Novel polypeptides with improved proteolytic stability, and methods of preparing and using same
Patent Information
- Authority / Receiving Office
- IL · IL
- Patent Type
- Applications
- Current Assignee / Owner
- TUFTS UNIV
- Filing Date
- 2016-10-28
- Publication Date
- 2026-07-01
AI Technical Summary
Polypeptides used as therapeutics face challenges such as poor in vivo stability and short half-life due to proteolytic degradation, leading to diminished biological activity and increased costs, particularly in treating conditions like short bowel syndrome where current GLP-1 and GLP-2 analogs have limitations in efficacy and stability.
Chemically modified polypeptides with specific modifications to the N-terminus amino group, NH of the N-terminus first internal amide bond, or other free primary amino groups, thiol groups, and thioether groups, which are alkylated, cycloalkylated, or alkynylated, enhancing proteolytic stability without compromising biological activity.
The chemically modified polypeptides exhibit increased resistance to proteolytic degradation, prolonged in vivo half-life, and improved biological activity, including enhanced blood-brain barrier permeability and oral bioavailability, thereby offering more effective therapeutic options with reduced treatment costs.
Smart Images

Figure 00000086_0000 
Figure 00000086_0001 
Figure 00000087_0000
Abstract
Description
NOVEL POLYPEPTIDES WITH IMPROVED PROTEOLYTIC STABILITY, AND METHODS OF PREPARING AND USING SAME CROSS-REFERENCE TO RELATED APPLICATIONThis application claims the benefit of the following U.S. Provisional Application No. : 62 / 247,493, filed Oct. 28, 2015, the entire contents of which are incorporated herein by reference. BACKGROUND OF THE INVENTIONPolypeptides have attracted much interest as therapeutic agents. They have proven biological activity, have very high affinity and exquisite specificity for their biological targets, and can be prepared in large scale using recombinant techniques or chemical synthesis. However, polypeptide-based therapeutics face key liabilities, such as poor in vivo stability and short in vivo half-life. Polypeptides are substrates for several in vivo peptidases, such as dipeptidyl protease 4 (DPP4) and endopeptidases, which cleave the polypeptide chain into fragments that usually exhibit diminished function. Further, polypeptides may be chemically modified within the body, marking them for excretion and / or degradation.Attempts to minimize the instability of polypeptides towards proteolysis have been met with limited success. Acetylation of the N-terminus amino group of the polypeptide has the general effect of reducing proteolysis rates, but with accentuated loss in biological activity. Further, the N-acetyl group is still far from being stable, undergoing hydrolysis in vivo. Stabilization against enzymes such as DPP4 may be achieved by replacing amino acids at the target cleavage site, but this modification also leads to concomitant loss of biological activity in most cases.Drawbacks of peptides as developable therapeutics, especially short plasma half-life times, have been addressed by targeted chemical modifications. For instance, insertion of unnatural amino acids in the peptide chain is a common first-pass approach to new peptide lead generation. However, modifying a biologically active polypeptide at certain main chain positions can result in unacceptable loss of activity. This process of structural modification is also largely a matter of trial and error. Combined with the intrinsic low yields of chemical synthesis and peptide isolation, target chemical modification is a very expensive approach.GLP-1 is a potent 31 -residue peptide secreted by enteroendocrine cells in response to food ingestion, and possesses the salient properties of delayed gastric emptying and induced satiety, insulin secretion upon glucose intake, increase of β-cell mass and function, and concomitant weight loss. However, its half-life in vivo is less than two minutes, due to the