Novel biomarker of coronary artery occlusion

EP4802281A1Pending Publication Date: 2026-09-09ALIER BIOTECH LTD
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
EP2024886444
Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-11-01
Filing Date
2024-10-31
Publication Date
2026-09-09

AI Technical Summary

Technical Problem

There is a significant unmet clinical need to identify circulating biomarkers that can rapidly triage patients suspected of having a significant coronary artery occlusion, reducing the burden on hospitals and clinics from performing complex cardiac imaging procedures.

Method used

The use of insulin-like growth factor binding protein 3 (IGFBP-3) as a novel circulating biomarker, measured through assays and test kits, to determine whether a patient has a coronary artery occlusion, thereby informing triage decisions involving cardiac imaging.

Benefits of technology

The measurement of IGFBP-3 levels, particularly through delta IGFBP-3 values, significantly enhances the prediction of coronary artery occlusions, improving the accuracy of triage decisions and reducing the need for unnecessary cardiac imaging procedures.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure NZ2024050119_08052025_PF_FP_ABST
    Figure NZ2024050119_08052025_PF_FP_ABST
Patent Text Reader

Abstract

The present invention is concerned with the unexpected discovery that IGFBP-3 is correlated with coronary artery occlusion in patients who present to a hospital, clinic or medical forum with a suspected complaint of cardiac origin. The measured levels of IGFBP-3 may used in a risk stratification analysis to distinguish patients who are likely to have a coronary artery occlusion and should therefore undergo cardiac imaging (e.g. coronary angiography) from those patients who are unlikely to have a coronary artery occlusion and who do not need to undergo a cardiac imaging procedure. Accordingly, the present invention provides assay methods and test kits involving the measurement of IGFBP-3, optionally across different time points and in combination with other risk factors and / or clinical observations, to yield important information for the clinical triaging of patients at risk from a life-threatening cardiovascular events.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] NOVEL BIOMARKER OF CORONARY ARTERY OCCLUSION

[0002] TECHNICAL FIELD

[0003] The present invention is concerned with a novel circulating biomarker to predict a significant coronary artery occlusion. In particular, the present invention provides assays, methods and test kits for detection of insulin-like growth factor binding protein 3 (IGFBP-3), optionally used in conjunction with other risk factors or clinical observations, to rule-in or rule-out patients predicted to have a coronary artery occlusion and consequently inform triage decisions involving (e.g.) coronary angiography or other imaging modalities.

[0004] BACKGROUND OF THE INVENTION

[0005] The following includes information that may be useful in understanding the present invention. It is not an admission that any of the information, publications or documents specifically or implicitly referenced herein is prior art, or essential, to the presently described or claimed inventions. All publications and patents mentioned herein are hereby incorporated herein by reference in their entirety.

[0006] Coronary artery disease is a common heart condition. The major blood vessels that supply the heart (coronary arteries) struggle to send enough blood, oxygen and nutrients to the heart muscle. Cholesterol deposits (plaques) in the heart arteries and inflammation are a typical cause of coronary artery disease.

[0007] Signs and symptoms of coronary artery disease occur when the heart doesn't get enough oxygen-rich blood. Patients who have coronary artery disease have reduced blood flow to the heart which may manifest itself in chest pain (angina) and shortness of breath. A complete blockage of blood flow can cause heart attack / myocardial ischemia.

[0008] Coronary artery disease often develops over decades. Symptoms may go unnoticed until a significant blockage causes health problems or a heart attack occurs.

[0009] Symptoms may go unrecognised at first, or they may only occur when the heart is beating hard like during exercise. As the coronary arteries continue to narrow, less and less blood gets to the heart and symptoms can become more severe or frequent.

[0010] Coronary angiography is typically used to triage patients who present to an emergency department, clinic or surgery with suspected coronary artery disease, although other imaging modalities known in the art and described herein may be used. During the procedure a catheter is inserted into a blood vessel in a patient's groin or arm, and X-ray images are used to guide the tip of the catheter as it is passed up to the heart and coronary arteries. A special type of dye called contrast medium is injected through the catheter and X-ray images (angiograms) are taken. The contrast medium is visible on the angiograms, showing the blood vessels the fluid travels through and highlights any blood vessels that are narrowed or blocked. The procedure is also carried out under local anaesthetic.

[0011] Coronary angiography is a complex procedure which involves significant clinical resource in terms of both dedicated equipment / instrumentation as well as the expertise of experienced clinicians and nurses.

[0012] Accordingly, there is a major unmet clinical need to identify circulating biomarkers with a potential to rapidly triage those patients suspected of having a significant coronary artery occlusion which results in, or has the potential to result in, (e.g.) angina, cardiac ischemia including acute myocardial infarction, and heart failure from those patients who are not at risk.

[0013] The present invention addresses this unmet clinical need through identification of a novel circulating biomarker of coronary artery occlusion. This unexpected finding is clinically relevant because it would help identify patients who do not require a cardiac imaging / coronary angiography which in turn would reduce the high burden currently placed on hospitals and clinics in performing this procedure.

[0014] SUMMARY OF THE INVENTION

[0015] The inventions described and claimed herein have many attributes and embodiments including, but not limited to, those set forth or described or referenced in this Summary of the Invention. It is not intended to be all inclusive and the inventions described and claimed herein are not limited to or by the features or embodiments identified in this Summary of the Invention, which is included for purposes of illustration only and not restriction.

[0016] In an aspect of the present invention there is provided a method for determining whether a patient with a suspected underlying cardiovascular condition has a coronary artery occlusion and should undergo cardiac imaging, the method comprising:

[0017] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0018] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0019] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0020] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0021] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population reflects that the patient is likely to have a coronary artery occlusion and should undergo cardiac imaging, or wherein, a decrease in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population reflects that the patient is unlikely to have a coronary artery occlusion and does not need to undergo cardiac imaging, and wherein, AIGFBP-3 is measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and history of coronary artery disease to determine the presence of the coronary artery occlusion.

[0022] In another aspect of the present invention there is provided a method for determining whether a patient with a suspected underlying cardiovascular condition has a coronary artery occlusion and should undergo cardiac imaging, the method comprising:

[0023] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient at index presentation; and

[0024] (ii) comparing the concentration of IGFBP-3 in the patient sample at index presentation against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the IGFBP-3 value in the patient sample at index presentation relative to the reference standard from the control population reflects that the patient is likely to have a coronary artery occlusion and should undergo cardiac imaging, or wherein, an increase in the IGFBP-3 value in the patient sample at index presentation relative to the reference standard from the control population reflects that the patient is unlikely to have a coronary artery occlusion and does not need to undergo cardiac imaging, and wherein, IGFBP-3 is measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and history of coronary artery disease to determine the presence of the coronary artery occlusion.

[0025] In another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising:

[0026] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient; and

[0027] (ii) comparing the concentration of IGFBP-3 in the patient sample against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the concentration of IGFBP-3 in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion. In another aspect of the present invention there is provided a method for predicting a >70% coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising:

[0028] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient; and

[0029] (ii) comparing the concentration of IGFBP-3 in the patient sample against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the concentration of IGFBP-3 in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a >70% coronary artery occlusion.

[0030] In yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising :

[0031] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0032] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0033] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0034] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0035] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion.

[0036] In yet another aspect of the present invention there is provided a method for predicting a >70% coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising :

[0037] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0038] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0039] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0040] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a >70% coronary artery occlusion.

[0041] In yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who has a troponin T concentration of <14 ng / L at index presentation, the method comprising :

[0042] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0043] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0044] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0045] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0046] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion.

[0047] In yet another aspect of the present invention there is provided a method for predicting a >70% coronary artery occlusion in a patient who has a troponin T concentration of <14 ng / L at index presentation, the method comprising :

[0048] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0049] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0050] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0051] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a >70% coronary artery occlusion.

[0052] In yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who has no history of coronary artery disease and is not having an acute myocardial infarction at index presentation, the method comprising:

[0053] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0054] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0055] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0056] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0057] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, optionally measured together with abnormal cholesterol, reflects that the patient has a significant coronary artery occlusion.

[0058] In yet another aspect of the present invention there is provided a method for predicting a >70% coronary artery occlusion in a patient who has no history of coronary artery disease and is not having an acute myocardial infarction at index presentation, the method comprising:

[0059] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0060] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0061] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0062] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value; and

[0063] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, optionally measured together with abnormal cholesterol, reflects that the patient has a >70% coronary artery occlusion.

[0064] In yet another aspect of the present invention there is provided a method for identifying a patient who is susceptible to inducible ischemia, the method comprising :

[0065] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0066] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0067] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0068] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value; and

[0069] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one or both of an abnormal peak heart rate and abnormal levels of troponin T, reflects that the patient has a >70% coronary artery occlusion.

[0070] In yet another aspect of the present invention there is provided a method for treating a patient with a significant coronary artery occlusion, the method comprising:

[0071] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0072] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0073] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0074] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0075] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion (iii) treating the patient with any one or more of a coronary angioplasty with or without insertion of a stent, coronary artery bypass graft, heart transplant, blood thinning agents, statins, beta-blockers, nitrates, angiotensin-converting enzyme inhibitors, angiotensin-2 receptor blockers, calcium channel blockers, antiangina drugs and diuretics, thereby reducing or eliminating the coronary artery occlusion.

[0076] In yet another aspect of the present invention there is provided a method for treating a patient with a >70% coronary artery occlusion, the method comprising:

[0077] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0078] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0079] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0080] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0081] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a >70% coronary artery occlusion

[0082] (iii) treating the patient with any one or more of a coronary angioplasty with or without insertion of a stent, coronary artery bypass graft, heart transplant, blood thinning agents, statins, beta-blockers, nitrates, angiotensin-converting enzyme inhibitors, angiotensin-2 receptor blockers, calcium channel blockers, antiangina drugs and diuretics, thereby reducing or eliminating the coronary artery occlusion.

[0083] In yet another aspect of the present invention there is provided a method to rule-out a patient with a suspected cardiac condition from a triage procedure involving cardiac imaging, the method comprising:

[0084] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient; and

[0085] (ii) comparing the concentration of IGFBP-3 in the patient sample against a reference standard of IGFBP-3 from a control population, wherein, an increase in the concentration of IGFBP-3 in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient should be ruled-out from the triage procedure involving cardiac imaging.

[0086] In yet another aspect of the present invention there is provided a method to rule-in a patient with a suspected cardiac condition for a triage procedure involving cardiac imaging, the method comprising:

[0087] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient; and

[0088] (ii) comparing the concentration of IGFBP-3 in the patient sample against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the concentration of IGFBP-3 in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient should be ruled-in for the triage procedure involving cardiac imaging.

[0089] In yet another aspect of the present invention there is provided a method to rule-out a patient with a suspected cardiac condition from a triage procedure involving cardiac imaging, the method comprising:

[0090] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0091] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0092] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0093] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0094] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, a decrease in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient should be ruled-out from the triage procedure involving cardiac imaging.

[0095] In yet another aspect of the present invention there is provided a method to rule-in a patient with a suspected cardiac condition for a triage procedure involving cardiac imaging, the method comprising: (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0096] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0097] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0098] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0099] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient should be ruled-in for the triage procedure involving cardiac imaging.

[0100] BRIEF DESCRIPTION OF THE FIGURES

[0101] Figure 1 shows Receiver Operating Curve (ROC) performance of (i) [sex + history of coronary artery disease + age + elevated systolic blood pressure + abnormal cholesterol + hsTnT] and (ii) [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + IGFBP-3(T-O>] in a combined patient cohort (SPACE, APACE and FAST-TRAC; T=0 represents the measured value of IGFBP-3 at index presentation) to predict the presence of a >70% coronary artery occlusion. This combined cohort included a total of n = 436 patients who (i) were diagnosed as not having an acute myocardial infarction and (ii) underwent an angiogram of which n = 233 were determined to have a >70% coronary artery occlusion. The area under the curve values for the prediction of a coronary artery occlusion: (i) [sex + history of coronary artery disease + age + elevated systolic blood pressure + abnormal cholesterol + hsTnT] yielded an AUC = 0.677 ± 0.026 and (ii) [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + IGFBP-3(T-O)] yielded an AUC = 0.740 ± 0.024. IGFBP-3 levels (ng / mL) were measured by ELISA using the assay described in Example 1.

[0102] Figure 2 shows Receiver Operating Curve (ROC) performance of (i) [sex + history of coronary artery disease + age + elevated systolic blood pressure + abnormal cholesterol + hsTnT] and (ii) [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + AIGFBP-3(T-o-2h)] in a combined patient cohort (SPACE, APACE and FAST-TRAC) to predict the presence of a >70% coronary artery occlusion. This combined cohort included a total of n = 335 patients who (i) were diagnosed as not having an acute myocardial infarction and (ii) underwent an angiogram of which n = 184 were determined to have a coronary artery occlusion. The area under the curve values for the prediction of a >70% coronary artery occlusion: (i) [sex + history of coronary artery disease + age + elevated systolic blood pressure + abnormal cholesterol + hsTnT] yielded an AUC = 0.683 ± 0.030 and (ii) [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + AIGFBP-3(T-o-2h)] yielded an AUC = 0.738 ± 0.027. IGFBP-3 levels (ng / mL) were measured by ELISA using the assay described in Example 1.

[0103] Figure 3 shows Receiver Operating Curve (ROC) performance of (i) [history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + hsTnT] and (ii) [history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + hsTnT + AIGFBP-3(T-o-2h)] in a combined patient cohort (SPACE, APACE and FAST-TRAC) to predict the presence of a >70% coronary artery occlusion. This combined cohort included a total of n = 245 patients who underwent an angiogram of which n = 131 were determined to have a >70% coronary artery occlusion. The area under the curve values for the prediction of a coronary artery occlusion: (i) [history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + hsTnT] yielded an AUC = 0.703 ± 0.034 and (ii) [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + AIGFBP-3(T-o-2h)] yielded an AUC = 0.741 ± 0.032. IGFBP-3 levels (ng / mL) were measured by ELISA using the assay described in Example 1.

[0104] Figure 4 shows a diagnostic decision pathway analysis of all emergency department patients who were sent for angiography, addition of AIGFBP-3(T-o-2h) to this pathway resulted in a 28% relative increase in those correctly identified as being low risk (representing a 5% absolute increase), with no false identification of high-risk individuals. According to these data, at 90% fixed sensitivity the specificity improved from 32% to 44%.

