as GFP (Green Fluorescent Protein), Texas Red and the Alexa dyes. Radioactive labels, e.g., include radioactive isotopes of iodide, cobalt, selenium, tritium, carbon, sulfur and phosphorous. A radioactive label can be detected by any method known and appropriate, e.g. a light- sensitive film or a phosphor imager. Magnetic labels e.g. include paramagnetic and superparamagnetic labels. Chemiluminescent labels of use may include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt or an oxalate ester.

[0069] In particular, it is envisaged that the antibodies described herein comprise an electrochemiluminescent label (in particular the signal antibodies).

[0070] The most commonly used electrochemiluminescent compound is ruthenium. Thus, the electrochemiluminescent label preferably comprises ruthenium. In particular, the electrochemiluminescent label shall comprise a bipyridine-ruthenium(II) complex. Thus, it is in particular envisaged that the antibody is a ruthenylated antibody. How to ruthenylate an antibody is described e.g. in the Examples section.

[0071] The present invention also relates to a host cell producing the antibody according to any one of claims 1 to 3, or the antigen-binding fragment according to claim 4. In a preferred embodiment, the host producing the antibody of the present invention is a hybridoma cell. Moreover, the host cell may be any kind of cellular system which can be engineered to generate the antibodies according to the current invention. For example, the host cell may be an animal cell, in particular a mammalian cell. In one embodiment HEK293 cells or CHO cells are used as host cells. In another embodiment, the host cell is a non-human animal or mammalian cell.

[0072] For example, the antibody S-23.4.66 that was generated in the studies underlying the present invention was produced by hybridoma. The antibody rS-22.2.195 was produced by hybridoma and by a pool of CHO cells in which the antibody was recombinantly expressed (Chinese Hamster Ovary cells). Subsequently, a stable CHO line was generated for large scale production of this antibody.

[0073] The host cell in accordance with the present invention is an isolated cell. Thus, the host cell shall be present in a cell culture, in other words outside from an organism.

[0074] The host cell preferably comprises at least one polynucleotide encoding for the light chain of the antibody of the present invention and at least one polynucleotide encoding the heavy chain of the antibody of the present invention. Said polynucleotides shall be operably linked to suitable promoters.

[0075] In accordance with the present invention, it is further envisaged to use the antibody of the invention that specifically binds a mutated NT-proBNP comprising a mutation substituting arginine at position 46 with histidine (or the antigen-binding fragment thereof) in combination with the antibody of the invention that specifically binds a mutated NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid (or antigen-binding fragment thereof). The combined use of these antibodies will allow the in vitro detection of NT-proBNP in samples of subjects comprising the R46H mutation and in samples of subjects comprising the E43D mutation.

[0076] Further, it is envisaged to use the R46H antibody (or antigen binding fragment thereof) of the invention, or the E43D antibody (or antigen binding fragment thereof) of the invention, or both the R46H and E43D antibodies (or antigen binding fragments thereof) of the invention in combination with an antibody that specifically binds to wild-type NT-proBNP (or an antigen-binding fragment thereof). As used herein, an "antibody that specifically binds to wild-type NT-proBNP" specifically binds to a region of the wild-type NT-proBNP comprising amino acid residues 42 to 46 of the wild-type NT-proBNP. Accordingly, said antibody binds an epitope comprised within amino acids 42 to 46 of the wild-type NT-proBNP. The epitope of this antibody thus does not comprise the E43D and R46H mutation. Preferably the antibody that specifically binds to wild-type NT-proBNP does not significantly bind the mutated NT-proBNP having the E43D or R46H mutation.

[0077] Thus, the present invention also relates to a kit or composition according to claim 7.

[0078] Preferably, the antibodies comprised by the kit are monoclonal antibodies. In an embodiment, the antibodies are monoclonal sheep antibodies.

[0079] Preferably, the kit or composition of the present invention comprises a further antibody, or an antigen-binding fragment thereof, which binds both the mutated NT-proBNP and the wild-type NT-proBNP. Thus, said antibody (or antigen-binding fragment thereof) shall specifically bind to a different region in NT-proBNP, in particular to a region which does not comprise amino acid 42 to 46 of NT-proBNP. Preferably, said further antibody (or antigen-binding fragment thereof) specifically binds to an epitope present in amino acids 1 to 35 of NT-proBNP (in particular of NT-proBNP having a sequence shown in SEQ ID NO: 3). More preferably said further antibody (or antigen-binding fragment thereof) binds to an epitope comprised within amino acids 27 to 31 of NT-proBNP (in particular of NT-proBNP having a sequence shown in SEQ ID NO: 3). Said antibody can be a monoclonal antibody or polyclonal antibody. Preferably, however, said antibody is a monoclonal antibody. In an embodiment, the further antibody described in this paragraph is a monoclonal mouse antibody.

[0080] The further antibody (or antigen-binding fragment thereof) described in the previous is preferably used as a capture antibody (fragment). Said antibody (or antigen-binding fragment thereof) shall be capable of being immobilized on a solid support (such as a plate, bead or tube). Preferably, said further antibody shall capture the mutated NT-proBNP(s) (as set forth elsewhere herein) and the wild-type NT-proBNP. In a preferred embodiment, the further antibody (or fragment thereof) is biotinylated. Thereby, the antibody (or fragment thereof) may bind to a solid support which comprises avidin or streptavidin.

[0081] The definitions and explanation given herein above apply mutatis mutandis to the following except if stated otherwise.

[0082] Moreover, the present invention relates to a mutated NT-proBNP or a fragment thereof as specified in claim 8. The mutated NT-proBNP has been defined herein above in connection with the antibody of the present invention.

[0083] The mutated NT-proBNP of the present invention according to claim 8, or the fragment thereof according to claim 8 can be e.g. used for the generation of the antibody of the present invention. Further, the mutated NT-proBNP, or the fragment thereof can be used as a standard or calibrator for assays in which the antibody (or fragments thereof) of the present invention is used for determining the amount of a mutated NT-proBNP as referred to herein. Accordingly, the aforementioned kit of the present invention may further comprise a) a mutated NT-proBNP according to claim 8 comprising a mutation substituting arginine at position 46 with histidine, or fragment thereof according to claim 8, or b) a mutated NT-proBNP according to claim 8 comprising a mutation substituting glutamic acid at position 43 with aspartic acid, or a fragment thereof according to claim 8.