action of endogenous serine protease dipeptidyl protease 4 (DPP4), making GLP-1 unsuitable for the treatment of Type II diabetes. Only two GLP-1 analogs have emerged as important therapeutics: Exenatide, a structural GLP-1 analog; and Liraglutide, which is a derivative of GLP-1 with an added large lipid side chain. Both of these drugs were developed in an effort to improve the proteolytic stability of GLP-1.Liraglutide self assembles into heptamers in solution, and shows enhanced albumin binding, partially protecting it from hydrolytic cleavage by DPP4. However, despite its unsurpassed ability among FDA-approved GLP-1 mimetics to reduce blood glucose in diabetics and induce weight loss, liraglutide is a relatively short acting drug that needs daily injections. Further, liraglutide is still markedly degraded by DPP4 leading to its inactivation.The derivative N-acetyl-GLP-1 is more stable to DPP4 degradation, but is 10-50 fold less active than GLP-1 itself. Thus, N-acetyl-GLP-1 cannot be used as a therapeutic agent. Moreover, N-acetylation confers in vitro stability against DPP4, but may not be effective against exopeptidases that are ubiquitous in serum. Further, deacetylation catalyzed by dedicated enzymes may occur in vivo.Additional approaches to further extend the half-life of GLP-1 have relied on fusing the polypeptide to large carrier proteins such as albumin (albiglutide) or immunoglobulin (dulaglutide). However, probably due to reduced CNS access, these constructs are less effective than liraglutide in reducing weight. Alternatively, the penultimate residue (Ala8) in GLP-1 was replaced with a helix-inducing non-canonical amino acid (a-aminoisobutyric acid, Aib). A corresponding derivative (taspoglutide) triggered antibody formation like exenatide in addition to injection site reactions, and was therefore withdrawn during clinical trials.There is a pressing need to develop more efficacious treatments for patients with short bowel syndrome (SBS), a debilitating medical condition resulting from an inability to adequately absorb nutrients from the intestine. This orphan disease occurs in patients who undergo a major loss of small bowel with surgery. A variety of underlying pathologies may lead to SBS including Crohn's disease, trauma, congenital abnormalities, and malignancy. Short bowel syndrome results in severe diarrhea, dehydration and malnutrition requiringparenteral nutrition (PN) for survival, delivered via an indwelling venous catheter.Complications of PN include sepsis, venous thrombosis and metabolic liver disease. The cumulative cost of SBS associated PN in the USA including hospitalizations is on the order of $5 billion per year.Post-surgery, there is a prolonged period, up to 2 years, where the remnant intestine adapts and nutrient absorption increases. The physiological compensation after adaptation, however, is often inadequate to meet even minimal nutritional requirements. Research efforts have focused on the identification of pharmacological agents that enhance this adaptive process. Administration of Glucagon-like Peptide-2 (GLP-2) acting through its cognate GPCR (GLP-2R) triggers expansion of the intestinal epithelium, resulting in increased nutrient absorption, enhanced barrier function and increased blood flow.A modified GLP-2 peptide, teduglutide or "GATTEX®", was FDA approved in 2012 for the treatment of SBS. GATTEX® includes a single amino acid alteration in position 2 (His-Gly-, instead of His-Ala), which enhances resistance of the polypeptide to dipeptidyl peptidase-4 (DPP4) extending its in vivo half-life from 7 minutes to ~3 hours. GATTEX® was an important but limited therapeutic step forward. After 52 weeks of treatment, 68% of SBS patients were able to reduce their PN regimen by at least 1 day / week. Despite this progress, only 4 of 52 treated patients became entirely independent of PN, and 32% failed to reduce their PN regimen by even 1 day / week. Yet, the cost of GATTEX® per patient is ~$300,000 / year. Further, introduction