[0105] Figure 5 shows Receiver Operating Curve (ROC) performance of (i) [peak heart rate + hsTnT] (grey line) and (ii) [peak heart rate + hsTnT + AIGFBP-3(T-o-2h)] (black line) in stress test patient cohort (BASEL VIII) to predict inducible ischemia in a patient. This cohort included a total of n = 163 patients who (i) have no history of coronary artery disease and were diagnosed as not having an acute myocardial infarction and (ii) underwent an angiogram of which n = 44 were determined to have inducible ischemia. The area under the curve values for the prediction of inducible ischemia: (i) [peak heart rate + hsTnT] yielded an AUC = 0.703 ± 0.047 and (ii) [peak heart rate + hsTnT + AIGFBP-3(T-o-2h)] yielded an AUC = 0.742 ± 0.047. IGFBP-3 levels (ng / mL) were measured by ELISA using the assay described in Example 1.

[0106] Figure 6 shows Receiver Operating Curve (ROC) performance of (i) abnormal cholesterol (grey line) and (ii) [abnormal cholesterol + AIGFBP-3(T-o-2h)] (black line) in a combined patient cohort (SPACE, APACE and FAST-TRAC) to predict the presence of a >70% coronary artery occlusion. This cohort included a total of n = 154 patients who (i) have no history of coronary artery disease and were diagnosed as not having an acute myocardial infarction and (ii) underwent an angiogram of which n = 63 were determined to have a >70% coronary artery occlusion. The area under the curve values for the prediction of a coronary artery occlusion: (i) abnormal cholesterol yielded an AUC = 0.656 ± 0.038 and (ii) [abnormal cholesterol + AIGFBP-3(T-o-2h)] yielded an AUC = 0.730 ± 0.043. IGFBP-3 levels (ng / mL) were measured by ELISA using the assay described in Example 1.

[0107] DETAILED DESCRIPTION

[0108] General Definitions

[0109] Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art to which the inventions belong (for example, in immunology, immunohistochemistry, protein chemistry, and biochemistry).

[0110] Unless otherwise indicated, the recombinant protein and immunological techniques utilized in the present invention are standard procedures well known to those skilled in the art. Such techniques are described and explained throughout the literature in sources such as, J. Perbal, A Practical Guide to Molecular Cloning, John Wiley and Sons (1984), J. Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1989), T.A. brown (editor), Essential Molecular Biology: A Practical Approach, Volumes 1 and 2, IRL Press (1991), D.M. Glover and B.D. Hames (editors), DNA Cloning: A Practical Approach, Volumes 1-4, IRL Press (1995 and 1996), and F.M. Ausubel et al., (editors), Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience (1988, including all updates until present), Ed Harlow and David Lane (editors) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, (1988), and J.E. Coligan et al., (editors) Current Protocols in Immunology, John Wiley & Sons (including all updates until present).

[0111] The term "and / or", e.g., "X and / or Y" shall be understood to mean either "X and Y" or "X or Y" and shall be taken to provide explicit support for both meanings or for either meaning.

[0112] Throughout this specification, unless specifically stated otherwise or the context requires otherwise, reference to a single step, composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e. one or more) of those steps, compositions of matter, groups of steps or group of compositions of matter.

[0113] It is intended that reference to a range of numbers disclosed herein (for example 1 to 10) also incorporates reference to all related numbers within that range (for example, 1, 1.1, 2, 3, 3.9, 4, 5, 6, 6.5, 7, 8, 9 and 10) and also any range of rational numbers within that range (for example 2 to 8, 1.5 to 5.5 and 3.1 to 4.7) and, therefore, all sub-ranges of all ranges expressly disclosed herein are expressly disclosed. These are only examples of what is specifically intended and all possible combinations of numerical values between the lowest value and the highest value enumerated are to be considered to be expressly stated in this application in a similar manner.

[0114] Throughout this specification the word "comprise", or variations such as "comprises" or "comprising", will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.

[0115] Those skilled in the art will appreciate that the invention described herein is susceptible to variations and modifications other than those specifically described. It is to be understood that the invention includes all such variations and modifications. The invention also includes all of the steps, features, compositions and compounds referred to or indicated in this specification, individually or collectively, and any and all combinations or any two or more of said steps or features.

[0116] The present invention is not to be limited in scope by the specific embodiments described herein, which are intended for the purpose of exemplification only. Functionally-equivalent products, compositions and methods are clearly within the scope of the invention, as described herein.

[0117] Any example or embodiment described herein shall be taken to apply mutatis mutandis to any other example or embodiment unless specifically stated otherwise.

[0118] Selected Definitions

[0119] The terms "abnormal HDL" and "abnormal high-density lipoprotein" as used herein means an amount or concentration of HDL which is considered abnormal for a given age range. For example, abnormal HDL may include an amount or concentration that is abnormally high (e.g. >1.5 mM) or abnormally low (e.g. <1.03 mM). A person skilled in the art would understand how to make a routine assessment with respect to abnormal HDL by comparing the level of HDL from a test sample against a reference interval or value from a control population having normal HDL levels. The present invention is typically concerned with a decreased level of high-density lipoprotein relative to a reference standard.

[0120] The term "ACS" as used herein means acute coronary syndrome. Examples of acute coronary syndromes include, but are not limited to, unstable angina or acute ischemia; cardiac ischemia and myocardial ischemia; Type 1 and Type 2 (acute) myocardial infarction including ST-elevation myocardial infarction and non-ST myocardial infarction; acute cardiac injury; acute cardiac damage resulting from acute drug toxicity, acute cardiomyopathies and cardiac transplant rejection. The term "angina" as used herein means any form of chest pain whether that chest pain was experienced historically (e.g. "history of angina") or in an acute setting.

[0121] For any avoidance of doubt the term "history of angina" is taken to mean a patient who has had any history of cardiovascular disease or has a history of chest pain complaints. The terms "history of angina", "history of cardiovascular disease" and "history of chest pain" as used herein are therefore synonymous.

[0122] The term "CAD" as used herein means coronary artery disease. In certain contexts, "CAD" refers to a patient who has, or has a history of, coronary artery disease. Coronary artery disease is also known as coronary heart disease.

[0123] The term "cardiac imaging" as used herein is intended to mean any (minimally invasive) imaging technique that may be used to image the heart and its surrounding structures / tissues and typically includes the modalities of computed tomography (CT), cardiac ultrasound (echocardiography), magnetic resonance imaging (MRI), nuclear imaging (PET and SPECT), and angiography. Examples of cardiac imaging include, but are not limited to, coronary angiography, computed tomography (CT) scan, electron beam computed tomography (EBCT) scan, positron emission tomography (PET) scan, single-photon emission computed tomography (SPECT) scan, cardiac magnetic resonance (CMR) imaging, myocardial perfusion imaging (MPI), multi-gated acquisition (MUGA) scan, intravascular ultrasonography (IVUS), contrast echocardiography and transthoracic doppler echocardiography. Refer for example to

[0010] . The terms "cardiac imaging" and "cardiovascular imaging" are used interchangeably in the art.

[0124] The term "chimeric antibody" refers to antibodies in which a portion of the heavy and / or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species (e.g., murine, such as mouse) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species (e.g., primate, such as human) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al. (1984) Proc. Natl Acad. Sci USA 81 :6851-6855).

[0125] The term "humanized antibody" shall be understood to refer to a chimeric molecule, generally prepared using recombinant techniques, having an epitope binding site derived from an immunoglobulin from a non-human species and the remaining immunoglobulin structure of the molecule based upon the structure and / or sequence of a human immunoglobulin. The antigen-binding site preferably comprises the complementarity determining regions (CDRs) from the non-human antibody grafted onto appropriate framework regions in the variable domains of human antibodies and the remaining regions from a human antibody. Epitope binding sites may be wild type or modified by one or more amino acid substitutions. It is known that the variable regions of both heavy and light chains contain three complementaritydetermining regions (CDRs) which vary in response to the epitopes in question and determine binding capability, flanked by four framework regions (FRs) which are relatively conserved in a given species and which putatively provide a scaffolding for the CDRs. When non-human antibodies are prepared with respect to a particular epitope, the variable regions can be "reshaped" or "humanized" by grafting CDRs derived from non-human antibody on the FRs present in the human antibody to be modified.

[0126] As used herein, the term "antigenic variant" refers to polypeptide sequences different from the specifically identified sequences, wherein one or more amino acid residues are deleted, substituted, or added. Substitutions, additions or deletions of 1, 2, 3 or 4 amino acids are specifically contemplated. Variants may be naturally-occurring allelic antigenic variants, or non-naturally occurring antigenic variants. Variants may be from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, antigenic variants of the polypeptides useful in the invention have biological activities including hormone function or antigenic-binding properties that are the same or similar to those of the parent polypeptides. The term "antigenic variant" with reference to (poly)peptides encompasses all forms of polypeptides as defined herein. The term "antigenic variant" encompasses naturally occurring, as well as recombinant and synthetic produced polypeptides.

[0127] The term "AUC" means Area Under the Curve which yields information about the strength of a correlation determined by the Receiver Operating Curve analysis. Typical ROC values where the AUC > 0.70 yields a statistically significant correlation.

[0128] The term "biological sample" as used herein includes biological fluids selected from blood including venous blood and arterial blood, plasma, serum, intertistial fluid, or any other body fluid. The term "biological sample" also includes heart tissue sample. The term "biological sample" and "body fluid sample" as used herein refers to a biological sample or a sample of bodily fluid obtained for the purpose of, for example, diagnosis, prognosis, classification or evaluation of a subject of interest, such as a patient. In certain embodiments, such a sample may be obtained for diagnosing a cardiac disorder, for performing risk stratification of a cardiac disorder, for making a prognosis of a disease course in a patient with a cardiac disorder, for identifying a patient with elevated risk of a cardiac disorder, or combinations thereof. In addition, a person skilled in the art would realise that certain body fluid samples would be more readily analysed following a fractionation or purification procedure, for example, separation of whole blood into serum or plasma components.

[0129] The term "delta IGFBP-3" or"AIGFBP-3" as used herein is intended to mean a measured difference in the concentration of IGFBP-3 between two time points in separate samples derived from the same patient. The delta (A) or difference in IGFBP-3 concentration may be a positive value or a negative value and depends on whether the concentration of IGFBP-3 increases or decreases over time. In the context of a clinical utility for the present invention, a decrease in AIGFBP-3 will help rule-out patients for further triage involving a cardiac imaging (e.g.) coronary angiography. Similarly, an increase in IGFBP-3(T-O) will also help rule- out patients who might otherwise have been referred for a cardiac imaging procedure in the absence of this biomarker interrogation.

[0130] The term "dyslipidemia" as used herein means a disorder of lipoprotein metabolism, usually manifested as an elevation of plasma cholesterol and / or triglycerides, or a low / high HDL cholesterol level that contributes to the development of atherosclerosis. A diagnosis of dyslipidemia is made by measuring plasma levels of total cholesterol, triglycerides, and individual lipoproteins [5].

[0131] The term "Dx" as used herein means diagnosis or diagnostic.

[0132] The term "ECG" as used herein means electrocardiogram. In the context of the present invention an "abnormal ECG" is intended to mean an ECG in which the P, Q, R, S and / or T peaks display an abnormal pattern.

[0133] The term "EDACS", in the context of a EDACS score, is intended to mean emergency department assessment of chest pain score, a decision aid for use in patients with chest pain or other anginal symptoms requiring evaluation for possible ACS, who may potentially be at low risk and appropriate for early discharge from an emergency department

[0011] .

[0134] The term "effective amount" as used herein refers to the amount of a therapy that is sufficient to result in the prevention of the development, recurrence, or onset of a disease or condition and one or more symptoms thereof, to enhance or improve the prophylactic effect(s) of another therapy, reduce the severity, the duration of disease, ameliorate one or more symptoms of the disease or condition, prevent the advancement of the disease or condition, cause regression of the disease or condition, and / or enhance or improve the therapeutic effect(s) of another therapy.

[0135] The term "ELISA" as used herein means enzyme-linked immunosorbent assay.

[0136] The term "epitope" includes any antigenic (e.g., a protein) determinant capable of specific binding to an antibody. Epitope determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains, and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. An epitope typically includes, for example, at least 3, 5 or 8-10 amino acids. The amino acids may be contiguous, or non-contiguous amino acids juxtaposed by tertiary folding. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.

[0137] The term "HEART", in the context of a HEART score, is a rapid risk stratification tool for patients with chest pain to help identify low risk patients. HEART assesses the clinical variables of cardiac history, electrocardiogram, age, risk factors (including diabetes, smoker, hypertension, hypercholesterolemia, obesity etc) and troponin levels

[0012] .

[0138] The term "hsTnT" as used herein means high sensitivity Troponin T, and includes high sensitivity cardiac Troponin T (i.e. hsTnT).

[0139] The term "Hx" as used herein means history, for example "Hx angina" means history of angina.

[0140] The terms "HxCAD" or "CADHx" as used herein mean a patient who had a history of cardiovascular disease.

[0141] The terms "HxHF" or "HFHx" as used herein mean a patient who has a history of heart failure.

[0142] The terms "HxMI" or "MIHx" as used herein mean a patient who has a history of myocardial infarction.

[0143] The terms "HxDyslipidemia", "DyslipidemiaHx", "HxDyslipid." and "DyslipidHx" as used herein mean a history of dyslipidemia.

[0144] The term "IGFBP-3" or "IGFBP3" as used herein means insulin-like growth factor binding protein 3. This includes, without limitation, a protein defined by SEQ ID NO: 1 (264 amino acid residues) as well as isoforms of IGFBP-3 and fragments of IGFBP-3. Insulin-like growth factor binding protein 3 is also known the art by the aliases "BP-53", "IBP3" and "IBP-3" which terms may be used interchangeably throughout this specification with IGFBP-3.