[0084] It is to be understood the mutation comprised by the fragment of the present invention usually will not be at position 43 or 46 of the fragment since the fragment is shorter than the mutated NT-proBNP. Rather, the mutation comprised by the fragment shall be a mutation corresponding to the mutation substituting arginine at position 46 with histidine or to the mutation substituting glutamic acid at position 43 with aspartic acid. Thus, the fragment shall comprise a histidine residue at the position corresponding to position 46 of the wild-type NT-proBNP, or an aspartic acid residue at the position corresponding to position 43 of the wild-type NT-proBNP.

[0085] The mutated NT-proBNP according to claim 8 or fragment thereof according to claim 8 can be advantageously used as antigen for the production of the antibody of the present invention. Moreover, the mutated NT-proBNP according to claim 8or fragment according to claim 8 can be used as positive control in the kit of the present invention (see above).

[0086] In one embodiment the fragment comprising the mutation substituting arginine at position 46 with histidine consists of the sequence as shown in SEQ ID NO: 6. In another embodiment the fragment comprising the mutation substituting arginine at position 46 with histidine consists of the sequence as shown in SEQ ID NO: 7.

[0087] In one embodiment, the fragment comprising the mutation substituting glutamic acid at position 43 with aspartic acid consists of the sequence as shown in SEQ ID NO: 8. In another embodiment the fragment comprising the mutation substituting glutamic acid at position 43 with aspartic acid consists of the sequence as shown in SEQ ID NO: 9.

[0088] In an embodiment of the present invention, the mutated NT-proBNP according to claim 8 or fragment thereof according to claim 8 further comprises a purification tag. The tag shall be operably linked to the mutated NT-proBNP or fragment thereof.

[0089] The tag shall allow the purification of the NT-proBNP or fragment thereof. Such tags are well known in the art. The term "purification tag" as used herein preferably refers to an additional amino acid sequence (a peptide of polypeptide) which allows for purification of the mutated NT-proBNP of the present invention or fragment thereof. In an embodiment, the purification tag is a peptide or polypeptide which is not naturally linked to the mutated NT-proBNP or fragment thereof. Thus, the purification tag shall be heterologous with respect to the mutated NT-proBNP or fragment thereof.

[0090] Preferably, the purification tag is selected from the group consisting of a polyhistidine tag, a polyarginine tag, glutathione- S-transferase (GST), maltose binding protein (MBP), influenza virus HA tag, thioredoxin, staphylococcal protein A tag, the FLAG ™< epitope, and the c-myc epitope. In a preferred embodiment, the purification tag is a polyhistidine tag, Preferably, said polyhistidine tag comprises at least 6 consecutive histidine residues.

[0091] In an embodiment of the present invention, the mutated NT-proBNP according to claim 8 or fragment thereof according to claim 8 further comprises a carrier protein. The carrier protein shall be operably linked to the mutated NT-proBNP or fragment thereof.

[0092] The carrier protein is preferably heterologous with respect to the mutated NT-proBNP according to claim 8 or fragment thereof according to claim 8. Carrier proteins desirably are proteins that elicit an immune response. Thus, a carrier protein shall have a high degree of immunogenicity. Such carrier proteins are well known in the art. Preferably, the carrier protein is selected from the group consisting of keyhole limpet haemocyanin (KLH), tetanus toxoid, and diphtheria toxin, bovine serum albumin (BSA), ovalbumin, and thyroglobulin, especially KLH.

[0093] The present invention also relates to a composition, said composition comprising i) the mutated NT-proBNP of the present invention according to claim 8 or ii) the fragment of the present invention according to claim 8, and further comprising an immunoadjuvant. The term "immunoadjuvant" as used herein refers to a substance or composition which, when administered together with an antigenic substance to organisms, can enhance immunoresponse to the antigenic substance. Preferred adjuvants are described above. In an embodiment, the immunoadjuvant is selected from alum, Freund's incomplete adjuvant, and in particular Freund's complete adjuvant.

[0094] Moreover, the present invention relates to the use of a mutated NT-proBNP according to claim 8 of the present invention, or of a fragment thereof according to claim 8 for the production of the antibody of the present invention. Said antibody shall specifically bind to a mutated NT-proBNP as defined elsewhere herein. In an embodiment, said antibody is a monoclonal antibody. Alternatively, the composition defined in the previous paragraph is used for the generation of the antibody.

[0095] The present invention further relates to a polynucleotide encoding the mutated NT-proBNP of the present invention, or fragment of the present invention as specified in claim 9.

[0096] The term "polynucleotide" as used herein refers to a linear or circular nucleic acid molecule. It encompasses DNA as well as RNA molecules. The polynucleotide of the present invention shall be provided, preferably, either as an isolated polynucleotide (i.e. isolated from its natural context) or in genetically modified form. The term encompasses single as well as double stranded polynucleotides. Moreover, comprised are also chemically modified polynucleotides including naturally occurring modified polynucleotides such as glycosylated or methylated polynucleotides or artificial modified ones such as biotinylated polynucleotides. The polynucleotide of the present invention is characterized in that it shall encode a polypeptide as referred to above. Due to the degeneracy of the genetic code, polynucleotides are encompassed which encode a specific amino acid sequence as recited above. In an embodiment, the polynucleotide does not comprise intron sequences.

[0097] In an embodiment, the polynucleotide of the present invention is operably linked to a promoter. Said promoter shall allow for the expression of the polynucleotide. In an embodiment, said promoter is a heterologous promoter. In addition, the polynucleotide of the present invention may be linked to a terminator.

[0098] The present invention also contemplates a vector comprising one of the aforementioned polynucleotide of the present invention. In an embodiment, said vector is an expression vector, in which the polynucleotide of the present invention is operably linked to a promoter, in particular to a heterologous promoter.