of the Gly residue at position 2 leads to formation of an unexpected synthetic impurity (aspartimide contamination), which must be avoided by using a manufacturing workaround that renders the synthesis longer and more expensive. Thus, more effective / competing drugs, including improved GLP-2 analogs, are critically needed for SBS to improve patient quality of life and to reduce treatment costs.There is a need in the art to identify novel methods of improving proteolytic stability of polypeptides without negatively affecting their biological activities. The present invention meets this need.SUMMARY OF THE INVENTIONThe present invention relates to chemically modified polypeptides, salts or solvates thereof which are characterized with an increased proteolytic stability without negative affects on their biological activities. In some embodiments, the chemically modifiedpolypeptides, or salts or solvate thereofs, wherein the polypeptide may have at least one of the following chemical modifications:(i) at least one selected from the group consisting of an N-terminus amino group, the NH of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide is independently derivatized with optionally substituted C1-C 16 alkyl, optionally substituted C3-C 16 cycloalkyl, optionally substituted C3-C16 aryl, optionally substituted C2-C16alkenyl or optionally substituted C2-C16alkynyl; and(ii) the NH group of at least one selected from the group consisting of the N-terminus amino group and the N-terminus first internal amide bond is derivatized with X, wherein each X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR2)i-6-phenyl,→0, -OH, -OR, alkoxy, NH2, optionally substituted NH(Ci-Ci6alkyl) and optionally substituted N(Ci-Ci6alkyl)(Ci-Ci6alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted C1-C 16 alkyl;wherein the chemically modified polypeptide has essentially the same biological activity and / or is more resistant to proteolytic degradation, as compared to the corresponding non- chemically modified polypeptide. In some embodiments, the proteolysis may be catalyzed by at least one selected from the group consisting of Acyl Peptide Hydrolase, DPP4, DPP2, DPP8, DPP9, Fibroblast Activation Protein (FAP), an S9B family oligopropyl peptidase and a protease with > 50% homology to DPP4 and / or DPP2. In some embodiments, the non- chemically modified polypeptide comprises an incretin.The chemically modified polypeptides may have greater serum stability as compared to a corresponding non-chemically modified polypeptide. The chemically modified polypeptide may have longer in vivo half-life as compared to the corresponding non- chemically modified polypeptide. The chemically modified polypeptide of claim 1 may have greater blood-brain barrier permeability or greater oral bioavailability as compared to the corresponding non-chemically modified polypeptide. In some embodiments, the modified polypeptide's half-life may be increased by at least 10-fold relative to the corresponding non- chemically modified polypeptide. In some embodiments, the modified peptide may retain at least about 5% of the biological activity of the corresponding non-chemically modified polypeptide.Multiple derivatives of the chemically modified are also included in the invention. In some embodiments, the polypeptide may be derivatized with at least one non-substituted Ci-Ce alkyl, non-substituted C3-C 16 cycloalkyl, non-substituted C2-C16alkenyl, non-substituted aryl, or non-substituted C2-C16alkynyl. In some embodiments, one or more of the N-terminus amino groups, other free amino group and / or thiol group of the polypeptide may be independently derivatized with a first substituent and a second substituent independently selected from the group consisting of optionally substituted C1-C16 alkyl, C1-C16 alkylaryl (e.g. , benzyl, etc.), optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16alkynyl, wherein the first substituent and the second substituent are independently identical or not identical. In some