[0145] The terms "delta-IGFBP-3" or "AIGFBP-3" as used herein mean the difference in IGFBP- 3 levels measured in (i) a first patient sample taken at presentation (e.g. to a hospital emergency department or clinic) (i.e. T=0) and (ii) a second sample taken from the same patient at a later point in time which includes, by way of illustration only, 0.5h, Ih, 1.5h, 2h, 2.5h, 3h, 3.5h, 4h, 4.5h, 5h, 5.5h, 6h, 6.5h, 7h, 7.5h, 8h, 8.5h, 9h, 9.5h and lOh. For any avoidance of doubt, the terms "ABP-53", "AIBP3" and "AIBP-3" may be taken mutandis mutatis with "AIGFBP-3" based on the definitions given above. Further, the person skilled in the art would recognise that the terms "AIGFBP-3", "ABP-53", "AIBP3" and "AIBP-3" apply to the determination of a change in the IGFBP-3 levels either at presentation to (e.g.) to a hospital or clinic or at any later time point. In other words, the terms "AIGFBP-3", "ABP-53", "AIBP3" and "AIBP-3" also encompasses repeat assays performed over multiple time points.

[0146] An "increase" or "decrease" in the level of IGFBP-3 (or any other biomarker for that matter) compared with a control, or a "change" or "deviation" from a control (level) in one example is statistically significant. An increased level, decreased level, deviation from, or change from a control level or mean or historical control level can be considered to exist if the level differs from the control level by about 5% or more, by about 10% or more, by about 20% or more, or by about 50% or more compared to the control level. Statistically significant may alternatively be calculated as P<0.05. Increased levels, decreased levels, deviation, and changes can also be determined by recourse to assay reference limits or reference intervals. These can be calculated from intuitive assessment or non-parametric methods. Overall, these methods may calculate the 0.025, and 0.975 fractiles as 0.025* (n+1) and 0.975 (n+1). Such methods are well known in the art. Presence of a marker absent in a control may be seen as a higher level, deviation or change. Absence of a marker present in a control may be seen as a lower level, deviation or change.

[0147] The term "index presentation" as used herein means the point at which a patient presents to (e.g.) an emergency department, a clinic, a hospital, a surgery, a doctor's practice, a doctor or any other relevant medical forum, and information about the cardiac status of the patient is measured, including the patient's IGFBP-3 levels. For any avoidance of doubt, the term "index presentation" also includes determining the levels of IGFBP-3 in a patient or subject who has a new or recurring complaint of chest pain. In other words the term "index presentation" is also intended to mean (e.g.) the point at which a sample is taken from a patient for further interrogation / testing. For example to determine the levels of IGFBP- 3 in the sample.

[0148] The term "isolated" as applied to the polypeptide sequences disclosed herein is used to refer to sequences that are removed from their natural cellular or other naturally-occurring biological environment. An isolated molecule may be obtained by any method or combination of methods including biochemical, recombinant, and synthetic techniques. The polypeptide sequences may be prepared by at least one purification step.

[0149] The term "level" as used herein is intended to refer to the amount per weight or weight per weight of an analyte of interest, (e.g.) IGFBP-3. It is also intended to encompass "concentration" expressed as amount per volume or weight per volume. The term "circulating level" is intended to refer to the amount per weight or weight per weight or concentration of, for example, IGFBP-3 present in the circulating fluid such as plasma, serum or whole blood.

[0150] As used herein, the terms "manage", "managing", and "management" in the context of the administration of a therapy to a subject refer to the beneficial effects that a subject derives from a therapy (e.g., a prophylactic or therapeutic agent) or a combination of therapies, while not resulting in a cure of the disease or condition. In certain examples, a subject is administered one or more therapies (e.g., one or more prophylactic or therapeutic agents) to "manage" the disease or condition so as to prevent the progression or worsening of the disease or condition.

[0151] As used herein, the terms "manage", "managing", and "management" in the context of the administration of a therapy to a subject refer to the beneficial effects that a subject derives from a therapy (e.g., a prophylactic or therapeutic agent) or a combination of therapies, while not resulting in a cure of the disease or condition. In certain examples, a subject is administered one or more therapies (e.g., one or more prophylactic or therapeutic agents) to "manage" the disease or condition so as to prevent the progression or worsening of the disease or condition.

[0152] The term "MACE" as used herein means major acute cardiac event.

[0153] The terms "marker" or "biomarker" in the context of an analyte means any antigen, molecule or other chemical or biological entity that is specifically found in circulation or associated with a particular tissue (e.g. heart muscle) that it is desired to be identified in or on a particular tissue affected by a disease or disorder, for example unstable angina.

[0154] The terms "MI" and "AMI" as used herein mean (acute) myocardial infarction, a type of acute coronary syndrome.

[0155] The term "NCCP" as used herein means non-cardiac chest pain.

[0156] The term "NOT" is used in the context of the NOT rule, is intended to mean a no objective testing rule for ongoing investigation of patients who present to the emergency department (ED) with chest pain. The rule identifies patients who are at low risk of acute coronary syndrome and could be discharged without further cardiac testing

[0013] .

[0157] The term "NT-proBNP" as used herein means N-Terminal pro B-Type Natriuretic Peptide.

[0158] The term "PCT" as used herein means procalcitonin, a circulating biomarker associated with various disease states including pneumonia.

[0159] The terms "peptide" and "polypeptide" or "selectively binds" may be used interchangeably throughout this specification, and encompass amino acid chains of any length, including full length sequences in which amino acid residues are linked by covalent peptide bonds. Polypeptides useful in the present invention may be purified natural products, or may be produced partially or wholly using recombinant or synthetic techniques. The term "polypeptide" may refer to a polypeptide, an aggregate of a polypeptide such as a dimer or other multimer, a fusion polypeptide, a polypeptide fragment, a polypeptide variant, or derivative thereof. Polypeptides herein may have chain lengths of at least 40 amino acids, at least 50 amino acids, or at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, at least 170, at least

[0160] 180, at least 190, at least 200, at least 210, at least 211, at least 212, at least 213, at least

[0161] 214, at least 215, at least 216, at least 217, at least 218, at least 219, at least 220, at least

[0162] 221, at least 222, at least 223, at least 224, at least 225, at least 226, at least 227, at least

[0163] 228, at least 229, at least 230, at least 231, at least 232, at least 233, at least 234, at least

[0164] 235, at least 236, at least 237, at least 238, at least 239, at least 240, at least 241, at least

[0165] 242, at least 243, at least 244, at least 245, at least 246, at least 247, at least 248, at least

[0166] 249, at least 250, at least 251, at least 252, at least 253, at least 254, at least 255, at least

[0167] 256, at least 257, at least 258, at least 259, at least 260, at least 261, at least 262, at least

[0168] 263, at least 264 amino acids. Reference to other polypeptides of the invention or other polypeptides described herein should be similarly understood. The term "purified" as used herein does not require absolute purity. Purified refers in various embodiments, for example, to at least about 80%, 85%, 90%, 95%, 98%, or 99% homogeneity of a polypeptide, for example, in a sample. The term should be similarly understood in relation to other molecules and constructs described herein.

[0169] The term "Px" as used herein means prediction or prognostic.

[0170] The term "reference interval" or "reference standard" as used herein is intended to refer to a figure within a statistical band of a representative concentration or alternatively a figure with an upper or lower concentration. The reference interval or reference standard will typically be obtained from subjects that do not have any pre-existing conditions that could result in artificially elevating the level of circulating IGFBP-3.

[0171] The term "ROC" means Receiver Operating Curve and a ROC plot depicts the overlap between two distributions by plotting the sensitivity versus 1 -specificity for a complete range of decision thresholds.

[0172] The term "significant coronary artery occlusion" as used here is intended to mean at least a 40% occlusion, 50% occlusion, 55% occlusion, 60% occlusion, 65% occlusion, 66% occlusion, 67% occlusion, 68% occlusion, 69% occlusion, 70% occlusion, 71% occlusion, 72% occlusion, 73% occlusion, 74% occlusion, 75% occlusion, 76% occlusion, 77% occlusion, 78% occlusion, 79% occlusion, 80% occlusion, 81% occlusion, 82% occlusion, 83% occlusion, 84% occlusion, 85% occlusion, 86% occlusion, 87% occlusion, 88% occlusion, 89% occlusion, 90% occlusion, 91% occlusion, 92% occlusion, 93% occlusion, 94% occlusion, 95% occlusion, 96% occlusion, 97% occlusion, 98% occlusion, 99% occlusion or 100% occlusion, in any coronary artery.

[0173] The term "subject" or "patient" may be used interchangeably in this specification and it intended to refer to a human or non-human primate. In one example, the subject or patient is a human.

[0174] The terms "specifically binds" or "selectively binds" may be used interchangeably throughout this specification, and shall be taken to mean that the binding agent reacts or associates more frequently, more rapidly, with greater duration and / or with greater affinity to a particular substance than it does with alternative substances. For example, a binding agent that specifically binds to IGFBP-3, as well as isoforms thereof, or an epitope or immunogenic fragment thereof with greater affinity, avidity, more readily, and / or with greater duration than it binds to unrelated protein and / or epitopes or immunogenic fragments thereof. It is also understood by reading this definition that, for example, a binding agent that specifically binds to a first target (e.g. IGFBP-3) may or may not specifically bind to a second target. As such, "specific binding" does not necessarily require exclusive binding or non- detectable binding of another molecule. Generally, but not necessarily, reference to binding means specific binding. In addition to computer / database methods known in the art, polypeptide antigenic variants may be identified by physical methods known in the art, for example, by screening expression libraries using antibodies raised against polypeptides of the invention (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2ndEd. Cold Spring Harbor Press, 1987) by recombinant DNA techniques also described by Sambrook et al. or by identifying polypeptides from natural sources with the aid of such antibodies.

[0175] In addition to computer / database methods known in the art, polypeptide antigenic variants may be identified by physical methods known in the art, for example, by screening expression libraries using antibodies raised against polypeptides of the invention (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed. Cold Spring Harbor Press, 1987) by recombinant DNA techniques also described by Sambrook et al. or by identifying polypeptides from natural sources with the aid of such antibodies.

[0176] As used herein, the term "therapeutic agent" refers to any molecule, compound, and / or substance that is used for the purpose of treating and / or managing a disease or disorder, such as an occluded coronary artery. General examples of therapeutic agents include, but are not limited to, proteins, immunoglobulins (e.g., multi-specific Igs, single chain Igs, Ig fragments, polyclonal antibodies and their fragments, monoclonal antibodies and their fragments), peptides (e.g., peptide receptors, selectins), binding proteins, biologies, proliferation-based therapy agents, hormonal agents, radioimmunotherapies, targeted agents, epigenetic therapies, differentiation therapies, biological agents, and small molecule drugs. Specific example of therapeutic agents for the treatment of an occluded artery include, but are not limited to, cholesterol lowering drugs, blood thinning agents, statins, betablockers, nitrates, angiotensin-converting enzyme inhibitors, angiotensin-2 receptor blockers, calcium channel blockers, anti-angina drugs and diuretics. Refer (e.g.) to [6] which is incorporated by reference.

[0177] As used herein, the terms "therapies" and "therapy" can refer to any method(s), composition(s), and / or agent(s) that can be used in the prevention, treatment and / or management of a disease or condition or one or more symptoms thereof.

[0178] The term "TID" as used herein mean transient ischemia dilation, which may be confirmed, for example, using spectral imaging or ultrasound.

[0179] The terms "TnT" and "cTnT" means Troponin T, typically derived from a cardiac source.

[0180] As used herein, the terms "treat", "treatment" and "treating" in the context of the administration of a therapy to a subject refer to the reduction, inhibition, elimination or amelioration of the progression and / or duration of (e.g.) unstable angina, the reduction, inhibition, elimination or amelioration of the severity of (e.g.) unstable angina, and / or the amelioration of one or more symptoms thereof resulting from the administration of one or more therapies. As used in this specification, the term "fragment" or "functional derivative" in relation to a polypeptide is a subsequence of a polypeptide that may be detected using a binding agent. The term may refer to a polypeptide, an aggregate of a polypeptide such as a dimer or multimer, a fusion polypeptide, a polypeptide fragment, a polypeptide variant or derivative thereof.

[0181] The term "UA" and "UAP" as used herein means unstable angina or acute ischemia, a type of acute coronary syndrome.

[0182] The term "UDCP" as used herein means undifferentiated chest pain.

[0183] Term "variant" as used herein refers to polypeptide sequences different from the specifically identified sequences, wherein 1 to 6 or more or amino acid residues are deleted, substituted, or added. Substitutions, additions or deletions of one, two, three, four, five or six amino acids are contemplated. Variants may be naturally occurring allelic variants, or non-naturally occurring variants. Variants may be from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, variants of the polypeptides useful in the invention have biological activities including signal peptide activity or antigenic-binding properties that are the same or similar to those of the parent polypeptides. The term "variant" with reference to polypeptides encompasses all forms of polypeptides as defined herein.

[0184] Variant polypeptide sequences exhibit at least about 50%, at least about 60%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity to a sequence of the present invention. With regard to polypeptides, identity is found over a comparison window of at least 233 to 291 amino acid positions.

[0185] Polypeptide variants also encompass those which exhibit a similarity to one or more of the specifically identified sequences that is likely to preserve the functional equivalence of those sequences, including those which could not reasonably be expected to have occurred by random chance.

[0186] Polypeptide sequence identity and similarity can be determined in the following manner. The subject polypeptide sequence is compared to a candidate polypeptide sequence using BLASTP (from the BLAST suite of programs, version 2.2.18 [April 2008]]) in bl2seq, which is publicly available from NCBI (ftp: / / ftp.ncbi.nih.gov / blast / ). The default parameters of bl2seq are utilized except that filtering of low complexity regions should be turned off. The similarity of polypeptide sequences may be examined using the following UNIX command line parameters: bl2seq— i peptideseql-j peptideseq2-F F-p blastp. The parameter -F F turns off filtering of low complexity sections. The parameter -p selects the appropriate algorithm for the pair of sequences. This program finds regions of similarity between the sequences and for each such region reports an "E value" which is the expected number of times one could expect to see such a match by chance in a database of a fixed reference size containing random sequences. For small E values, much less than one, this is approximately the probability of such a random match. Variant polypeptide sequences commonly exhibit an E value of less than 1 x 10'5, less than 1 x 10'6, less than 1 x 10'9, less than 1 x 10'12, less than 1 x 10'15, less than 1 x 10'18or less than 1 x 10'21when compared with any one of the specifically identified sequences. Polypeptide sequence identity may also be calculated over the entire length of the overlap between a candidate and subject polypeptide sequences using global sequence alignment programs. EMBOSS-needle (available at http: / www. ebi.ac.uk / emboss / align / ) and GAP (Huang, X. (1994) On Global Sequence Alignment. Computer Applications in the Biosciences 10, 227-235) as discussed above are also suitable global sequence alignment programs for calculating polypeptide sequence identity. Use of BLASTP is preferred for use in the determination of polypeptide variants according to the present invention.