[0099] The term "vector", preferably, encompasses phage, plasmid, viral or retroviral vectors as well as artificial chromosomes, such as bacterial or yeast artificial chromosomes. More preferably, the vector of the present invention is an expression vector. In such an expression vector, the polynucleotide comprises an expression cassette as specified above allowing for expression in eukaryotic cells or isolated fractions thereof. An expression vector may, in addition to the polynucleotide of the invention, also comprise further regulatory elements including transcriptional as well as translational enhancers. Preferably, the expression vector is also a gene transfer or targeting vector. Expression vectors derived from viruses such as retroviruses, vaccinia virus, adeno-associated virus, herpes viruses, or bovine papilloma virus, may be used for delivery of the polynucleotides of the invention into targeted cell population. Methods which are well known to those skilled in the art can be used to construct recombinant viral vectors; see, for example, the techniques described in Sambrook, Molecular Cloning A Laboratory Manual, Cold Spring Harbor Laboratory (1989) N.Y. and Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y. (1994).

[0100] The present invention also relates to a host cell comprising the mutated NT-proBNP of the present invention, or the fragment thereof, the polynucleotide of the present invention, or the vector of the present invention.

[0101] The term "host cell" as referred to in the previous paragraph shall be prokaryotic or eukaryotic cell. Eukaryotic cells include protist, fungal, plant and animal cells. In another embodiment, host cells include but are not limited to the prokaryotic cell line E. Coli; mammalian cell lines CHO, HEK293, COS, NSO, SP2 and PER.C6; the insect cell line Sf9; and the fungal cell Saccharomyces cerevisiae. In connection with the present invention, it is also envisaged that the host cell is a non-human host cell. In an embodiment, the mutated NT-proBNP, the fragment, the polynucleotide, or the vector comprised by the host cell of the present invention is heterologous with the respect to the host cell. For example, it is envisaged that the host cell has been transfected with the polynucleotide of the present invention.

[0102] Moreover, the present invention relates to a kit or composition according to claim 12.

[0103] The term "fragment" has been explained elsewhere herein. The definitions and explanations apply accordingly.

[0104] In an embodiment of the aforementioned kit (or composition), the kit (or composition) further comprises the wild-type NT-proBNP, or a fragment thereof. Said fragment comprises at least amino acid residues 42 to 46 of the wild-type NT-proBNP. In an embodiment, the fragment has a length of at least 10 amino acids.

[0105] Moreover, the present invention relates to a method of diagnosing heart failure in a subject according to claim 13.

[0106] In the aforementioned method, the determination of the amount of NT-proBNP comprises the step of contacting the sample with at least one antibody (or at least one antigen binding fragment of the antibody) of the present invention.

[0107] In an embodiment of step a) the aforementioned method, the sample is further contacted with an antibody that specifically binds to wild-type NT-proBNP, wherein the antibody specifically binds to a region of the wild-type NT-proBNP comprising amino acid residues 42 to 46 of the wild-type NT-proBNP, or an antigen-binding fragment of said antibody.

[0108] The subject in accordance with the method of the present invention is a human.

[0109] In an embodiment, the subject is heterozygous, or in particular homozygous for the mutation in NT-proBNP in which arginine at position 46 is substituted with histidine. Preferably, the antibodies / antigen binding fragments in i) or iii) as set forth above are used.

[0110] In an alternative embodiment, the subject is heterozygous, or in particular homozygous for the mutation in NT-proBNP in which glutamic acid at position 43 is substituted with aspartic acid. Preferably, the antibodies / antigen binding fragments in ii) or iii) as set forth above are used.

[0111] In the present invention, the sample is a blood, serum, or plasma sample. For example, blood samples, i.e. whole blood samples, can be used for the determination of NT-proBNP in the Point-of-Care setting. The most preferred samples are plasma and serum. Such type of samples are routinely used in laboratory testing.

[0112] Moreover, the present invention relates to the in vitro use of at least one antibody of the present invention (or at least one antigen-binding fragment thereof) for diagnosing heart failure (i.e. using a sample of a subject). The antibody (or the antibodies) as set forth in i), ii), iii) in connection with step a) of the method of diagnosing heart failure is (are) used. In addition to said antibody (antibodies), or antigen binding fragment(s) thereof, it is envisaged an antibody that specifically binds to wild-type NT-proBNP, wherein the antibody specifically binds to a region of the wild-type NT-proBNP comprising amino acid residues 42 to 46 of the wild-type NT-proBNP, or an antigen-binding fragment of said antibody is used.

[0113] The antibodies or antigen binding fragments that are applied in the use or method of the present invention may comprise a detectable label as described elsewhere.

[0114] In Figures 1 and 2 and in the following Examples section, reference is made to the mutations R72H and E69D in NT-proBNP. As described herein elsewhere, the R72H mutation is the same mutation as the R46H mutation, and the E69D mutation is the same mutation as the E46D mutation.

[0115] In the Figures: Figure 1: Concentration dependent antibody kinetics for antibody S-23.4.66 and for antibody rS-22.2.195 (see Example 3) Figure 2: Antibody sandwich experiments with recombinant proBNP and M-18.4.34-IgG as primary antibody and S-23.4.66-IgG or rS-22.2.195-IgG as secondary antibodies. M-18.4.34-IgG was applied as homologous secondary antibody control (see Example 4). Figure 3: Specificity of the antibody rS-22.2.195 for NT-proBNP-R46H Figure 4: Specificity of the antibody S-23.4.66 for NT-proBNP-E43D. EXAMPLES

[0116] The following Examples shall illustrate the invention. They shall, however, not be construed as limiting the scope of the invention.Example 1: Production of recombinant N-terminal proBNP (1-76) muteins NTproBNP (1-76) Mutein [R72H] (i.e. a Mutein comprising the R46H substitution) and NTproBNP (1-76) Mutein[ E69D] (i.e. a Mutein comprising the E43D substitution).