embodiments, the N-terminus amino group is derivatized with a first substituent and a second substituent independently selected from the group consisting of optionally substituted C1-C16 alkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16alkynyl, wherein the first substituent and the second substituent are independently identical or not identical. The alkyl and / or alkylaryl and / or cycloalkyl and / or aryl and / or alkenyl and / or alkylaryl, and / or alkynyl group may be independently substituted with at least one independently selected from the group consisting of C1-C16 alkyl, C3-C16 cycloalkyl, C2-C16alkenyl, C2-C16alkynyl, heteroaryl, heterocyclyl, C1-C6 alkoxy, azido, diazirylN , -CHO, l ,3-dioxol-2-yl, halo, haloalkyl, haloalkoxy, cyano, nitro, triflyl, tosyl, heterocyclyl, aryl, heteroaryl, -SR,alkyl), - S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR,alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and -P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C 16 alkyl. In some embodiments, the alkyl and / or alkylaryl and / or cycloalkyl and / or aryl and / or alkenyl and / or alkylaryl, and / or alkynyl group may be fluorinated or perfluorinated. In some embodiments, he alkyl group is halogenated Ci-ci6 alkyl. In some embodiments, the alkyl group may be 2,2,2,-trifluoroethyl. In some embodiments, the at least one (e.g. , two, three, four, five, etc.) alkyl, cycloalkyl, alkenyl, aryl, or alkynyl group may be selected from the group consisting of:wherein n is an integer ranging from 1 to 6, and R is hydrogen or an optionally substituted alkyl or aryl. In some embodiments, the alkyl and / or alkylaryl and / or cycloalkyl and / or aryl and / or alkenyl and / or alkylaryl, and / or alkynyl group may be selected from the group consisting of 2,2,2-trifluoro-l -ethyl, 2,2,3,3,3-pentafluoro-l-propyl, 2,2,3,3,4,4,4- heptafluoro-1 -butyl, ethyl, isopropyl, benzyl, substituted benzyl, adamant- 1-yl-methyl, quinolin-4-yl-methyl, 2-amino-l -propyl, 4-phenyl-benzyl, lH-imidazol-4-yl-methyl, 4- hydroxy-benzyl, 4-[3-(trifluoromethyl)-3H-diazirine]-benzyl, and (8R,9R,13S,14R)-3,17- dihydroxy-13-methyl-7,8,9,l l,12,13,14,15,16,17-decahydro-6H-cyclopenta[a]phenanthren- 17-yl-ethynyl-methyl.The group attached to the N-terminus amino group may occupy a binding pocket on the receptor that is proximal to the membrane-water interface where the polypeptide binds to the receptor. Chemical modifications of the polypeptide may have specific volumes or geometries. In some embodiments, the polypeptide may be chemically modified with a group that occupies a volume equal to or lower than about 240 A3(e.g. , lower than about 190 A, etc.). The chemically modified polypeptides may comprise from about 3 to about 100 amino acids or from about 3 to about 49 amino acids or from about 80 to about 100 amino acids.In some embodiments, at least the N-terminus amino group may be derivatized with an optionally substituted C1-C16alkyl, optionally substituted C1-C16arylalkyl, optionally substituted C3-C16cycloalkyl, optionally substituted C2-C16alkenyl or optionally substituted C2-C16alkynyl. In some embodiments, the chemically modified polypeptide. In some embodiments, the chemically modified polypeptide may comprise at least one amino acid residue, wherein the amino acid or amino acid residue is selected from the group consisting of:In some embodiments, the chemically modified polypeptide may comprise at least one derivatized amino acid, salt or solvate thereof having the structure:In some embodiments, the polypeptide may be selected from the group consisting of:GLP-1 (H*AEGTFTS* D VS * S * YLEGQ AAK* EFIAWLVK* GR);Exenatide (H*GEGT*FT*S*DLS*KQM*EEEAVRLFIEWLK*NGGPS*S*GAPPPS*-NH2); Liraglutide (H*AEGT*FT*S*DVS*S*Y*LEGQAA-(N6- Palmitoylglutamyl)K*EFIAWLVRGRG);Semaglutide (H*AibEGT*FT*S*DVS*S*Y*LEGQAA-(X)K*EFIAWLVRGRG), wherein Xattached to the ε-amino group of lysine is: ¾Taspoglutide (H*AibEGT*FT*S*DVS*S*YLEGQAAK*EFIAWLVK*AibR-NH2);Lixisenatide(H*GEGT*FT*S*DLS*K*QM*EEEAVRLFIEWLK*NGGPS*S*GAPPS*K*K*K*K*K*K *-NH2);Triagonist (H*AibQGT*FT*S*D-(y-E-Ci6acyl)KS*K*YLDERAAQDFVQWLLDGGPS*S*GAPPPS*-NH2);Exendin (H*GEGTFTS*DLS*KQMEEEAVRLFIEWLK*NGGPS*S*GAPPPS);VIP (H*S*DAVFTDNYTRLRK*QMAVK*K*YLNS*ILN);PACAP (H*S*DGIFTDS*YS*RYRK*QMAVK*K*YLAAVLGK*RYKQRVK*NK*);GIP (Y*AEGTFIS*DYS*IAMDK*IHQQDFVNWLLAQK*GK*K*NDWK*HNITQ); Met-Enkephalin (Y* GGFM);BNP (Y*PSKPDNPGEDAPAEDMARYYS*ALRHYINLITRQRY);Substance P (R*PK*PQQFFGLM);Tyr-MIF-1 (Y*LG);Tyr-W-MIF-1 (Y*PWG);glucagon (h*sqgtftsdyskyldsrraqdfvqwlmnt);Growth Hormone Releasing Hormone (ghrh);Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) ADCYAP1;Glucagon (GCG);Gastric Inhibitory Polypeptide (GIP);Secretin (SCT);Vasoactive Intestinal Peptid (VIP);OXM (oxyntomodulin);PTH (Parathyroid hormone);Peptide YY3-36 and Peptide YY1-36 (PYY);NPY (Neuropeptide Y);VIP peptide (Vasoactive intestinal peptide);Dual agonists for at least one selected from the group consisting of GLP-1 + GIP; GLP-1 + amylin; GLP-1 + gastrin; GLP-1 + estrogen; GLP-1 + PYY, GLP-1 + cholecystin kinase (CCK);Dual agonists for GLP-1 R + glucagon receptor;Mixed agonists;Albiglutide;Dulaglutide;Other GLP-1R agonists;Amylin;Other substrates of DPP4, DPP2 and / or a protease with > 50% homology to DPP4 and / or DPP2;GLP-1 analogues stabilized by other modifications;or a sequence with at least 75% identity to any of these sequences,wherein at least one of the residues marked with * may be alkylated (-R) or acylated (-C(O)R) with R or a hydrocarbon R (e.g. , Ci-i6 alkyl, etc.).In some embodiments, the chemically modified polypeptide may be selected from the group consisting parathyroid hormone (PTH), PYY3-36, cholecystokinin, PYY1-36, corticotropin releasing hormone receptor 1 or 2, ^ro h hormo-u.' - cici-sin;.; i'aclor. glucagon, Exendin, GLP-1, gastric inhibitory peptide, Liraglutide, prealbumin, peptide HI-27, PACAP, secretin, and vasoactive intestinal peptide (VIP),wherein the N-terminus amino group may be derivatized with (i) one selected from the group consisting of optionally substituted Cr-C^ alkyl, optionally substituted arylalkyl, optionally substituted C3-C16 aryl, optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16 alkynyl, or (ii) one selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl,→0, -OH, alkoxy, NH2, NH(Ci-Ci6 alkyl) and N(Ci-Ci6alkyl)(Ci-Ci6alkyl),wherein the derivatization stabilizes the polypeptide against degradation by at least one selected from the group consisting of Acylamino-acid-releasing enzyme, DPP4, DPP2, DPP8, DPP9, all S9B family Oligopropyl peptidases and a protease with > 50% homology to DPP4 and / or DPP2, without reducing the polypeptide's biological activity relative to the corresponding non-chemically modified protein.Pharmaceutical compositions comprising the chemically modified polypeptide are also provided. In some embodiments, the pharmaceutically acceptable composition may comprise any of the chemically modified polypeptides described herein.Methods of treating or preventing at least one disease or disorder are also provided. In some embodiments, the methods may comprise administering at least one chemically modified polypeptide to a patient in need thereof. In some embodiments, the methods may comprise administering pharmaceutical compositions comprising any chemically modified polypeptide described herein. In some embodiments, the disease or disorder may be selected from the group consisting of short bowel syndrome, Non-Alcoholic steatohepatitis, smokingcessation, neurodegeneration, Alzheimer's disease, Parkinson's disease, congenital hyperinsulism, and / or hypoglycemia. In some embodiments, the disease or disorder may be selected from the group of diabetes, weight gain, obesity, and / or metabolic syndrome.Methods of increasing the in vivo half-life of polypeptides and / or improving the blood-brain barrier permeability of polypeptides and / or improving oral bioavailability of a polypeptide are also provided. These changes (e.g. , increase half-life, improve permeability, improve