[0187] DETAILED DESCRIPTION

[0188] Insulin-like growth factor binding protein 3 (IGFBP-3) is a 264 amino acid proprotein that binds insulin-like growth factors 1 and 2 (IGF-I / IGF-II). IGFBP-3 is glycosylated and phosphorylated and has a final molecular weight in the range 40-43kDa [1].

[0189] The main function of IGFBP-3 appears to be in insulin growth factor (IGF) transport in the circulation as a 150kDa complex of IGFBP-3 / IGF-I or IGF-II and a third factor known as acid labile subunit (ALS). Approximately 80%+ circulating of IGF-I / IGF-II is bound to IGFBP- 3 and thus, IGFBP-3 plays a major role in IGF bioavailability.

[0190] IGFBP-3 is produced in multiple cell types including the liver, kidney, gut, uterus and placenta and the major regulators of its production are growth-hormone (GH), nutrition and age. Because of its binding to IGF and its dependence upon growth-hormone, IGFBP-3 is measured clinically as a surrogate of disorders of growth-hormone secretion or action, particularly in relation to pediatric growth.

[0191] Functionally, two unrelated IGFBP-3 receptors have been described. First, the low- density lipoprotein receptor-related protein 1 (LRP1) [1] and second, the transmembrane protein TMEM219 [2]. It has also been proposed that circulating IGFBP-3 can enter cells by both clathrin-mediated and caveolin-mediated endocytosis [3] possibly involving the transferrin receptor [4].

[0192] There is limited information about the utility of IGFBP-3 in the context of chronic or acute cardiac conditions.

[0193] Coronary artery disease is a common heart condition. The major blood vessels that supply the heart (coronary arteries) struggle to send enough blood, oxygen and nutrients to the heart muscle. Cholesterol deposits (plaques) in the heart arteries and inflammation are a typical cause of coronary artery disease.

[0194] Signs and symptoms of coronary artery disease occur when the heart doesn't get enough oxygen-rich blood. If you have coronary artery disease, reduced blood flow to the heart can cause chest pain (angina) and shortness of breath. A complete blockage of blood flow can cause heart attack / myocardial ischemia.

[0195] Coronary artery disease often develops over decades. Symptoms may go unnoticed until a significant blockage causes health problems or a heart attack occurs.

[0196] Symptoms may go unrecognized at first, or they may only occur when the heart is beating hard like during exercise. As the coronary arteries continue to narrow, less and less blood gets to the heart and symptoms can become more severe or frequent.

[0197] Coronary artery disease signs and symptoms can include (i) chest pain (angina), shortness of breath, fatigue or even heart attack. Risk factors include age, sex (male bias), familial history, smoking, high blood pressure, high cholesterol, diabetes, overweight or obesity, chronic kidney disease, insufficient exercise, heightened stress, unhealthy diet, alcohol use, and limited sleep. Risk factors often occur together and one risk factor may trigger another.

[0198] The Applicants have now unexpectedly discovered a positive correlation between the circulating levels of IGFBP-3 (i.e. as derived from a biological sample such as (e.g.) plasma or serum) and coronary artery occlusion. Accordingly, a utility for IGFBP-3 to identify patients with coronary artery disease exists. This represents a significant clinical opportunity for the reason that a biomarker-based test to identify coronary artery disease would avoid the need for complex patient triage processes involving cardiac imaging (e.g.) coronary angiography.

[0199] With reference to the data presented in Examples 2-6, when read in conjunction with Figures 1-6, the Applicants performed a series of correlation analyses using different cardiac patient cohorts.

[0200] In Example 2, using regression models and Receiver Operating Curve (ROC) analysis, the Applicants demonstrate that levels of IGFBP-3 at index presentation (also designated herein as IGFBP-3(T-O>) significantly enhanced the ROC performance of clinical variables including sex, history of coronary artery disease, abnormal cholesterol levels (i.e. relevant to a reference standard derived from a patient not having coronary artery disease and normal cholesterol levels), and elevated systolic blood pressure for predicting a coronary artery occlusion in a patient who is diagnosed as not having a myocardial infarction at the point of measurement (i.e. also referred to as index presentation), where the area under the curve improved from 0.677 ± 0.026 to 0.740 ± 0.024 (p value = 0.002). Refer also to Fig. 1. This result is considered significant since the total number of patient samples interrogated was n = 436 with n = 233 having a coronary artery occlusion as confirmed by angiography. Further, the patient samples were derived from three discrete cohorts in terms of geography and ethnicity.

[0201] Accordingly, in one aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising:

[0202] (i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient; and

[0203] (ii) comparing the concentration of IGFBP-3 in the patient sample against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the concentration of IGFBP-3 in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion.

[0204] In an example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0205] Applicants then extended their analysis to examine a potential for enhancing the specificity of the assay by interrogating the concentration of IGFBP-3 over a time dependent sampling window. This is achieved by determining the concentration of IGFBP-3 in a sample obtained from a patient at a first point in time and comparing it to the concentration of IGFBP- 3 in a sample obtained from the same patient taken at a second point in time. This measurement is referred to throughout this specification as "delta IGFBP3" or "AIGFBP-3".

[0206] With reference to Example 3 read in conjunction with Figure 2, Applicants demonstrated that AIGFBP-3(T -o-2h) significantly enhanced the ROC performance of the clinical variables including sex, history of coronary artery disease, abnormal cholesterol levels and elevated systolic blood pressure for predicting a coronary artery occlusion in a patient who is diagnosed as not having a myocardial infarction at the point of measurement (i.e. also referred to as index presentation) where the area under the curve improved from 0.683 ± 0.030 to 0.738 ± 0.027 (p value = 0.034). Refer also to Fig. 2. Again, this result is considered significant since the total number of patient samples interrogated was n = 335 with n = 184 having a coronary artery occlusion as confirmed by angiography.

[0207] Accordingly, in yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who is not having an acute myocardial infarction at index presentation, the method comprising :

[0208] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0209] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0210] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0211] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0212] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion.

[0213] In an example according to this and other aspects of the present invention, the time point between the measurements performed in step (a) and step (b) is 0.5 hours, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours or more. In a related example, the time point between the measurements performed in step (a) and step (b) is two hours.

[0214] In another example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0215] The data presented in Examples 2 and 3 were performed on a combined chest pain patient cohort in which those patients with a concurrent adjudicated diagnosis of acute myocardial infarction (i.e. at the time of measurement or index presentation) were excluded. Applicants then went on to examine the utility of AIGFBP-3(T-o-2h) to predict coronary artery occlusion in a cohort which includes those patients with a concurrent adjudicated diagnosis of an acute myocardial infarction. Unexpectedly, Applicants discovered that the performance of AIGFBP-3 to predict a coronary artery occlusion was most significant in patients where cardiac troponin T levels of <14 ng / L. These data are presented in Example 4 and Figure 3, and demonstrated clinically relevant ROC performance (i.e. AUC >0.70) when considered in conjunction with other clinical risk factors including history of coronary artery disease, abnormal cholesterol, elevated systolic blood pressure when compared to the same panel inclusive of hsTnT.

[0216] Without wishing to be bound by theory, Applicants hypothesise that the clinical significance of this observation may be explained by the cause of the acute myocardial infarction. For example, lower levels of (e.g.) hsTnT are more likely to reflect an acute myocardial infarction caused by a partial or complete coronary artery occlusion, as opposed to an acute myocardial infarction resulting from another cardiac cause.

[0217] Accordingly, in yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who has a troponin T concentration of <14 ng / L at index presentation, the method comprising :

[0218] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0219] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0220] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0221] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0222] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion.

[0223] In an example according to this and other aspects of the present invention, the time point between the measurements performed in step (a) and step (b) is 0.5 hours, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours or more. In a related example, the time point between the measurements performed in step (a) and step (b) is two hours.

[0224] In another example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0225] Further analysis of different cohorts, this time in patients who have no acute myocardial infarction and no history of coronary artery at index presentation revealed yet further utility for IGFBP-3 in predicting a significant coronary artery occlusion. Reference is made to Example 6 read in conjunction with Fig. 6 where AIGFBP-3(T-o-2h) levels significantly improved the prediction of coronary artery occlusion in patients with abnormal cholesterol levels where the AUC improved from 0.656 ± 0.045 to 0.730 ± 0.042.

[0226] Accordingly, in yet another aspect of the present invention there is provided a method for predicting a significant coronary artery occlusion in a patient who has no history of coronary artery disease and is not having an acute myocardial infarction at index presentation, the method comprising :

[0227] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0228] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0229] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0230] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0231] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, optionally measured together with abnormal cholesterol, reflects that the patient has a significant coronary artery occlusion. In an example according to this and other aspects of the present invention, the time point between the measurements performed in step (a) and step (b) is 0.5 hours, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours or more. In a related example, the time point between the measurements performed in step (a) and step (b) is two hours.

[0232] In another example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0233] In terms of clinical practice, the data presented in Examples 2-4 and 6 (accompanied by Figures 1-3 and 6) has identified a bone fide utility for IGFBP-3 to rule-out patients who might otherwise have been referred for further triage involving cardiac imaging (e.g.) coronary angiography procedure. The converse is also true (i.e.) IGFBP-3 may be used to rule-in patients for further investigation of suspected coronary artery occlusion by cardiac imaging (e.g.) coronary angiography.

[0234] As previously identified, risk stratification for coronary artery occlusion involving IGFBP- 3 biomarker interrogations has significant potential to reduce the burden placed on hospitals and clinics in performing time-consuming and expensive angiography procedures, while also enhancing patient outcomes.

[0235] Specifically, in terms of clinical decision making:

[0236] 1. increased levels of IGFBP-3(T-O> in a patient sample relative to a reference standard provides a clinician with a rule-out decision tool for further triage involving cardiac imaging (e.g.) coronary angiography;

[0237] 2. decreased levels of IGFBP-3(T-O> in a patient sample relative to a reference standard provides a clinician with a rule-in decision tool for further triage involving cardiac imaging (e.g.) coronary angiography;

[0238] 3. decreased levels of AIGFBP-3 in a patient sample relative to a reference standard provides a clinician with a rule-out decision tool for further triage involving cardiac imaging (e.g.) coronary angiography; and

[0239] 4. increased levels of AIGFBP-3 in a patient sample relative to a reference standard provides a clinician with a rule-in decision tool for further triage involving cardiac imaging (e.g.) coronary angiography.

[0240] Refer also to the flow-chart presented in Figure 4.

[0241] Interestingly, the data presented in Example 7 reveals yet a further potential for IGFBP- 3 to distinguish patients having a Type 2 myocardial infarction over Type 1 myocardial infarction. This is clinically significant because it is currently very difficult for clinicians to distinguish between these sub-types of acute myocardial infarction. The relevant data are presented in Tables 16-18, and shows that IGFBP-3 was comparatively superior to high sensitivity troponin T and another emerging diagnostic biomarker of immunoglobulin G-bound troponin I. Refer, for example, to the beta values in Tables 16-18.

[0242] Finally, the data presented in Example 5, when read in conjunction with Fig. 5, reveals yet another utility for IGFBP-3 in predicting inducible ischemia in a patient. Levels of AIGFBP- 3(T-o-2h) were interrogated in a separate patient cohort in which participants were subjected to an exercise or chemical induced stress test and the occurrence of inducible ischemia analysed. Analytes from patient samples were then measured (pre- and post-stress) to identify unique biomarker signatures. According to the data presented in Example 5, AIGFBP- 3(T-o-2h) significantly enhanced the predictive performance of heart rate and hsTnT where the AUC improved from 0.703 ± 0.047 to 0.742 ± 0.046.

[0243] Accordingly, in yet another aspect of the present invention there is provided a method for identifying a patient who is susceptible to inducible ischemia, the method comprising:

[0244] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0245] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0246] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0247] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value; and

[0248] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one or both of an abnormal peak heart rate and abnormal levels of troponin T, reflects that the patient has a >70% coronary artery occlusion.

[0249] In an example according to this and other aspects of the present invention, the time point between the measurements performed in step (a) and step (b) is 0.5 hours, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours or more. In a related example, the time point between the measurements performed in step (a) and step (b) is two hours.

[0250] In another example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0251] The present invention further contemplates methods of treatment for coronary artery disease in which patients suitable for therapy have been identified utilising IGFBP-3. Treatments for coronary artery disease include, but are not limited to, surgical and pharmaceutical approaches including but not limited to coronary angioplasty with or without insertion of a stent, coronary artery bypass graft, heart transplant, and drug-based therapies.

[0252] Examples of treatments involving one or more pharmaceutical agents (drugs) include but are not limited to: (i) common blood thinning agents including one or more of (e.g.) low- dose aspirin, clopidogrel, rivaroxaban, ticagrelor, prasugrel; (ii) statins including one or more of (e.g.) atorvastatin, simvastatin, rosuvastatin, pravastatin; (iii) beta blockers including one or more of (e.g.) atenolol, bisoprolol, metroprolol and nebivolol; (iv) nitrates including one or more of (e.g.) glyceryl trinitrate and isosorbide mononitrate; (v) angiotensin-converting enzyme inhibitors including one or more of (e.g.) ramipril and lisinopril; (vi) angiotensin-2 receptor blockers including one or more of (e.g.) azilsartan, candesartan, irbesartan, losartan, olmesartan, telmisartan and valsartan; (vii) calcium channel blockers including one or more of (e.g.) amlodipine, verapamil and diltiazem; (viii) diuretics; and (ix) anti-angina drugs including (e.g.) ranolazine.

[0253] Accordingly, in yet another aspect of the present invention there is provided a method for treating a patient with a significant coronary artery occlusion, the method comprising:

[0254] (i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:

[0255] (a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;

[0256] (b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and

[0257] (c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value

[0258] (ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population, when measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and no history of coronary artery disease, reflects that the patient has a significant coronary artery occlusion

[0259] (iii) treating the patient with any one or more of a coronary angioplasty with or without insertion of a stent, coronary artery bypass graft, heart transplant, blood thinning agents, statins, beta-blockers, nitrates, angiotensin-converting enzyme inhibitors, angiotensin-2 receptor blockers, calcium channel blockers, antiangina drugs and diuretics, thereby reducing or eliminating the coronary artery occlusion.