[0117] The nucleotide sequence of the N-terminal proBNP (amino acid sequence 1-76) was produced by means of genetic synthesis via PCR and the amplified genes were cloned in suitable expression vector (pQE80) allowing an expression with C-terminal Histidine-Tag. To obtain an optimum expression of the gene the DNA sequence was suited to the codons most frequently used in E. coli. The translated protein sequence consists of 92 amino acids comprising N-terminal four amino acid sequence MRGS (SEQ ID NO: 29) followed by NTproBNP(1-76), the amino acids GGGS (SEQ ID NO: 30) and 8 histidines: NTproBNP(1-76)Mutein[R72H]: MRGS-NTproBNP(1-76)[R72H]-GGGSHHHHHHHH (see SEQ ID NO: 27) NTproBNP(1-76)Mutein[E69D]:MRGS-NTproBNP(1-76)[E69D]-GGGSHHHHHHHH (see SEQ ID NO: 28)

[0118] The plasmids were transformed in E.coli. The recombinant E.coli clones were inoculated in Super Broth (with 100 µg / ml ampicillin) at an OD 600 of 0,2 and induced at an OD600 of 1,0 - 1,5 with IPTG (Isopropylthiogalactoside; 0,5 mM final concentration). After the induction the cultures were further incubated for 3 hours at 37°C. The cultures were then centrifuged and the cell pellet gathered in 20 mM Na-phosphate buffer, pH 7,5, 500 mM NaCl. After decomposition of the cell suspension via high pressure the suspension was centrifuged and the supernatant applied on Ni-NTA (Nitrilo-triacetate) column. After a washing step with 50 mM Na-phosphate buffer, pH 7,5, 500 mM NaCl, 20 mM Imidazole the histidine-tagged NT-pro BNP proteins were eluted using a linear gradient of increasing concentration of Imidazole (from 20 mM to 500 mM ) in 50 mM Na-phosphate buffer, pH 7,5, 500 mM NaCl buffer.Example 2: Production and screening for monoclonal antibodies against NTproBNP (1-76) Mutein [R72H] and NTproBNP (1-76) Mutein [E69D]

[0119] Sheep were immunized with recombinant NTproBNP(1-76)Mutein[R72H] and with recombinant NTproBNP(1-76)Mutein[E69D]. Freund's complete was used as adjuvant. After four initial immunizations, the immunizations were repeated in monthly intervals. One lymph node of sheep with positive reacting titer was removed under general anaesthesia and pain medication. After the surgical removal single cell preparations were made out of the lymph node tissue. The lymph node lymphocytes and the permanent myeloma cell line 1C10 (Bioventix) were fused with PEG at a ratio of 2 : 1 and cultured in Dulbecco's Modified Eagle's Medium supplemented with 4,5 mg / ml glucose, 10 % fetal calf serum (Hy-clone), 100 µmol / L non essential amino acids (Gibco), 5.7 µM azaserine / 100 µM hypoxanthine (Sigma), 50 U / ml human Interleukine-6 (Roche), 100 IU / ml penicillin / 100 µg / ml streptomycin (Sigma). The fusions were carried out according to the well-known method of Köhler and Millstein (Nature 256, 1975, p. 495-497). Hybridomas secreting antibodies specific for their respective immunogen sequence were finally cloned by single cell deposition using a FACSAria III.

[0120] To identify the presence and specificity of antibodies against NTproBNP(1-76)Mutein[R72H] or NTproBNP(1-76)Mutein[E69D] in the culture supernatant of the hybridoma cells the clones were evaluated by means of ELISA according to the following test principles:a) Reactivity with NTproBNP(1-76)Mutein[R72H]

[0121] Streptavidin coated 384-well microtiter plates (Microcoat) were coated with 1 µg / ml biotinylated MAK <NTproBNP> M-18.4.34 IgG-Bi mono (Roche) in incubation buffer (PBS buffer + 0,5% Byco C) for 1 hour at room temperature. M-18.4.34 binds to the region comprising amino acids 27 to 31 of SEQ ID NO: 3, e.g. the antibody binds to the mutated NT-proBNPs as set forth herein and to the wild-type. After washing with washing solution (0,9% NaCl + 0,05% Tween 20) a further incubation with the antigen NTproBNP(1-76)Mutein[R72H] diluted at 100 ng / ml in the incubation buffer were carried out for 1 hour at room temperature. After further washing step with washing solution the antibody sample incubation (hybridoma supernatants) were carried out with 50 µl / well for 1 hour at room temperature. After a further washing step with washing buffer incubation with the peroxidase-conjugated AffiniPure Donkey Anti-Sheep-IgG(H+I) detection antibody (Jackson Imm.Research) diluted 1 : 15.000 in incubation buffer were carried out for 1 hour at room temperature. After a further washing step with washing buffer the peroxidase activity was detected by incubation with ABTS (ready-to-use solution, Roche) for 20 minutes at room temperature and the extinction difference was read in mU at 405 nm by means of an ELISA reader.

[0122] Positively reacting hybridoma supernatants were then similarly screened for cross-reactivity against NTproBNP(1-76)Mutein[E69D] and the wild type NTproBNP(1-76).b) Reactivity with NTproBNP(1-76)Mutein[E69D]

[0123] Initial ELISA screenings were performed in similar way as described above using NTproBNP(1-76)Mutein[E69D] as antigen. Positively reacting hybridoma supernatants were then screened for cross-reactivity against NTproBNP(1-76)Mutein[R72H] and the wild type NTproBNP(1-76).Example 3: Characterization of kinetic properties of the monoclonal antibodies