bioavailability) are compared to a corresponding non-chemically modified polypeptide. In some embodiments, these methods may comprise any chemical modification described herein. In some embodiments, the method increasing the in vivo half-life of polypeptides and / or improving the blood-brain barrier permeability of polypeptides and / or improving oral bioavailability as compared to the corresponding non-chemically modified polypeptide may comprise at least one the following chemical modifications:(i) chemically modifying at least one substituent selected from the group consisting of an N-terminus amino group, the NH group of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide, wherein each chemical modification independently comprises derivatizing the substituent with an optionally substituted C1-C 16 alkyl, optionally substituted C4-C16 arylalkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C3-C 16 aryl, optionally substituted C2-C16alkenyl or optionally substituted C2-C16alkynyl, and / or(ii) chemically modifying at least one substituent selected from the N-terminus amino group and the NH of the independently comprises derivatizing the substituent with the group X, wherein each occurrence of X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR2)1-6- phenyl,→0, -OH, alkoxy, NH2, NH(CrC16alkyl) and N(Ci-Ci6alkyl)(Ci-Ci6alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted C\- Ci6 alkyl. In some embodiments, the alkyl group is 2,2,2,-trifluoroethyl. In someembodiments, the at least one alkyl, cycloalkyl, aryl, arylalkyl, alkenyl or alkynyl group may be selected from the group consisting of:- 15 -wherein "n" is an integer ranging from 1 to 6, and R maybe an optionally substituted alkyl, optionally substituted aryl, or optionally substituted arylaklyl. In some embodiments, the at least one alkyl, arylalkyl, aryl cycloalkyl, alkenyl or alkynyl group is selected from the group consisting of 2,2,2-trifluoro-l -ethyl, 2,2,3,3,3-pentafluoro-l-propyl, 2,2,3,3,4,4,4- heptafluoro-1 -butyl, ethyl, isopropyl, benzyl, substituted benzyl, adamant- 1-yl-methyl, quinolin-4-yl-methyl, 2-amino-l -propyl, 4-phenyl-benzyl, lH-imidazol-4-yl-methyl, 4- hydroxy-benzyl, 4-[3-(trifluoromethyl)-3H-diazirine]-benzyl, and (8R,9R,13S,14R)-3,17- dihy droxy- 13-methyl-7,8,9, 11 , 12, 13, 14, 15, 16, 17-decahy dro-6H-cy clopenta[a]phenanthren- 17-yl-ethynyl-methyl. In some embodimentsthe polypeptide is chemically modified with a group that occupies a volume equal to or lower than about 240 A3. In some embodiments, the polypeptide may comprises from about 5 to about 100 amino acids or from about 3 to about 49 amino acids or from about 80 to about 100 amino acids. In some embodiments, the N- terminus amino group may be derivatized with an optionally substituted C1-C16 alkyl, C1-C 16 arylalkyl, optionally substituted C3-C 16 cycloalkyl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl. In some embodiments, the polypeptide comprises at least one amino acid residue, wherein the amino acid or amino acid residue may be selected from the group consisting of:In some embodiments, the polypeptide comprises a derivatized amino acid, a salt or solvate thereof having the structure:Methods of derivatizing polypeptides are also provided. In some embodiments, the method of derivatizing a polypeptide that comprises a free amino group may comprise contacting a derivatized amino acid with a polypeptide under conditions under which the free carboxylic acid of the derivatized amino acid forms an amide bond with the free amino acid of the polypeptide.Methods of imagine a cell or tissue in a subject are also possible. In someembodiments, a method of imaging a cell or tissue in a subject comprises comprising administering to the subject in need thereof an effective amount of a chemically modified polypeptide, wherein the polypeptide is labeled with a detectable isotope and / or conjugated to a detectable label. In some embodiments, the detectable label may comprise a chromophore, a fluorescent group, a