[0260] In an example according to this and other aspects of the present invention, the time point between the measurements performed in step (a) and step (b) is 0.5 hours, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours or more. In a related example, the time point between the measurements performed in step (a) and step (b) is two hours.

[0261] In another example according to this and other aspects of the present invention, a significant coronary occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion. In a related example, the coronary artery occlusion is a > 70% coronary artery occlusion.

[0262] Clinical Measurement of IGFBP-3

[0263] According to all methods described herein, the concentration or levels of IGFBP-3 in a sample may be measured in conjunction with at least one other risk factor and / or at least one other clinical observation to inform a further triage and / or treatment decision. The at least one other risk factor and / or clinical observation may be determined by proposed or adopted clinical pathways for patient selection. By way of example, HEART or EDACS scores [7], [8] or the No Objective Testing (NOT) score [9].

[0264] Examples of other risk factors according to the present invention include, but are not limited to, an abnormal heart rate relevant to a reference standard, a history of coronary artery disease, a history of angina, abnormal cholesterol levels, a decreased level of high- density lipoprotein relative to a reference standard, an abnormal electrocardiogram, dyslipidemia, a history of dyslipidemia, or any combination thereof.

[0265] Examples of clinical observations according to the present invention include, but are not limited to, one or more of sex, age, confirmed transient ischaemia dilation, optionally by imaging, haemoglobin concentration, blood pressure, weight, level of physical activity, family history of events including obesity, diabetes, cardiac events and / or cardiovascular disease, levels of circulating Troponin T, Troponin I, NT-proBNP, BNP, BNPsp and BNPsp fragments including BNPsp(17-26).

[0266] In a further example according to any of the methods described herein, the concentration or level of IGFBP-3 is obtained from a sample taken from a patient at index presentation. This includes, without limitation, at a time when a patient (e.g.) presents to an emergency department, a clinic, a hospital, a surgery, a doctor's practice, a doctor or any other relevant medical forum, and information about the clinical status of the patient is measured, including the patient's IGFBP-3 levels, or during a follow-up consultation posttriage.

[0267] Aspects of the present invention involve measuring the concentration of IGFBP-3 at different time points (i.e.) determining a difference in IGFBP-3 concentration as measured by taking discrete samples from the same patient where the time between sampling is (e.g.) about 30 minutes, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours or more.

[0268] By way of illustration only, a first sample is taken from a patient at index presentation and used to determine the levels of IGFBP-3 (i.e. IGFBP-3(T-O>), and a second sample is taken from the patient within about two hours of index presentation (i.e. IGFBP-3(T-2h>) and used to determine the concentration of IGFBP-3. The concentration difference in IGFBP-3 between the T=0h and T=2h time points is then calculated and represented by a value, referred to herein (e.g.) as "AIGFBP-3(T-o-2h)".

[0269] The term "within about two hours [of index presentation]" as used herein is intended to mean any point on a time continuum measured in seconds, minutes, hours up to and including about ten hours, preferably five hours, more preferably two hours within presentation by the patient to an emergency department, clinic, hospital, surgery, doctor's practice, doctor or any other relevant medical forum or within a similar time frame following a subsequent or isolated consultation based on the medical forums referred to above.

[0270] For any avoidance of doubt the term "about" as used in the context of (e.g.) "about two hours" does not mean that the time continuum is limited to two hours, and it may exceed this time limit, for example, by a minute or tens of minutes. For example, "about two hours" could mean 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129 or 130 minutes.

[0271] In an example according to various aspects of the present invention, the amount, level or concentration of IGFBP-3 is determined using an immunological assay or mass spectrometry.

[0272] In another example according to these and other aspects of the present invention, the IGFBP-3 is a peptide defined by SEQ ID NO: 1 as set forth below.

[0273] SEQ ID NO: 1

[0274] GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQP SPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKF HPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGV HIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK In a further example according to these and other aspects of the present invention described herein, the patient sample is selected from the group consisting of plasma, serum, whole blood, arterial blood, venous blood, saliva, bone marrow tissue, heart tissue, vascular tissue and interstitial fluid sample.

[0275] In a related example, the patient sample is a circulating sample selected from plasma, serum, whole blood, arterial blood and venous blood.

[0276] In another example according to this aspect of the present invention, the level or concentration of IGFBP-3 in the patient sample is at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine or at least ten times lower than the level or concentration of IGFBP-3 in the reference standard of IGFBP-3 from a control population.

[0277] In another example according to this aspect of the present invention, the level or concentration of IGFBP-3 in the patient sample is at least 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7,

[0278] 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7,

[0279] 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7,

[0280] 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7,

[0281] 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7,

[0282] 9.8, 9.9 or at least 10 times lower than the level or concentration of IGFBP-3 in the reference standard of IGFBP-3 from a control population.

[0283] In another example according to this aspect of the present invention, the level or concentration of IGFBP-3 in the patient sample is at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,

[0284] 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67,

[0285] 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91,

[0286] 92, 93, 94, 95, 96, 97, 98, 99 or at least 100 times lower than the level or concentration of

[0287] IGFBP-3 in the reference standard of IGFBP-3 from a control population.

[0288] In a further example according to this aspect of the present invention, the AIGFBP-3 value in the patient sample is at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine or at least ten times higher than the AIGFBP- 3 value in the reference standard obtained from a control population.

[0289] In a further example according to this aspect of the present invention, the AIGFBP-3 value in the patient sample is at least 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2,

[0290] 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2,

[0291] 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2,

[0292] 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2,

[0293] 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9 or at least 10 times higher than the AIGFBP-3 value in the reference standard of AIGFBP-3 from a control population.

[0294] In a further example according to this aspect of the present invention, the AIGFBP-3 value in the patient sample is at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,

[0295] 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48,

[0296] 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72,

[0297] 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96,

[0298] 97, 98, 99 or at least 100 times higher than the AIGFBP-3 value in the reference standard of AIGFBP-3 from a control population.

[0299] In another example according to this aspect of the present invention, the level of IGFBP- 3 in the patient sample is between about 0.01 and 100 ug / mL, and includes without limitation about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or about 100 ug / mL.

[0300] In yet another example according to this aspect of the present invention, the reference standard is from a control population of sex and age-matched subjects who have not been identified as having acute ischaemia or other risk factor(s), or a control population of sex and age-matched subjects who are not predisposed to developing acute ischaemia, as measured by one or more risk factors.

[0301] In a further example according to this aspect of the present invention, the reference standard is the mean IGFBP-3 level or AIGFBP-3 from a control population or the median IGFBP-3 or AIGFBP-3 level from a control population.

[0302] The following information is intended to provide information as to how the levels / concentration of IGFBP-3 may be measured, for example, in a biological sample derived from a patient or subject of interest. This includes, by way of non-limiting illustration, immunological methods for detection such as sandwich (i.e. ELISA) assays involving antibodies or aptamers, as well as mass spectrometry techniques.

[0303] Antibodies and Antigen Binding Fragments

[0304] The present invention contemplates various antibodies and antigen-binding fragments thereof which selectively bind to IGFBP-3 or antigenic variants of IGFBP-3 including IGFBP-3 isoforms.

[0305] Accordingly, in yet another aspect of the present invention there is provided an antibody or antigen-binding fragment which selectively binds to IGFBP-3.

[0306] In yet a further aspect of the present invention there is provided a monoclonal antibody, a polyclonal antibody, a chimeric antibody or a humanized antibody which selectively binds to IGFBP-3, or an antigen-binding fragment of a monoclonal, polyclonal, chimeric or humanized antibody which selectively binds to IGFBP-3. In yet another aspect of the present invention there is provided a monoclonal antibody or antigen-binding fragment thereof which selectively binds to IGFBP-3.

[0307] In yet a further aspect of the present invention there is provided an antibody or antigenbinding fragment which selectively binds to IGFBP-3, which antibody or antigen-binding fragment comprises a detectable label.

[0308] In yet another aspect of the present invention there is provided an antibody or antigenbinding fragment which selectively binds to IGFBP-3, which antibody or antigen-binding fragment is immobilized on a solid phase.

[0309] In yet a further aspect of the present invention there is provided a binding agent comprising a peptide framework comprising one or more complementarity determining regions derived from an antibody which selectively binds to IGFBP-3.

[0310] In yet a further aspect of the present invention there is provided a binding agent comprising a peptide framework comprising at least three complementarity determining regions derived from an antibody which selectively binds to IGFBP-3.

[0311] As noted above, antibody or antibodies as used herein refers to a peptide or polypeptide derived from, modelled after or substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, capable of specifically binding an antigen or epitope. As foreshadowed in the definition section of this specification, the term antibody includes antigen binding fragments such as, for example, fragments, subsequences, complementarity determining regions (CDRs) that retain capacity to bind to an antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(a")2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment, which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term "antibody."

[0312] Also included is antiserum obtained by immunizing an animal such as a mouse, rat or rabbit with an antigen, such as for example, IGFBP-3. In brief, methods of preparing polyclonal antibodies are known to a person skilled in the art. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and / or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The immunizing agent may include IGFBP-3, antigenic variants thereof or a fusion protein thereof. It may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, bovine serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Examples of adjuvants that may be employed include Freund's complete adjuvant and MPL TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation.

[0313] Monoclonal antibodies may be prepared using hybridoma methods well known in the art. The hybridoma cells may be cultured in a suitable culture medium, alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal. Preferred immortalized cell lines are murine myeloma lines, which can be obtained, for example, from the American Type Culture Collection, Virginia, USA. Immunoassays may be used to screen for immortalized cell lines that secrete the antibody of interest. Sequences of IGFBP-3 or antigenic variants thereof may be used in screening.

[0314] Well known means for establishing binding specificity of monoclonal antibodies produced by the hybridoma cells include immunoprecipitation, radiolinked immunoassay (RIA), enzyme-linked immunoabsorbent assay (ELISA) and Western blot. For example, as noted above, the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis. Samples from immunised animals may similarly be screened for the presence of polyclonal antibodies.

[0315] Monoclonal antibodies can also be obtained from recombinant host cells. DNA encoding the antibody can be obtained from a hybridoma cell line. The DNA is then placed into an expression vector, transfected into host cells (e.g., COS cells, CHO cells, E. coli cells) and the antibody produced in the host cells. The antibody may then be isolated and / or purified using standard techniques.

[0316] The monoclonal antibodies or fragments may also be produced by recombinant DNA means. DNA modifications such as substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences are also possible. The antibodies may be monovalent antibodies. Methods for preparing monovalent antibodies are well known in the art. Production of chimeric, bivalent antibodies and multivalent antibodies are also contemplated herein.

[0317] Other known art techniques for monoclonal antibody production such as from phage libraries, may also be used.

[0318] The monoclonal antibodies secreted by the cells may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, reverse phase HPLC, protein A-Sepharose, hydroxyapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.

[0319] Bispecific antibodies may also be useful. These antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. Antibodies with greater than two specificities for example trispecific antibodies are also contemplated herein.

[0320] Antibodies used in the immunoassays described herein selectively bind to IGFBP-3. The term "selectively binds" is not intended to indicate that an antibody binds exclusively to its intended target since, as noted above, an antibody binds to any polypeptide displaying the epitope(s) to which the antibody binds. Rather, an antibody "selectively binds" if its affinity for its intended target is about 5-fold greater when compared to its affinity for a non-target molecule which does not display the appropriate epitope(s). In certain examples, the affinity of the antibody will be at least about 5 fold, preferably 10 fold, more preferably 25-fold, even more preferably 50-fold, and most preferably 100-fold or more, greater for a target molecule than its affinity for a non-target molecule. In other examples, antibodies bind with affinities of at least about 10'6M, or 10'7M, or at least about 10'8M, or 10'9M, or 10'10M, or 10-11M or 10'12M.

[0321] Affinity is calculated as Kd=kOff / kOn (kOff is the dissociation rate constant, KOn is the association rate constant and Kd is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction boundl) of labelled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r / c=K(n-r): where r=moles of bound ligand / mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r / c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art.

[0322] Numerous publications discuss the use of phage display technology to produce and screen libraries of polypeptides for binding to a selected analyte. A basic concept of phage display methods is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the phage particle, which displays a polypeptide as part of a capsid enclosing the phage genome that encodes the polypeptide. The establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target binds to the target and these phage are enriched by affinity screening to the target. The identity of polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means.

[0323] The antibodies that are generated by these methods may then be selected by first screening for affinity and specificity with the purified polypeptide of interest and, if required, comparing the results to the affinity and specificity of the antibodies with polypeptides that are desired to be excluded from binding. The screening procedure can involve immobilization of the purified polypeptides in separate wells of microtiter plates. The solution containing a potential antibody or groups of antibodies is then placed into the respective microtiter wells and incubated for about 30 min to 2 h. The microtiter wells are then washed and a labelled secondary antibody (for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies) is added to the wells and incubated for about 30 min and then washed. Substrate is added to the wells and a colour reaction will appear where antibody to the immobilized polypeptide(s) is present.

[0324] The antibodies so identified may then be further analysed for affinity and specificity in the assay design selected. In the development of immunoassays for a target protein, the purified target protein acts as a standard with which to judge the sensitivity and specificity of the immunoassay using the antibodies that have been selected. Because the binding affinity of various antibodies may differ; certain antibody pairs (e.g., in sandwich assays) may interact with one another sterically, etc., assay performance of an antibody may be a more important measure than absolute affinity and specificity of an antibody.

[0325] Aptamers

[0326] The present invention also contemplates aptamers that selectively bind to IGFBP-3 or antigenic variants of IGFBP-3 including IGFBP-3 isoforms.

[0327] In yet another aspect of the present invention there is provided an aptamer or aptamer ligand binding domain which selectively binds to IGFBP-3.

[0328] Nucleic acid aptamers are nucleic acid molecules that have been engineered through repeated rounds of in vitro selection, SELEX (systematic evolution of ligands by exponential enrichment) to bind to various molecular targets such as small molecules, proteins, nucleic acids, and even cells, tissues and organisms. Aptamers offer molecular binding and recognition equivalent to antibodies. In addition to their discriminate recognition, aptamers offer advantages over antibodies as they can be engineered completely in vitro, are readily produced by chemical synthesis, possess desirable storage properties, and elicit little or no immunogenicity in therapeutic applications.