[0124] A T200 instrument was mounted with a Biacore Series S Sensor Chip CM5. The system buffer was 1 mM KH 2 PO 4 , 10 mM Na 2 HPO 4 pH 7.4, 500 mM NaCl, 2.7 mM KCl, 0.05 % Tween 20. In order to determine the velocity factor, the system was incubated at 13 °C and 37 °C. The sample buffer was the system buffer, additionally supplemented with 1 mg / ml CMD (Carboxymethyldextran, Fluka). An antibody capture system was established. 5000 RU rabbit anti-sheep polyclonal antibody (Id.: 313-005-045, Dianova) were immobilized at 25 °C at 30 µg / ml in 10 mM sodium acetate buffer pH 5.0, by EDC / NHS coupling as described by the manufacturer. The capture system was regenerated by a 15 sec. wash at 20 µl / min with concentrated HBS buffer (100 mM HEPES pH 7.4, 1.5 M NaCl, 0.05 % (w / v) Tween 20) and a 30 sec injection of 100 mM HCl at 20 µl / min followed by a 10 mM glycine buffer pH 1.5 injection for 1 min at 20 µl / min. Antibodies to be captured were injected for 1 min at 10 µl / min at 40 nM concentration diluted in the respective system buffer pH 7.4. After antibody capturing the system was washed by 2.5-fold concentrated system buffer for 30 sec at 60 µl / min followed by 2 min baseline stabilization. Concentration-dependent analyte series were injected in 1:3 dilution steps, from 0.4 nM, 1.1 nM, 3.3 nM, two injections at 10 nM, 30 nM and 90 nM. In another embodiment, the analyte NTproBNP E69D was injected in concentration series from 1.1 nM, 3.3 nM, 10 nM, two injections at 30 nM, 90 nM and 270 nM. The analyte contact time was 5 min and the dissociation time was 10 min. Analyte kinetics were performed at 60 µl / min. Sheep antibodies were captured as ligands on the sensor surface: mAb<NTproBNP(E69D)>S-23.4.66-IgG, mAb<NTproBNP(R72H)>rS-22.2.195-IgG. Roche manufactured analytes were injected in solution: NT-proBNP (aa 1-76) (MW 8.5 kDa); proBNP (aa 27-102) (MW 9.9 kDa); NT-proBNP E69D (MW 10.2kDa); NT-proBNP R72H (MW 10.2 kDa); system buffer as control; 0-serum SB150610-001. The Biaevaluation software V.3.0 was used according to the instructions of the manufacturer GEHC. A 1:1 binding model with R MAX local was applied to determine kinetic rates.

[0125] Figure 1 shows concentration dependent antibody kinetics performed at 37°C. Antibody S-23.4.66 binds NT-proBNP E69D, but did not show any detectable interaction to full length wild-type NT-proBNP (aa 1-76), wild-type proBNP (aa27-102) and NT-proBNP R72H. The recombinant sheep antibody rS-22.2.195 shows no measureable interactions versus NT-proBNP(aa 1-76), proBNP(aa27-102) and NT-proBNP E69D, but specifically binds to NT-proBNP R72H. Kinetic data are summarized in table 1.

[0126] In order to estimate the thermodynamic binding properties of the sheep antibodies the temperature-dependent binding kinetic data at 13 °C and 37°C were used to calculate the Velocity Factor (US20140256915, Table 2). In short, the velocity factor is the quotient of the association rate velocities at ka 37°C and ka 13°C. If the quotient is below a value of 10, VF < 10, the antibody antigen binding is enthalpy dominated, whereas a velocity factor VF > 10 increases the likelihood of an entropy-driven kinetic. For matters of specificity and biophysical stability, preferably enthalpy-dominated antibody binding interactions are used for the detection of NT-proBNP wild-type and NT-proBNP mutants in immunological tests. Table 2: mAb analytes VF 5-23.4.66NTproBNP(E69D)1.8 r5-22.2.195NTproBNP(R72H)3.0 Example 4: Antibody Sandwich characterization

[0127] Antibody sandwich SPR measurements were conducted at 25 °C. A T200 instrument was used as described in example 3 under the same buffer conditions and sensor equipment. 12000 RU RbAMFcg (rabbit anti mouse Fc gamma, PAK<M-Fcg>Rb-IgG(IS), code: 315-005-046, Jackson Immuno Research) were immobilized at 25 °C at 40 µg / ml in 10 mM sodium acetate buffer pH 5.0, by EDC / NHS coupling as described by the manufacturer. The capture system was regenerated by a 15 sec wash at 20 µl / min with concentrated HBS buffer (100 mM HEPES pH 7.4, 1.5 M NaCl, 0.05 % (w / v) Tween 20), a 1 min injection of 10 mM glycine buffer pH 1.5 at 20 µl / min, followed by two injections for 1 min of 10 mM glycine buffer pH 1.7 at 20 µl / min. 150 nM of the primary murine anti-proBNP antibody M-18.4.34 (27-31) were captured for 1 min at 10 µl / min. Free binding valences of the capture system were saturated by a blocking solution. The blocking solution was injected for 3 min at 30 µl / min followed by 2 min baseline stabilization. The analytes NT-proBNP (aa 1-76) (MW 8.5 kDa) ; proBNP (aa 27-102) (MW 9.9 kDa) and NT-proBNP R72H (MW 10.2 kDa) were injected at 90 nM for 3 min at 30 µL / min. The analyte NT-proBNP E69D (MW 10.2kDa) was injected at 180 nM for 3 min at 30 µL / min. In another embodiment instead of recombinant proBNP analytes, human sera were applied as analytes in solution. The sera were diluted 1:5 with sample buffer and were injected at 5 µl / min for 20 min, so that the displayed primary antibody M-18.4.34 (27-31) was saturated by patient serum-derived, native proBNP antigen derivatives. Serum analytes were : 0-serum SB150610-001; NT-proBNP R72H serum; NT-proBNP wild-type serum SE 1053 DI 0580 with 27.39 ng / mL proBNP; In order to evaluate the sandwich performances, 250 nM of each secondary antibody mAb<NTproBNP(E69D)>S-23.4.66-IgG and mAb<NTproBNP(R72H)>rS-22.2.195-IgG SP / Q) were injected at 30 µl / min for 3 min association time and 3 min dissociation time Biaevaluation software V.3.0 was used according to the instructions of the manufacturer GEHC.

[0128] Antibody sandwich experiments with recombinant proBNP and M-18.4.34-IgG as primary antibody and S-23.4.66-IgG or rS-22.2.195-IgG as secondary antibodies are shown in figure 2. M-18.4.34-IgG was applied as homologous secondary antibody control. All sensor-grams show analyte saturation of the primary antibody M-18.4.34-IgG, followed by the secondary antibody injections. The primary antibody binds the antigens with high complex stability. rS-22.2.195-IgG shows specific complex formation with NT-proBNP R72H. Antibody S-23.4.66-IgG specific complex formation on NT-proBNP E69D.