bioluminescent group, a chemiluminescent group or a radioactive group.The invnention also involves methods of characterizing a gastrinoma in a subject. In some embodiments, the methods for characterizing a gastrinoma in a subject may comprise administering to the subject a chemically modified polypeptide (e.g. , a chemically modified secretin polypeptide, etc.), and detecting an increase in gastrin in the subject, thereby characterizing the presence or absence of a gastrinoma in the subject.In some embodiments, the modification to the polypeptide increases binding to a plasma component. In some embodiments, the plasma component may be Vitamin D3 binding protein, Albumin or Transthyretin. In some embodiments, the chemically modified polypeptide is not GLP2.BRIEF DESCRIPTION OF THE DRAWINGSThe following detailed description of specific embodiments of the invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, specific embodiments are shown in the drawings. It should be understood, however, that the invention is not limited to the precise arrangements and instrumentalities of the embodiments shown in the drawings.FIG. 1 provides HPLC traces of native and modified GLP-1 variants, which were obtained concurrently from the same batch of resin in SPPS. Two products were observed by direct on-resin alkylation of GLP-1 with reagent la (see Figs. 2 and 4), which correspond to N-terminal decoration of GLP-1 with either one CHCF3 group (G-4) or with two of these moieties ("Bis-G-4"). In the latter case, the second alkylation occurs on the π nitrogen of His. Peptides were purified to >95% purity before they were assayed against the GLP-1 receptor (FIG. 3). Nomenclature according to Fig. 6 is as follows: G-l (unmodified GLP-1 ; G-2 (Ac-GLP-1); G-4 (mono-C2-GLP-l). "Bis-C2-GLP-1" is GLP-1 with two CH2CF3 moities attached to the N-terminal histidine.FIG. 2 provides a schematic showing of an exemplary fluoroalkylation scheme. The trivalent iodonium salt coordinates free amines, and the addition of a base triggers the alkylation reaction. The resulting trifluoroethyl function is unreactive, and different chemical modifications of side chains can be carried out in its presence, either on or off-resin. At the end of the synthesis, the peptide is cleaved from the resin and worked up as usual.FIG. 3 provides data from exemplary stability assays for native and fluoroalkyl- modified GLP-1 ("G-4" in nomenclature according to Fig. 6) . Briefly, HEK293 cells were plated at a density of 2-3x103cells per well onto clear-bottom, white, 96-well plates and grown for 2 days to -80% confluency. Cells were then transiently transfected by using Lipofectamine reagent (Invitrogen) with cDNA encoding (1) a GPCR (or empty expression vector); (ii) a cAMP-responsive element-luciferase reporter gene (CRE6x-luc), and (iv) β- galactosidase as a control. Cells were incubated with or without the selected peptide agonist in serum-free medium for 6 h. Luciferase activity was quantified by using Steadylite reagent (Perkin-Elmer). A β-galactosidase assay then was performed after adding the enzymesubstrate 2-nitrophenyl β-d-galactopyranoside. Following incubation at 37 °C for 30-60 min, substrate cleavage was quantified by measurement of OD at 420 nM using a SpectraMax microplate reader (Molecular Devices). Top panel: Native GLP-1 is degraded after incubation with DPP4, resulting in a pronounced potency loss compared to GLP-1 without DPP4 incubation. Bottom panel: In contrast, G-4 is completely resistant to DPP4-induced degradation.FIG. 4 provides a schematic showing the synthesis of a reagent useful within the methods of the invention.FIG. 5 provides a set of images showing that GLP-1 is rapidly deactivated by DPP4, an enzyme that cleaves the dipeptide HA from the N-terminus. Left: Cartoon depicting the inactive peptide that has lost the amino terminal HA dipeptide fragment. Right: ESI LC-MS analysis of GLP-1 and G-4 (an N-trifluoroethyl analogue that is unyielding to enzyme action) incubated overnight with DPP4 at 