[0329] According to an example of the present invention, the aptamer is a monomer (one unit). According to another example of the invention, the aptamer is a multimeric aptamer. The multimeric aptamer may comprise a plurality of aptamer units (mers). Each of the plurality of units of the aptamer may be identical. In such a case the multimeric aptamer is a homomultimer having a single specificity but enhanced avidity (multivalent aptamer).

[0330] Alternatively, the multimeric aptamer may comprise two or more aptameric monomers, wherein at least two mers of the multimeric aptamer are non-identical in structure, nucleic acid sequence or both. Such a multimeric aptamer is referred to herein as a heteromultimer. The heteromultimer may be directed to a single binding site i.e., monospecific (such as to avoid steric hindrance). The heteromultimer may be directed to a plurality of binding sites i.e., multispecific. The heteromultimer may be directed to a plurality of binding sites on different analytes. Further description of a multimeric aptamer is provided below.

[0331] A plurality of multimeric aptamers may be conjugated to form a conjugate of multimeric aptamers. The multimeric aptamer may comprise, two (dimer), three (trimer), four (tetramer), five (pentamer), six (hexamer), and even more units.

[0332] Aptamers of the invention can be synthesized and screened by any suitable methods in the art.

[0333] For example, aptamers can be screened and identified from a random aptamer library by SELEX (systematic evolution of ligands by exponential enrichment). Aptamers that bind to an antigen of interest can be suitably screened and selected by a modified selection method herein referred to as cell-SELEX or cellular-SELEX.

[0334] A random aptamer library can be created that contains monomeric, dimeric, trimeric, tetrameric or other higher multimeric aptamers. A random aptamer library (either ssDNA or RNA) can be modified by including oligonucleotide linkers to link individual aptamer monomers to form multimeric aptamer fusion molecules. In other examples, a random oligonucleotide library is synthesized with randomized 45 nt sequences flanked by defined 20 nt sequences both upstream and downstream of the random sequence, i.e., known as 5'-arm and 3'-arm, which are used for the amplification of selected aptamers. A linking oligonucleotide (i.e., linker) is designed to contain sequences complementary to both 5'-arm and 3'-arm regions of random aptamers to form dimeric aptamers. For trimeric or tetrameric aptamers, a small trimeric or tetrameric (i.e., a Holiday junction-like) DNA nanostructure is engineered to include sequences complementary to the 3'-arm region of the random aptamers, therefore creating multimeric aptamer fusion through hybridization. In addition, 3-5 or 5-10 dT rich nucleotides can be engineered into the linker polynucleotides as a single stranded region between the aptamer-binding motifs, which offers flexibility and freedom of multiple aptamers to coordinate and synergize multivalent interactions with cellular ligands or receptors. Alternatively, multimeric aptamers can also be formed by mixing biotinylated aptamers with streptavidin.

[0335] A modified cellular SELEX procedure can be employed to select target-binding aptamers. Multimeric aptamers may be multivalent but be of single binding specificity (i.e., homomultimeric aptamers). Alternatively, the multimeric aptamer may be multivalent and multi- specific (i.e., heteromultimeric aptamers).

[0336] Thus, each monomer of the homomultimeric aptamer binds the target protein (e.g., IGFBP-3 as well as antigenic variants thereof) in an identical manner. Thus according to an example of the invention, all monomeric components of the homomultimeric aptamer are identical.

[0337] Conversely, a heteromultimeric aptamer comprises a plurality of monomeric aptamers at least two of which bind different sites on a single target protein or bind at least two different target proteins.

[0338] Selection of RNA-aptamers is well-established using protocols described in the scientific literature.

[0339] In certain examples, a suitable nucleotide length for an aptamer ranges from about 15 to about 100 nucleotide (nt), and in various other examples, 12-30, 14-30, 15-30 nt, 30-100 nt, 30-60 nt, 25-70 nt, 25-60 nt, 40-60 nt, or 40-70 nt in length.

[0340] Multimerization can be done at the library level as follows.

[0341] In certain examples, a linker polynucleotide has a length between about 5 nucleotides (nt) and about 100 nt; in various examples, 10-30 nt, 20-30 nt, 25-35 nt, 30-50 nt, 40-50 nt, 50-60 nt, 55-65 nt, 50-80 nt, or 80-100 nt. It is within the ability of one of skill in the art to adjust the length of the linker polynucleotide to accommodate each monomeric aptamer in the multimeric structure.

[0342] In certain examples, the multimeric aptamers can be identified and screened from a random multimeric aptamer library as described herein. In other examples, the monomeric aptamers are linked to each other by one or a plurality of linker polynucleotides to form multimeric aptamers. Monomeric aptamers can be linked to form multimeric aptamers by any suitable means and in any configurations.

[0343] It will be appreciated that the monomeric structures of the invention can be further multimerized by post SELEX procedures.

[0344] Multimers can be linearly linked by continuous linear synthesis of DNA without spacers or with nucleic acid spacers. Aptamer synthesis usually relies on standard solid phase phosphoramitide chemistry.

[0345] Thus, dimers, trimers and tetramers or higher oligomeric structures (e.g., pentamers, hexamers, heptamers, octamers etc.) can be linked by a polymeric spacer.

[0346] In certain examples, the aptamers are further modified to protect the aptamers from nuclease and other enzymatic activities. The aptamer sequence can be modified by any suitable methods known in the art. For example, phosphorothioate can be incorporated into the backbone, and 5'-modified pyrimidine can be included in 5' end of ssDNA for DNA aptamer. For RNA aptamers, modified nucleotides such as substitutions of the 2'-OH groups of the ribose backbone, e.g., with 2'-deoxy-NTP or - fluoro-NTP, can be incorporated into the RNA molecule using T7 RNA polymerase mutants. The resistance of these modified aptamers to nuclease can be tested by incubating them with either purified nucleases or nuclease from mouse serum, and the integrity of aptamers can be analyzed by gel electrophoresis. The monomeric or multimeric aptamer of the invention can be further attached or conjugated to a detectable or therapeutic moiety (i.e., a pharmaceutical moiety).

[0347] Thus, as noted above, a diagnostic or therapeutic moiety can be attached to an aptamer embodied herein to provide additional biological activity, such as for diagnosing, preventing, or treating a condition or disease. In one example a diagnostic moiety such as a detectable moiety e.g., label (e.g., His tag, flag tag), fluorescent, radioactive, biotin / avidin etc., can be bound to the aptamer, and imaging, immunohistochemistry, or other invasive or non-invasive methods used to identify the location(s) and extend of binding of the conjugate to locations within the body. For therapeutic uses, a cytotoxic agent such as a chemotherapeutic agent, radioactive moiety, toxin, antibody, nucleic acid silencing agents e.g., small interferring RNA (siRNA) or other molecule with therapeutic activity when delivered to cells expressing a molecule to which the aptamer is targeted, may be used to enhance the therapeutic activity of the aptamer or provide a biological activity where the aptamer is providing the targeting activity. Moreover, other conjugates to the aptamers described herein are contemplated, such as but not limited to scaffolds, sugars, proteins, antibodies, polymers, and nanoparticles, each of which have art- recognized therapeutic or diagnostic utilities and can be targeted to particular sites in vivo using an aptamer embodied herein.

[0348] Detection of Binding Agents Including Peptide Binding Assays

[0349] The present invention includes use of a detection system involving the binding of IGFBP- 3 to a binding agent and then detecting the amount of bound peptide. A similar solution is to detect the amount of unbound binding agent in a sample to get an indication of unbound or bound IGFBP-3. It is intended that such alternative methods fall within the scope of the present invention as functional alternatives to directly detecting the amount of bound binding agent. Persons skilled in the art will appreciate that the concentration of IGFBP-3 in a sample can be readily calculated from the amount of IGFBP-3 in a sample when the sample volume is known.

[0350] In the assays, methods and kits according to the present invention, the measuring steps comprise detecting binding between IGFBP-3 and a binding agent that binds, selectively or specifically, to IGFBP-3, and has low cross-reactivity with other markers of biological events.

[0351] Accordingly, in another aspect of the present invention there is provided an assay method for measuring the level of IGFBP-3 in a sample, the method comprising:

[0352] (i) contacting a sample with a binding agent which selectively binds to IGFBP-3; and

[0353] (ii) determining the amount of binding agent bound to IGFBP-3 so as to establish the level of IGFBP-3 in the sample.

[0354] In certain examples, the binding agent is an antibody or an antigen-binding fragment thereof. The antibody may be a monoclonal, polyclonal, chimeric or humanized antibody or antigen-binding fragment thereof. As such, in one example the assay, as well as methods involving assays, of the present invention is an immunoassay.

[0355] As such, in a further aspect of the present invention there is provided an assay method for measuring the level of IGFBP-3 in a sample, the method comprising:

[0356] (i) contacting a sample with an antibody or aptamer which selectively binds to IGFBP-3; and

[0357] (ii) determining the amount of antibody or aptamer bound to IGFBP-3 so as to establish the level of IGFBP-3 in the sample.

[0358] The antibodies of the present invention are particularly useful in immunoassays for determining the presence and / or amount of IGFBP-3 in a sample. Due to variable binding affinities of different antibodies, the person skilled in the art will appreciate that a standard binding curve of measured values versus amount of IGFBP-3 in a sample should be established for a particular antibody to enable the amount of IGFBP-3 in a sample to be determined. Such a curve is used to determine the true amount of IGFBP-3 in a sample.

[0359] Sample materials include biological fluids but are not limited thereto. In terms of the present invention, usually biological fluids are selected from whole blood, plasma or serum.

[0360] Immunoassays specific for IGFBP-3 usually will require the production of antibodies that specifically bind to IGFBP-3. The antibodies can be used to construct immunoassays with broad specificity, as in competitive binding assays below, or used in conjunction with other antibodies described below in sandwich type assays to produce assays specific to IGFBP-3. The person skilled in the art will appreciate that non-competitive assays are also possible. The latter antibodies for sandwich immunoassays include those specific for amino acid sequences including SEQ ID NO: 1.

[0361] In another example, indicators may also be used. Indicators may be employed in ELISA and RIA assay formats.

[0362] Polyclonal and monoclonal antibodies can be used in competitive binding or sandwich type assays. In one example of this method a liquid sample is contacted with the antibody and simultaneously or sequentially contacted with a labelled IGFBP-3 or modified peptide containing the epitope recognised by the antibody.

[0363] The label can be a radioactive component such as125I,131I,3H,14C or a non-radioactive component that can be measured by time resolved fluorescence, fluorescence, fluorescence polarisation, luminescence, chemiluminescence or colorimetric methods. These compounds include europium or other actinide elements, acrinidium esters, fluorescein, or radioactive material such as those above, that can be directly measured by radioactive counting, measuring luminescent or fluorescent light output, light absorbance etc. The label can also be any component that can be indirectly measured such as biotin, digoxin, or enzymes such as horseradish peroxidase, alkaline phosphatase. These labels can be indirectly measured in a multitude of ways. Horseradish peroxidase for example can be incubated with substrates such as o-Phenylenediamine Dihyhdrochloride (OPD) and peroxide to generate a coloured product whose absorbance can be measured, or with luminol and peroxide to give chemiluminescent light which can be measured in a luminometer. Biotin or digoxin can be reacted with binding agents that bind strongly to them; e.g. avidin will bind strongly to biotin. These binding agents can in turn be covalently bound or linked to measurable labels such as horseradish peroxidase or other directly or indirectly measured labels as above. These labels and those above may be attached to the peptide or protein: during synthesis, by direct reaction with the label, or through the use of commonly available crosslinking agents such as MCS and carbodiimide, or by addition of chelating agents.

[0364] Following contact with the antibody, usually for 18 to 25 hours at 4° C, or 1 to 240 minutes at 30° C to 40° C, the labelled peptide bound to the binding agent (antibody) is separated from the unbound labelled peptide. In solution phase assays, the separation may be accomplished by addition of an anti-gamma globulin antibody (second-antibody) coupled to solid phase particles such as cellulose, or magnetic material. The second-antibody is raised in a different species to that used for the primary antibody and binds the primary antibody. All primary antibodies are therefore bound to the solid phase via the second antibody. This complex is removed from solution by centrifugation or magnetic attraction and the bound labelled peptide measured using the label bound to it. Other options for separating bound from free label include formation of immune complexes, which precipitate from solution, precipitation of the antibodies by polyethyleneglycol or binding free labelled peptide to charcoal and removal from solution by centrifugation of filtration. The label in the separated bound or free phase is measured by an appropriate method such as those presented above.

[0365] Competitive binding assays can also be configured as solid phase assays that are easier to perform and are therefore preferable to those above. This type of assay use a solid support including plates with wells (commonly known as ELISA or immunoassay plates), solid beads or the surfaces of tubes. The primary antibody is either adsorbed or covalently bound to the surface of the plate, bead or tube, or is bound indirectly through a second anti gamma globulin or anti Fc region antibody adsorbed or covalently bound to the plate. Sample and labelled peptide (as above) are added to the plate either together or sequentially and incubated under conditions allowing competition for antibody binding between IGFBP-3 in the sample and the labelled peptide. Unbound labelled peptide can subsequently be aspirated off and the plate rinsed leaving the antibody bound labelled peptide attached to the plate. The labelled peptide can then be measured using techniques described above.

[0366] Sandwich type assays are more preferred for reasons of specificity, speed and greater measuring range. In this type of assay an excess of the primary antibody to IGFBP-3 is attached to the well of an ELISA plate, bead or tube via adsorption, covalent coupling, or an anti Fc or gamma globulin antibody, as described above for solid phase competition binding assays. Sample fluid or extract is contacted with the antibody attached to the solid phase. Because the antibody is in excess this binding reaction is usually rapid. A second antibody to a IGFBP-3 peptide is also incubated with the sample either simultaneously or sequentially with the primary antibody. This second antibody is chosen to bind to a site on IGFBP-3 that is different from the binding site of the primary antibody. These two antibody reactions result in a sandwich with the IGFBP-3 from the sample sandwiched between the two antibodies. The second antibody is usually labelled with a readily measurable compound as detailed above for competitive binding assays. Alternatively, a labelled third antibody which binds specifically to the second antibody may be contacted with the sample. After washing the unbound material the bound labelled antibody can be measured by methods outlined for competitive binding assays. After washing away the unbound labelled antibody, the bound label can be quantified as outlined for competitive binding assays.