[0129] Similar experiments were performed with human sera instead of recombinant analytes. Figure 2 focusses the secondary antibody injections as overlay data. Negative serum (0-serum SB150610-001) was referenced. Antibody rS-22.2.195-IgG forms an antibody sandwich complex specifically with NT-proBNP R72H serum, and no complex formation with wild-type NT-proBNP serum. S-23.4.66-IgG didn't show complex formation within serum samples (NT-proBNP E69D serum is not available).Example 5: Purification and Ruthenylation of monoclonal antibodies rS-22.2.195 and S-23.4.66 Purification of MAK<NTproBNP>S-23.4.66-IgG

[0130] A cell-free sheep hybridoma culture supernatant (CELLine, INTEGRA Biosciences AG) is adjusted to pH 4.75 and incubated 30min at RT. After centrifugation the IgG containing supernatant is supplemented with 0.5 M ammonium sulfate and 150mM NaCl and the pH is raised to 8.5. The solution is applied to a Protein A-column (ProSep ®< Ultra Plus, Merck Millipore) and the bound IgG is eluted with 100mM citrate, 100mM NaCl, pH 5.5. Following a dialysis against 50mM K-phosphate, 150mM NaCl pH 7.5 traces of bovine IgG originating from the FCS in the culture medium are removed using an immunoaffinity resin which specifically binds bovine IgG. The final product is concentrated (Amicon Ultra-30, Merck Millipore), filtered (0.22µm) and stored at -80°C.Purification of MAK<NTproBNP>rS-22.2.195-IgG

[0131] A cell-free culture supernatant of a CHO cell line expressing the recombinant antibody is adjusted to pH 4.75 and incubated 30min at RT. After centrifugation the IgG containing supernatant is supplemented with 0.5 M ammonium sulfate and 150mM NaCl and the pH is raised to 8.5. The solution is applied to a Protein A-column (ProSep ®< Ultra Plus, Merck Millipore) and the bound IgG was eluted with 100mM citrate, 100mM NaCl, pH 5.5. Following a dialysis against 50mM K-phosphate, 150mM NaCl pH 7.5 the final product is concentrated (Amicon Ultra-30, Merck Millipore), filtered (0.22µm) and stored at -80°C.Ruthenylation of MAK<NTproBNP>S-23.4.66-IgG and MAK<NTproBNP>rS-22.2.195

[0132] The Protein A-purified antibodies are dialysed against the ruthenylation buffer (100 mM K-phosphate pH 8.5) and then the solution is adjusted to a protein concentration of 1 mg / ml. Ruthenium(II) tris(bipyridyl)-UEEK-N-hydroxysuccinimide ester is dissolved in DMSO at a concentration > 5mg / ml. A 15-fold molar excess of BPRu-UEEK-DDS is added to the IgG solution and the reaction is performed for 45 minutes at 25°C while mixing vigorously. The reaction is stopped by adding L-lysin at a final concentration of 10mM. The excess of the labelling reagent is removed by gel permeation chromatography on Superdex 200 (GE Healthcare Life Sciences) using 100mM K-phosphate, 150mM KCl pH 7.5 as running buffer. The fractions containing the conjugated IgG are pooled and the final product is stabilized with 6.5 % saccharose and stored at -80°C.Example 6: Method of detecting mutated NT-proBNP

[0133] One method to detect NT-proBNP is the well-established Roche Elecsys ®< assay technology which is based on electrochemiluminescence. The Elecsys ®< assays are heterogenous immunoassays and function according to the sandwich principle: an antibody-antigen-antibody complex is formed by using a capture and a detection (signal) antibody which were raised against different epitopes of the analyte. An Elecsys ®< assay to detect mutated NT-proBNP comprises the following steps and components: a) The sample is incubated with a monoclonal capture antibody, e.g. M-18.4.34, and with rS-22.2.195, or S-23.4.66, or both as monoclonal signal antibodies in a phosphate-buffered (100 mM, pH 5.8) matrix containing preservatives (Oxy-Pyrion 0.1%, N-Methylisothiazolon 0.1%), a detergent (0.1%), stabilizing and interference-avoiding proteins (e.g. Albumin, Streptavidin-Poly). b) The biotinylated capture antibody (e.g. M-18.4.34) and one out of the ruthenium-labeled detection antibodies rS-22.2.195 specific for NT-proBNP-R46H or S-23.4.66 specific for NT-proBNP-E43D form a sandwich complex with the analyte. c) The sandwich complex is bound to streptavidin-coated microparticles which are then magnetically captured onto the surface of the electrode. d) Unbound substances are removed with ProCell. e) Chemiluminescent emission is induced by application of a voltage to the electrode and measured by a photomultiplier. f) NT-proBNP values are calculated via a calibration curve which is instrument-specific.

[0134] If the Elecsys assay should detect mutated and wild-type NT-proBNP, an additional signal antibody specific for wild-type NT-proBNP, e.g. S-1.21.3, can be included in the assay mixture.Example 7: Antibodies rS-22.2.195 and S-23.4.66 are highly specific for mutated NT-proBNP

[0135] The specificity of the two newly generated antibodies, rS-22.2.195 and S-23.4.66, was assessed with an NT-proBNP-specific Elecsys ®< assay as described in Example 5. Human NT-proBNP-free sera were spiked with a series of recombinant wild-type and mutated peptides so that they cover the range of NT-proBNP concentrations observed in heart failure patients. NT-proBNP in the samples was then detected with either rS-22.2.195 specific for NT-proBNP-R46H (Figure 3) or S-23.4.66 specific for NT-proBNP-E43D (Figure 4).