[0367] A dipstick type assay may also be used. These assays are well known in the art. They may for example, employ small particles such as gold or coloured latex particles with specific antibodies attached. The liquid sample to be measured may be added to one end of a membrane or paper strip preloaded with the particles and allowed to migrate along the strip. Binding of the antigen in the sample to the particles modifies the ability of the particles to bind to trapping sites, which contain binding agents for the particles such as antigens or antibodies, further along the strip. Accumulation of the coloured particles at these sites results in colour development are dependent on the concentration of competing antigen in the sample. Other dipstick methods may employ antibodies covalently bound to paper or membrane strips to trap antigen in the sample. Subsequent reactions employing second antibodies coupled to enzymes such as horse radish peroxidase and incubation with substrates to produce colour, fluorescent or chemiluminescent light output will enable quantitation of antigen in the sample.

[0368] The present invention further contemplates a peptide complex comprising IGFBP-3 bound to a binding agent which selectively binds to IGFBP-3.

[0369] Accordingly, in a further aspect of the present invention there is provided a peptide complex comprising IGFBP-3 bound to a binding agent which selectively binds to IGFBP-3.

[0370] In yet a further aspect of the present invention there is provided a peptide complex comprising IGFBP-3 bound to an antibody or antigen binding fragment thereof which selectively binds to IGFBP-3.

[0371] In another further aspect of the present invention there is provided a peptide complex comprising IGFBP-3 bound to a polyclonal antibody or antigen-binding fragment thereof which selectively binds to IGFBP-3. In another further aspect of the present invention there is provided a peptide complex comprising IGFBP-3 bound to a monoclonal antibody or antigen-binding fragment thereof which selectively binds to IGFBP-3.

[0372] In yet another aspect of the present invention there is provided a peptide complex comprising IGFBP-3 bound to an aptamer which selectively binds to IGFBP-3.

[0373] Further contemplated by the present invention is methods for detection of a peptide complex comprising IGFBP-3 bound to a binding agent which selectively binds to IGFBP-3.

[0374] Accordingly, in a further aspect of the present invention there is provided a method for detecting a peptide complex from a biological sample, wherein the peptide complex comprises IGFBP-3 bound to a binding agent which selectively binds to IGFBP-3.

[0375] In yet a further aspect of the present invention there is provided a method for detecting a peptide complex from a biological sample, wherein the peptide complex comprises IGFBP- 3 bound to an antibody or antigen-binding fragment thereof which selectively binds to IGFBP- 3.

[0376] In yet a further aspect of the present invention there is provided a method for detecting a peptide complex from a biological sample, wherein the peptide complex comprises IGFBP- 3 bound to a monoclonal antibody or antigen-binding fragment thereof which selectively binds to IGFBP-3.

[0377] In yet a further aspect of the present invention there is provided a method for detecting a peptide complex from a biological sample, wherein the peptide complex comprises IGFBP- 3 bound to a polyclonal antibody or antigen-binding fragment thereof which selectively binds to IGFBP-3.

[0378] In yet a further aspect of the present invention there is provided a method for detecting a peptide complex from a biological sample, wherein the peptide complex comprises IGFBP- 3 bound to an aptamer which selectively binds to IGFBP-3.

[0379] According to these and other aspects, the present invention further contemplates the methods described herein in which one or more risk factors are also interrogated. This includes, without limitation, one or more clinical risk factors selected from a history of angina, a decreased heart rate relative to a reference standard, a decreased level of high-density lipoprotein relative to a reference standard, an abnormal electrocardiogram, a diagnosis of ischaemia, optionally by imaging, and a history of dyslipidemia

[0380] Detection of IGFBP-3 by Mass Spectrometry

[0381] Given the relative abundance of IGFBP-3 in circulation (i.e. 1-1000 uM range), and in particular the amount / concentration of this peptide fragment detected in plasma levels, measurement of IGFBP-3 in a patient sample is particularly suited to detection using non binding-agent assays including, without limitation, mass spectrometry, x-ray diffraction nuclear magnetic resonance and high performance liquid chromatography.

[0382] The precise molecular mass of IGFBP-3 has been determined as ~40-43kDa, and accordingly it is possible to detect the presence of this fragment in a biological sample of interest using mass spectrometry including tandem mass spectrometry or "MS / MS". MS / MS is a technique in instrumental analysis where two or more mass analyzers are coupled together using an additional reaction step to increase their abilities to analyse chemical samples. The molecules of a given sample are ionized and the first spectrometer (designated MSI) separates these ions by their mass-to-charge ratio (often given as m / z or m / Q). Ions of a particular m / z-ratio coming from MSI are selected and then made to split into smaller fragment ions, e.g. by collision-induced dissociation, ion-molecule reaction, or photodissociation. These fragments are then introduced into the second mass spectrometer (MS2), which in turn separates the fragments by their m / z-ratio and detects them. The fragmentation step makes it possible to identify and separate ions that have very similar m / z- ratios in regular mass spectrometers.

[0383] In reading this specification in its entirety, it would be appreciated by the skilled person that any method or assay described and claimed herein may be modified to include the step of measuring the level of IGFBP-3 in a patient sample using mass spectrometry, and in particular tandem mass spectrometry or MS / MS.

[0384] Receiver Operating Characteristic (ROC) Analysis

[0385] The clinical performance of a laboratory test depends on its diagnostic / prognostic accuracy, or the ability to correctly classify subjects into clinically relevant subgroups. Prognostic accuracy measures the test's ability to correctly distinguish two different conditions of the subjects investigated. Such conditions are for example health and disease or benign versus malignant disease.

[0386] In each case, a receiver operating characteristic (ROC) plot depicts the overlap between the two distributions by plotting the sensitivity versus 1 -specificity for the complete range of decision thresholds. On the y-axis is sensitivity, or the true-positive fraction [defined as (number of true-positive test results) / (number of true-positive + number of false-negative test results)]. This has also been referred to as positivity in the presence of a disease or condition. It is calculated solely from the affected subgroup. On the x-axis is the falsepositive fraction, or 1-specificity [defined as (number of false-positive results) / (number of true-negative + number of false-positive results)]. It is an index of specificity and is calculated entirely from the unaffected subgroup. Because the true- and false-positive fractions are calculated entirely separately, by using the test results from two different subgroups, the ROC plot is independent of the prevalence of disease in the sample. Each point on the ROC plot represents a sensitivity / -specificity pair corresponding to a particular decision threshold. A test with perfect discrimination (no overlap in the two distributions of results) has an ROC plot that passes through the upper left corner, where the true-positive fraction is 1.0, or 100% (perfect sensitivity), and the false-positive fraction is 0 (perfect specificity). The theoretical plot for a test with no discrimination (identical distributions of results for the two groups) is a 45° diagonal line from the lower left corner to the upper right corner. Most plots fall in between these two extremes. If the ROC plot falls completely below the 45° diagonal, this is easily remedied by reversing the criterion for "positivity" from "greater than" to "less than" or vice versa. Qualitatively, the closer the plot is to the upper left corner, the higher the overall accuracy of the test.

[0387] One convenient objective to quantify the diagnostic accuracy of a laboratory test is to express its performance by a single number. The most common global measure is the area under the ROC plot. By convention, this area is always ^ 0.5 (if it is not, one can reverse the decision rule to make it so). Values range between 1.0 (perfect separation of the test values of the two groups) and 0.5 (no apparent distributional difference between the two groups of test values). The area does not depend only on a particular portion of the plot such as the point closest to the diagonal or the sensitivity at 90% specificity, but on the entire plot. This is a quantitative, descriptive expression of how close the ROC plot is to the perfect one (area = 1.0).

[0388] Test Kits & Articles of Manufacture

[0389] The test kits or articles of manufacture may be comprised of one or more containers and may also include collection equipment, for example, bottles, bags (such as intravenous fluids bags), vials, syringes, and test tubes. At least one container will be included and will hold a product which is effective for use in the assays and methods described herein. The product is typically a peptide binding agent, particularly an antibody or antigen-binding fragment of the invention, or a composition comprising any of these. In one example, an instruction or label on or associated with the container indicates that the composition is used for predicting, diagnosing, or monitoring a cardiac disease in the subject. Other components may include needles, diluents and buffers.

[0390] The test kits or articles of manufacture may also include detection or measurement means involving one or more additional markers or risk factors for a cardiac disease of interest (e.g.) including heart rate, haemoglobin concentration, blood pressure, age, sex, weight, level of physical activity, family history of events including obesity, diabetes and cardiac events, and levels of circulating Troponin T, Troponin I, NT-proBNP, BNP, BNPsp and BNPsp fragments including BNPsp(17-26). Again, this may include binding agent(s), aptamer(s), antibody(s) and antigen-binding fragment(s) thereof which selectively bind to other biomarker(s) of interest.

[0391] Also included in the kits or articles of manufacture may be a device for sample analysis comprising a disposable testing cartridge with appropriate components (markers, antibodies and reagents) to carry out sample testing. The device will conveniently include a testing zone and test result window. Immunochromatographic cartridges are examples of such devices. See for example US 6,399,398; US 6,235,241 and US 5,504,013.

[0392] Alternatively, the device may be an electronic device which allows input, storage and evaluation of levels of the measured marker against control levels and other marker levels. US 2006 / 0234315 provides examples of such devices. Also useful in the invention are Ciphergen's Protein Chip® which can be used to process SELDI results using Ciphergen's Protein Chip® software package.

[0393] The invention is further described with reference to the following examples. It will be appreciated that the invention as claimed is not intended to be limited in any way by these examples.

[0394] EXAMPLES

[0395] EXAMPLE 1

[0396] MEASUREMENT OF IGFBP-3

[0397] Levels of IGFBP-3 were measured using RnD Systems Quantikine ELISA (Catalogue # DGB300).

[0398] LoD 0.5 ng / mL, ED50 25 ng / mL, 6 uL sample requirement diluted lOOx for assay. 4hr turnaround, working range 0.8-50 ng / mL. No effect of EDTA, LithHep or serum collection. No cross reactivities with other related proteins, lipids, IgG / M, bilirubin, albumin or drugs such as clopidogrel, aspirin, beta-blockers, ACE inhibitors.

[0399] Repeatability (Intra-Assav CV) Intermediate precision (Inter-Assav CV)

[0400] Sample 1 2 3 1 2 3 n 20 20 20 40 40 40

[0401] Mean 4.13 12.7 31.1 4.06 11.8 28.5

[0402] Std Dev 0.2 0.64 0.71 0.22 0.76 2.27

[0403] CV% 4.8 5 2.3 5.4 6.4 8

[0404] EXAMPLE 2

[0405] IGFBP-3 PREDICTS CORONARY ARTERY OCCLUSION [MI EXCLUDED]

[0406] IGFBP-3(T-O) was interrogated in samples obtained from a chest pain cohort comprising SPACE (Christchurch, NZ), APACE (BASEL, CH) and FAST-TRAC (Multi-Centre, USA). Those patients with an adjudicated diagnosis of an acute myocardial infarction were removed. This combined patient cohort comprised n= 436 matched patient samples which included n = 233 patients with >70% coronary artery occlusion as confirmed by angiography. The results of regression and ROC analyses are presented in Tables 1-5 below, when read in conjunction with the ROC curve presented in Figure 1.

[0407] Table 1: Univariable regression analysis for IGFBP-3(T=O)

[0408] Table 2: Multivariable regression analysis for IGFBP-3(T=O) which is superior to hsTnT(T=o)

[0409] Table 3: Multivariable regression analysis for IGFBP-3(T=O) with age removed

[0410] Table 4: Final multivariable regression analysis model for IGFBP-3(T=O)

[0411] Note: HxCAD = history of coronary artery disease; AChol = abnormal cholesterol; SBP = (elevated) systolic blood pressure Table 5: ROC curve analysis for IGFBP-3(T=O) with other clinical variables in the model

[0412] The ROC data presented in Table 5 and Fig. 1 show that IGFBP-3(T-O) significantly enhanced the predictive performance of [sex + history of coronary artery disease + abnormal cholesterol + elevated systolic blood pressure] in identifying non-myocardial infarction patients who had a >70% coronary artery occlusion where the area under the curve increased from AUC = 0.677 ± 0.026 to AUC = 0.740 ± 0.024. This represents a minimum increase observing that the control experiment (i.e. variables absent IGFBP-3(T-O>) also included age. Furthermore, the ROC measurement of [sex + history of coronary artery disease + abnormal cholesterol + elevated systolic blood pressure + IGFBP-3(T-O>] with an AUC = 0.740 ± 0.024 was statistically significant with a p value of 0.002.

[0413] EXAMPLE 3

[0414] AIGFBP-3 PREDICTS CORONARY ARTERY OCCLUSION [MI EXCLUDED]

[0415] IGFBP-3(T-O) and AIGFBP-3(T-o-2h) was interrogated in samples obtained from a chest pain cohort comprising SPACE (Christchurch, NZ), APACE (BASEL, CH) and FAST-TRAC (MultiCentre, USA). Those patients with an adjudicated diagnosis of an acute myocardial infarction were removed. This combined patient cohort comprised n= 335 matched patient samples which included n = 184 patients with >70% coronary artery occlusion as confirmed by angiography. The results of regression and ROC analyses are presented in Tables 6-8 below, when read in conjunction with the ROC curve presented in Figure 2.

[0416] Table 6: Univariable regression analysis for IGFBP-3(T=O) and AIGFBP-3(T=O-2H) Table 7: Final multivariable regression analysis model for AIGFBP-3(T=o-2h)

[0417] Table 8: ROC curve analysis for AIGFBP-3(T=o-2h) with other clinical variables in the model

[0418] The ROC data presented in Table 8 and Fig. 2 show that AIGFBP-3(T-o-2h) significantly enhanced the predictive performance of [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol] in identifying non-myocardial infarction patients who had a >70% coronary artery occlusion where the area under the curve increased from AUC = 0.683 ± 0.030 to AUC = 0.738 ± 0.027. Again, this represents a minimum increase observing that the control experiment (i.e. variables absent AIGFBP-3(T-o-2h)) also included age. Furthermore, the ROC measurement of [sex + history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + AIGFBP-3(T-o-2h)] with an AUC = 0.738 ± 0.027 was statistically significant with a p value of 0.034.

[0419] EXAMPLE 4

[0420] AIGFBP-3 PREDICTS CORONARY ARTERY OCCLUSION [MI INCLUDED]

[0421] IGFBP-3(T-O) and AIGFBP-3(T-o-2h) was interrogated in samples obtained from a chest pain cohort comprising SPACE (Christchurch, NZ), APACE (BASEL, CH) and FAST-TRAC (MultiCentre, USA). Unlike the data presented in Examples 1 and 2, this time patients with an adjudicated diagnosis of an acute myocardial infarction were retained. Further, only those patients who had hsTnT(-r-o) levels of < 14 ng / L (i.e. as measured at index presentation) were included in the model / analysis. This reflects the uncertainty around the presence of occlusion in patients presenting with troponin values below myocardial infarction guideline cut-offs. For the measurement of IGFBP-3(T-O) the combined patient cohort comprised n= 318 matched patient samples which included n = 173 patients with >70% coronary artery occlusion as confirmed by angiography. For the measurement of AIGFBP-3(T-o-2h) the combined patient cohort comprised n= 245 matched patient samples which included n = 131 patients with >70% coronary artery occlusion as confirmed by angiography. The results of regression and ROC analyses are presented in Tables 9-11 below, when read in conjunction with the ROC curve presented in Figure 3.

[0422] Table 9: Multivariable regression analysis model for IGFBP-3(T=O); hsTnT <14 ng / L

[0423] Table 10: Multivariable regression analysis model for AIGFBP-3(T=o-2h); hsTnT < 14 ng / L

[0424] Table 11: ROC curve analysis for AIGFBP-3(T=o-2h) with other clinical variables in the model The ROC data presented in Table 11 and Fig. 3 show that AIGFBP-3(T-o-2h) significantly enhanced the predictive performance of [history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + hsTnT(T-o)@<i4 ng / L] in identifying patients who had a >70% coronary artery occlusion where the area under the curve increased from AUC = 0.703 ± 0.033 to AUC = 0.741 ± 0.032. Furthermore, the ROC measurement of [history of coronary artery disease + elevated systolic blood pressure + abnormal cholesterol + hsTnT(T-o)@<i4ng / L] with an AUC = 0.741 ± 0.032 was statistically significant with a p value of 0.044.

[0425] EXAMPLE 5

[0426] AIGFBP-3 PREDICTS INDUCIBLE ISCHEMIA [NON-MI & NON-HxCAD]

[0427] AIGFBP-3(T-o-2h) was interrogated in samples obtained from a positive stress test patient cohort (BASEL VIII; BASEL, CH). Those patients with an adjudicated diagnosis of an acute myocardial infarction and / or a history of coronary artery disease were removed. This patient cohort comprised n= 163 matched patient samples which included n = 44 patients with >70% coronary artery occlusion as confirmed by angiography. The results of regression and ROC analyses are presented in Tables 12-13 below, when read in conjunction with the ROC curve presented in Figure 5.

[0428] Table 12: Multivariable regression analysis model for AIGFBP-3(T=o-2h)

[0429] Table 13: ROC curve analysis for AIGFBP-3(T=o-2h) with other clinical variables in the model The ROC data presented in Table 13 and Fig. 5 show that AIGFBP-3(T-o-2h) significantly enhanced the predictive performance of [peak heart rate + elevated hsTnT(-r-o)] in identifying patients who had a positive result from an exercise or chemical induced stress test where the area under the curve increased from AUC = 0.703 ± 0.047 to AUC = 0.742 ± 0.047.

[0430] EXAMPLE 6

[0431] AIGFBP-3 PREDICTS CORONARY ARTERY OCCLUSION [NON-MI & NON-HxCAD]

[0432] AIGFBP-3(T-o-2h) was interrogated in samples obtained from an acute chest pain patient cohort (SPACE, APACE and FAST-TRAC). Those patients with an adjudicated diagnosis of an acute myocardial infarction and / or a history of coronary artery disease were removed. This patient cohort comprised n= 154 matched patient samples which included n = 63 patients with >70% coronary artery occlusion as confirmed by angiography. The results of regression and ROC analyses are presented in Tables 14-15 below, when read in conjunction with the ROC curve presented in Figure 6.

[0433] Table 14: Multivariable regression analysis model for AIGFBP-3(T=o-2h)

[0434] Table 15: ROC curve analysis for AIGFBP-3(T=o-2h) with other clinical variables in the model

[0435] The ROC data presented in Table 15 and Fig. 6 show that AIGFBP-3(T-o-2h) significantly enhanced the predictive performance of abnormal cholesterol levels in identifying patients who had a >70% coronary artery occlusion where the area under the curve increased from AUC = 0.656 ± 0.038 to AUC = 0.730 ± 0.043. EXAMPLE 7

[0436] IGFBP-3 IS A COMPARATIVELY SUPERIOR BIOMARKER TO PREDICT CORONARY ARTERY OCCLUSION IN TYPE 2 MYOCARDIAL INFARCTION PATIENTS

[0437] The Applicants also interrogated the comparative performance of IGFBP-3(T-O) against hsTnT(-r-o) and bTnl-IgG(-r-o) to predict >70% coronary artery occlusion in patients who had an adjudicated diagnosis of Type 2 myocardial infarction (T2MI).

[0438] According to the regression analysis presented in Tables 16-18 below, the performance of IGFBP-3(T-O) to predict >70% coronary artery occlusion was superior to that of hsTnT(-r-o) and bTnl-IgG(-r-o).

[0439] This result is clinically significant because clinical adjudication of T2MI is difficult. Accordingly, using a correlation analysis the utility of IGFBP-3 may be used to help identify those patients with T2MI. The identification of reduced concentration of IGFBP-3(T-O) relative to a reference standard could be used to predict the presence of a coronary artery occlusion, reflective of Type 1 myocardial infarction (T1MI), whereas T2MI does not have significant coronary artery occlusion and therefore increased concentration of AIGFBP-3 may be used to specifically identify T2MI patients.

[0440] Table 16: Multivariable regression analysis model for IGFBP-3(T=O) in T2MI patient cohort

[0441] Table 17: Multivariable regression analysis model for hsTnT(T=o) in T2MI patient cohort

[0442] Table 18: Multivariable regression analysis model for bTnI-IgG(T=o) in T2MI patient cohort * * *

[0443] Although the invention has been described by way of example, it should be appreciated that variations and modifications may be made without departing from the scope of the invention as defined in the claims. Furthermore, where known equivalents exist to specific features, such equivalents are incorporated as if specifically referred in this specification.

[0444] REFERENCES

[0445] 1. Ranke MB, Traunecker R, Martin DD, Schweizer R, Schwarze CP, Wollmann HA, Binder G, 2005. IGF-I and IGF binding protein-3 levels during initial GH dosage step-up are indicators of GH sensitivity in GH-deficient children and short children born small for gestational age. Horm Res. 64(2):68-76.

[0446] 2. Huang SS, Ling TY, Tseng WF, Huang YH, Tang FM, Leal SM, Huang JS, 2003. Cellular growth inhibition by IGFBP-3 and TGF-betal requires LRP-1. FASEB J. 17(14):2068-81.

[0447] 3. Ingermann AR, Yang YF, Han J, Mikami A, Garza AE, Mohanraj L, Fan L, Idowu M, Ware JL, Kim HS, Lee DY, Oh Y, 2010. Identification of a novel cell death receptor mediating IGFBP-3-induced anti-tumor effects in breast and prostate cancer. J. Biol. Chem. 285(39):30233-46.

[0448] 4. Micutkova L, Hermann M, Offterdinger M, Hess MW, Matscheski A, Pircher H, Muck C, Ebner HL, Laich A, Ferrando-May E, Zwerschke W, Huber LA, Jansen-Durr P, 2012. Analysis of the cellular uptake and nuclear delivery of insulin-like growth factor binding protein-3 in human osteosarcoma cells. Int. J. Cancer 130(7): 1544-57.

[0449] 5. Knuuti J, Wijns W, Saraste A, Capodanno D, Barbato E, Funck-Brentano C, Prescott E, Storey RF, Deaton C, Cuisset T, Agewall S, Dickstein K, Edvardsen T, Escaned J, Gersh BJ, Svitil P, Gilard M, Hasdai D, Hatala R, Mahfoud F, Masip J, Muneretto C, Valgimigli M, Achenbach S, Bax JJ; ESC Scientific Document Group. 2019 ESC Guidelines for the diagnosis and management of chronic coronary syndromes. European Heart Journal (2020) 41, 407-477.

[0450] 6. https: / / www.mayoclinic.org / diseases-conditions / coronary-artery-disease / diagnosis- treatment / drc-20350619.

[0451] 7. Six A. J., Backus B.E., Kelder J.C. Chest pain in the emergency room: value of the HEART score. Neth Heart J. 2008;16: 191-196.

[0452] 8. Nilsson T, Johannesson E, Lundager Forberg J, et al. Emerg Med J 2021;38:808-813.

[0453] 9. Greenslade J, Parsonage W, Than M, Scott A, Aldous SA, Pickering JW, Hammett CJ, Cullen L. A clinical decision rule to identify emergency department patients at low risk for acute coronary syndrome who do not need objective coronary artery testing: the No Objective Testing rule Ann Emerg Med 2016 67(4): 478-489.

[0454] 10. https: / / my.clevelandclinic.org / health / diagnostics / 16836-cardiac-imaging

[0455] 11. https: / / www.mdcalc.com / calc / 1858 / emergency-department-assessment-chest-pain-score- edacs

[0456] 12. Brady 8i de Souza (2018) Turk J Emerg Med 18(2):47-51

[0457] - 59 -

[0458] SUBSTITUTE SHEET (RULE 26)

Claims

CLAIMS1. A method for determining whether a patient with a suspected underlying cardiovascular condition has a coronary artery occlusion and should undergo a triage procedure involving cardiac imaging, the method comprising:(i) determining a delta insulin-like growth factor binding protein 3 (AIGFBP-3) value which comprises:(a) measuring the concentration of IGFBP-3 from a first sample obtained from the patient at index presentation;(b) measuring the concentration of IGFBP-3 from a second sample obtained from the patient at a time point after (a); and(c) measuring the concentration difference in IGFBP-3 between the first and second samples to obtain a AIGFBP-3 value(ii) comparing the AIGFBP-3 value from the patient sample against a reference standard of AIGFBP-3 from a control population, wherein, an increase in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population reflects that the patient is likely to have a coronary artery occlusion and should undergo a triage procedure involving cardiac imaging, or wherein, a decrease in the AIGFBP-3 value in the patient sample relative to the reference standard from the control population reflects that the patient is unlikely to have a coronary artery occlusion and does not need to undergo a triage procedure involving cardiac imaging, and wherein, AIGFBP-3 is measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and history of coronary artery disease to determine the presence of the coronary artery occlusion.

2. The method according to claim 1, wherein the time point between the measurements performed in step (a) and step (b) is about 0.5 hours, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours or more.

3. The method according to claim 1 or claim 2, wherein the time point between the measurements performed in step (a) and step (b) is about 2 hours.

4. A method for determining whether a patient with a suspected underlying cardiovascular condition has a coronary artery occlusion and should undergo a triage procedure involving cardiac imaging, the method comprising:(i) measuring the concentration of insulin-like growth factor binding protein 3 (IGFBP-3) in a sample obtained from the patient at index presentation; and(ii) comparing the concentration of IGFBP-3 in the patient sample at index presentation against a reference standard of IGFBP-3 from a control population, wherein, a decrease in the IGFBP-3 value in the patient sample at index presentation relative to the reference standard from the control population reflects that the patient is likely to have a coronary artery occlusion and should undergo a triage procedure involving cardiac imaging, or wherein, an increase in the IGFBP-3 value in the patient sample at index presentation relative to the reference standard from the control population reflects that the patient is unlikely to have a coronary artery occlusion and does not need to undergo a triage procedure involving cardiac imaging, and wherein, IGFBP-3 is measured together with zero, one, two or all three of abnormal cholesterol, elevated systolic blood pressure and history of coronary artery disease to determine the presence of the coronary artery occlusion.

5. The method according to any one of claims 1 to 4, wherein the triage procedure involving cardiac imaging comprises a technique selected from coronary angiography, computed tomography (CT), electron beam computed tomography (EBCT), positron emission tomography (PET), single-photon emission computed tomography (SPECT), cardiac magnetic resonance (CMR), myocardial perfusion imaging (MPI), multi-gated acquisition (MUGA) scan, intravascular ultrasonography (IVUS), contrast echocardiography, transthoracic doppler echocardiography and electrocardiogram (ECG).

6. The method according to any one claims 1 to 5, wherein the coronary artery occlusion comprises at least one coronary artery which has at least a 40%, at least a 50%, at least a 60%, at least a 70%, at least a 80%, at least a 90% or 100% occlusion.

7. The method according to any one of claims 1 to 6, wherein the coronary artery occlusion comprises at least one coronary artery which has a > 70% occlusion.

8. The method according to any one of claims 1 to 7, wherein the patient is concurrently diagnosed as not having an acute myocardial infarction.

9. The method according to any one of claims 1 to 7, wherein the patient is concurrently diagnosed as having an acute myocardial infarction.

10. The method according to claim 9 wherein the concentration of cardiac troponinT in the patient sample is < 14 ng / L.

11. The method according to any one of claims 1 to 10, wherein the patient has symptoms of chest pain and / or shortness of breath.

12. The method according to any one of claims 1 to 11, wherein (i) the sample is a biological sample selected from plasma, serum, whole blood, arterial blood, venous blood, saliva, bone marrow tissue, heart tissue, vascular tissue and interstitial fluid sample and (ii) the IGFBP-3 is set forth in SEQ ID NO: 1.

13. The method according to any one of claims 1 to 12, wherein the IGFBP-3 or AIGFBP-3 are measured together with at least one other risk factor or clinical observation.

14. The method according to claim 13, wherein the at least one other risk factor or clinical observation is determined using a clinical test score or rule selected from HEART, EDACS and NOT.

15. The method according to claim 13 or claim 14, wherein the at least one other risk factor is selected from sex, age, family history of events including obesity, diabetes, cardiac events and / or cardiovascular disease, levels of circulating troponins including troponin T and troponin I, haemoglobin concentration, weight, level of physical activity, circulating levels of NT-proBNP, BNP, BNPsp and BNPsp fragments including BNPsp(17-26).