[0136] The results in Figure 3 and 4 show that both antibodies, rS-22.2.195 and S-23.4.66, do not bind to wild-type NT-proBNP at all, but recognize the mutated peptides with high intensity. Furthermore, both antibodies show a wide range of linear correlation of signal vs. analyte concentration and therefore allow quantitation of NT-proBNP across the whole concentration range commonly found in heart failure patients.Example 8: Reactivity with mutated NT-proBNP (R46H) in patient samples

[0137] The reactivity of the new antibodies with native mutated NT-proBNP was assessed in serum or plasma samples from eight patients known to show clear symptoms of heart failure (Table 4, patient 1-8). Only patients with an R46H mutation were available. For three patients, the presence of the R46H mutation was also confirmed by sequencing. NT-proBNP was quantified using the Elecsys ®< assay system described in example 5 with rS-22.2.195 specific for NT-proBNP-R46H as signal antibody and M-18.4.34 as capture antibody. For comparison, the same patient samples were measured with an Elecsys ®< kit containing S-23.4.66 specific for NT-proBNP-E43D as signal antibody and M-18.4.34 as capture antibody. Calibration of both assay systems was done with calibrators based on recombinant mutated NT-proBNP (R46H or E43D, respectively). Table 3:Target values rS-22.2.195 S-23.4.66 sample name pg / mL counts pg / mL counts pg / mL R46H_Cal_105560R46H_Cal_21403538146R46H_Cal_32806722295R46H_Cal_462514232638R46H_Cal_51250279821254R46H_Cal_61250029494312543R46H_Cal_71644038252716149R46H_Cal_84050099318040801E43D_Cal_106060E43D_Cal_21401391193E43D_Cal_32802094338E43D_Cal_46254213734E43D_Cal_5125083491430E43D_Cal_6125008829211891E43D_Cal_71644012713316377E43D_Cal_84050037095441832patient 19654642295970patient 2 *401278169186100patient 3 *4757021166110patient 447302026020patient 548472076000patient 6 *5284823466193patient 7533739223216266patient 8309914131626287* R46H mutation was confirmed by sequencing

[0138] The assay kit containing the rS-22.2.195 antibody clearly detected NT-proBNP-R46H in all patient samples. Control kits using S-23.4.66 as signal antibody did not detect significant amounts of NT-proBNP (≤ 7 pg / mL). This result again shows the high specificity of rS-22.2.195 and S-23.4.66 for the two point mutations R46H and E43D, respectively, but now also with native samples. The NT-proBNP concentrations quantified with rS-22.2.195 range from 202 to 22321 pg / mL. In the past, the decision threshold for diagnosis of cardiac dysfunction was determined to be 125 pg / mL of (wild-type) NT-proBNP (Roche Elecsys ®< proBNP II assay). Thus, the measured concentrations of mutated NT-proBNP being all > 125 pg / mL might reflect the patients' symptoms of heart failure.

[0139] The sequences referred to herein are shown in the sequence listing and in the following table. Table A: Sequences described in the present applicationSEQ ID NOBrief descriptionSequence1NT-proBNP with R46H mutationHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPH PTGVWKSREVATEGIRGHRKMVLYTLRAPR(position 46 indicated in bold)2NT-proBNP with E43D mutationHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQD SPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR(position 43 indicated in bold)3wild-type NT-proBNPHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR4light chain of antibody S-22.2.195(CDR1 - CDR2 - CDR3) indicated in bold (in this order)5heavy chain of antibody S-22.2.195(CDR1 - CDR2 - CDR3) indicated in bold (in this order)6fragment of NT-proBNP with R46H mutationESPHPTG7fragment of NT-proBNP with R46H mutationQESPHPTGVW8fragment of NT-proBNP with E43D mutationPLQDSPR9fragment of NT-proBNP with E43D mutationEPLQDSPRPT10nucleic acid sequence for light chain of antibody S-22.2.195 11nucleic acid sequence for heavy chain of antibody S-22.2.195 12light chain of antibody S-23.4.66(CDR1 - CDR2 - CDR3) indicated in bold (in this order)13heavy chain of antibody S-23.4.66(CDR1 - CDR2 - CDR3) indicated in bold (in this order)14nucleic acid sequence for light chain of antibody S-23.4.6615nucleic acid sequence for heavy chain of antibody S-23.4.66 16CDR1, light chain, antibody S-22.2.195LLDDAYCDR2, light chain, antibody S-22.2.195KDS17CDR3, light chain, antibody S-22.2.195LSVDSSEYSV18CDR1, heavy chain, antibody S-22.2.195GFSLIGEY19CDR2, heavy chain, antibody S-22.2.195MASGGTI20CDR3, heavy chain, antibody S-22.2.195VRSSVSPGDDRDV21CDR1, light chain, antibody S-23.4.66SSNVGYGNYCDR2, light chain, antibody S-23.4.66SAT22CDR3, light chain, antibody S-23.4.66VSYDSSSKFGV23CDR1, heavy chain, antibody S-23.4.66GFSVTNSG24CDR2, heavy chain, antibody S-23.4.66INNDGVA25CDR3, heavy chain, antibody S-23.4.66GTRDLPSDVRYGNMY INY26NT-proBNP with R46H mutation with additional sequences such as His tag27NT-proBNP with R46H mutation with additional sequences such as His tag28NT-proBNP with E43D mutation with additional sequences such as His tag

Claims

1. An antibody that specifically binds a mutated human N-terminal fragment of pro-brain natriuretic peptide (NT-proBNP), wherein said antibody is selected from i) an antibody that specifically binds to mutated human NT-proBNP comprising a mutation substituting arginine at position 46 with histidine, and wherein the antibody is characterized in that the light chain variable domain comprises a CDR1 having the sequence LLDDAY (SEQ ID NO: 16), a CDR2 having the sequence KDS, and a CDR3 having the sequence LSVDSSEYSV (SEQ ID NO: 17), and the heavy chain variable domain comprises a CDR1 having the sequence GFSLIGEY (SEQ ID NO: 18), a CDR2 having the sequence MASGGTI (SEQ ID NO: 19), and a CDR3 having the sequence VRSSVSPGDDRDV (SEQ ID NO: 20), and ii) an antibody that specifically binds to mutated human NT-proBNP comprising a mutation substituting glutamic acid at position 43 with aspartic acid, and wherein the antibody is characterized in that the light chain variable domain comprises a CDR1 having the sequence SSNVGYGNY (SEQ ID NO: 21) a CDR2 having the sequence SAT, and a CDR3 having the sequence VSYDSSSKFGV (SEQ ID NO: 22), and the heavy chain variable domain a CDR1 having the sequence GFSVTNSG (SEQ ID NO: 23), a CDR2 having the sequence INNDGVA (SEQ ID NO: 24), and a CDR3 having the sequence GTRDLPSDVRYGNMYINY (SEQ ID NO: 25), wherein said antibody does not bind to wild-type human NT-proBNP.

2. The antibody of claim 1, wherein said antibody is a monoclonal antibody.

3. The antibody of claim 2, wherein said antibody is a sheep antibody.

4. An antigen-binding fragment of the antibody of any one of claims 1 to 3, wherein the antigen-binding fragment is selected from the group consisting of a Fab fragment, a Fab' fragment, a Facb fragment, a F(ab')2 fragment, a scFv fragment, and a Fv fragment.

5. The antibody of any one of claims 1 to 3, or the antigen-binding fragment of claim 4, wherein said antibody or said antigen-binding fragment is linked to a detectable label, such as an enzyme, biotin, a radioactive label, a fluorescent label, a chemiluminescent label, an electrochemiluminescent label, a gold label, or a magnetic label.

6. The antibody of any one of claims 1 to 3, or the antigen-binding fragment of claim 4, wherein said antibody or said antigen-binding fragment is linked to an electrochemiluminescent label comprising ruthenium.

7. A kit or composition comprising a) i) an antibody or an antigen-binding fragment thereof according to any one of claims 1 to 6 alternative i), and ii) an antibody or an antigen-binding fragment thereof according to any one of of claims 1 to 6 alternative ii), or b) i) an antibody or an antigen-binding fragment thereof according to any one of claims 1 to 6 alternative i), and ii) an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment thereof or c) i) an antibody or an antigen-binding fragment thereof according to any one of claims 1 to 6 alternative ii), and ii) an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment thereof, or d) i) an antibody or an antigen-binding fragment thereof according to any one of claims 1 to 6 alternative i), and ii) an antibody or an antigen-binding fragment thereof according to any one of claims 1 to 6 alternative ii), and iii) an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment thereof, and optionally wherein the kit or composition as set forth under a), b), c) or d) further comprises an antibody which binds to a different epitope in human NT-proBNP, in particular wherein said antibody binds to an epitope present in amino acids 1 to 35 of human NT-proBNP.

8. A mutated human NT-proBNP selected from SEQ ID NOs: 1 and 2 or a fragment of said mutated human NT-proBNP selected from SEQ ID NOs: 6, 7, 8 and 9, preferably wherein said mutated human NT-proBNP or fragment is operably linked to a purification tag or to a carrier protein.

9. An isolated polynucleotide encoding the mutated human NT-proBNP of claim 8, or the fragment of claim 8, preferably wherein said polynucleotide is operably linked to a heterologous promoter.

10. An isolated host cell i) producing the antibody of any one of claims 1 to 3, or the antigen-binding fragment of claim 4, or ii) comprising the mutated human NT-proBNP of claim 8 or the fragment of claim 8, the polynucleotide of claim 9, or an expression vector comprising said polynucleotide.

11. A composition comprising an immunoadjuvant and the mutated human NT-proBNP of claim 8, or the fragment of claim 8.

12. A kit or composition comprising: (i) a mutated human NT-proBNP of SEQ ID NO: 1, or fragment thereof according to SEQ ID NO: 6 or 7, or (ii) a mutated human NT-proBNP of SEQ ID NO: 2, or a fragment thereof according to SEQ ID NO: 8 or 9, or (iii)a mutated human NT-proBNP of SEQ ID NO: 1, or fragment thereof according to SEQ ID NO: 6 or 7, and a mutated human NT-proBNP of SEQ ID NO: 2, or a fragment thereof according to SEQ ID NO: 8 or 9, wherein optionally said kit or composition further comprises the wild-type human NT-proBNP, or a fragment thereof, wherein said fragment comprises at least amino acid residues 42 to 46 of the wild-type human NT-proBNP.

13. A method of diagnosing heart failure in a subject, comprising the steps of: a) determining the amount of NT-proBNP in a blood, serum or plasma sample from a subject, and b) comparing the amount of NT-proBNP as determined in step a) to a reference amount, thereby diagnosing heart failure, wherein the determination of the amount of NT-proBNP in step a) comprises the step of contacting the sample with at least: (i) an antibody according to any one of claims 1 to 6 alternative i), or an antigen binding fragment thereof, and an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment of said antibody, or (ii) an antibody according to any one of claims 1 to 6 alternative ii), or an antigen binding fragment thereof, and an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment of said antibody, or (iii) an antibody according to any one of claims 1 to 6 alternative i) that specifically binds to mutated human NT-proBNP comprising a mutation substituting arginine at position 46 with histidine, and wherein the antibody is characterized in that the light chain variable domain comprises a CDR1 having the sequence LLDDAY (SEQ ID NO: 16), a CDR2 having the sequence KDS, and a CDR3 having the sequence LSVDSSEYSV (SEQ ID NO: 17), and the heavy chain variable domain comprises a CDR1 having the sequence GFSLIGEY (SEQ ID NO: 18), a CDR2 having the sequence MASGGTI (SEQ ID NO: 19), and a CDR3 having the sequence VRSSVSPGDDRDV (SEQ ID NO: 20), or an antigen binding fragment thereof, and an antibody according to any one of claims 1 to 6 alternative ii), or an antigen binding fragment thereof, and an antibody that specifically binds to wild-type human NT-proBNP, wherein the antibody specifically binds to a region of the wild-type human NT-proBNP comprising amino acid residues 42 to 46 of the wild-type human NT-proBNP, or an antigen-binding fragment of said antibody.

14. In vitro use of the antibody of any one of claims 1 to 3, 5 and 6, or the antigen-binding fragment of any one of claims 4 to 6, for the diagnosis of heart failure.