37 °C.FIG. 6A provides a schematic representation of chemical structures of certain analogues of the invention. X corresponds to moieties at the N-terminus, as represented by numbers. All unmodified peptides have X=l (corresponding to hydrogen; e.g. unmodified GLP-1 = G-l). Abbreviated nomenclature used in the text and in other figures is as follows: G-X (GLP-1 analogues); I-X (GIP analogues); GCG-X (glucagon analogues); DA-X (dual agonist analogues); TA-X (triagonist analogues); Lira-X (liraglutide analogues); EXE-X (exendin analogues); OXY-X (oxyntomodulin analogues); GH29-X or GH44-X (growth hormone releasing hormone analogues).FIG. 6B provides a schematic representation of chemical structures of GLP-2 analogues of the invention. X corresponds to moieties at the N-terminus, as represented by numbers. Peptides that are unmodified at the N-terminus have X=l (corresponding to hydrogen; e.g. unmodified GLP-2 = GLP2-1). Some of the analogues are additionally modified by a lysine substitution and attachment of a lipid-linker moiety in this position. Examples for GLP-2 positions where such modifications are made include LI 7 and N24, and examples of attachments include 11, 12, or 13. Gattex is an established GLP-2 based drug that includes an A2G substitution.FIG. 7 provides a graph showing concentration response curves of liraglutide andLira-4 (see FIG. 6, corresponds to N-trifluoroethyl modified liraglutide), with and without DPP4 incubation overnight. Under these conditions, >98% of liraglutide was degraded while Lira-4 remained intact. Corresponding EC50 values are indicated in pM.FIG. 8 provides a table summarizing exemplary results of stability assays (incubated with or without DPP4) for certain GLP-1 analogues.FIG. 9A provides a table summarizing exemplary results of stability assays(incubated with or without DPP4, DPP2, or FAP) for certain GLP-1 or GIP. Whereas native GLP-1 (G-l) and GIP (1-4) show major potency losses due to enzyme exposure (reflected by an increase in EC50), corresponding alkylated analogues (G4 and 14, respectively) are stable under the same conditions.FIG. 9B provides a table showing that native GLP-2 (GLP2-1) is degraded by DPP4 whereas a trifluoroethyl decorated analog (GLP2-4) is completely resistant to degradation. Peptides were incubated with vehicle or recombinant DPP4. Serial dilutions of GLP2-1 and GLP2-4 were then applied to HEK293 cells, which had been transfected with cDNA encoding human GLP-2R and a cAMP-responsive reporter gene. DPP4 induced a major increase in the EC50 of GLP-2 (indicating reduced potency), which was not observed with the GLP2-4 derivative.FIG. 9C provides a table showing that selected N-terminal decorations are well tolerated in GLP-1. Compound potencies were assessed by bioassay in HEK293 cells expressing GLP-1 receptors and a cAMP -responsive luciferase reporter gene.FIGs. 10A-10D provide a series of graphs that reflect stability assays (incubated overnight with or without DPP4) for acetyl GLP-1 (="G-2"; FIG. 10A), ethyl GLP-1 (="G- 5"; FIG. 10B), isobutyl GLP-1 (="G-6"; FIG. IOC) and C-phenyl GLP-1 (="G-11"; FIG.10D, nomenclature as in Fig. 6). "ON": overnight incubation. Corresponding EC50 values are indicated in pM.FIG. 11 provides a schematic that shows exemplary GLP-1 analogues. Nomenclature in parentheses refers to Fig. 6.FIG. 12 provides a series of graphs showing results of stability assays (incubated with or without DPP4) for unmodified GIP vs. CHCF3-GIP (compound 1-4). Whereas the unmodified peptide is degraded by DPP4, 1-4 is resistant to this enzyme. EC50 values are indicated in pM.FIG. 13 provides a series of graphs showing results of stability assays (incubated with or without DPP4) for unmodified Glucagon vs. CHCF3-glucagon (compound GCG-4).Whereas the unmodified peptide is degraded by DPP4, GCG-4 is resistant to this enzyme. EC50 values are indicated in pM.FIG. 14 provides a graph showing results of stability assays (incubated with or without DPP4) for unmodified exendin (Exe) vs. CHCF3-exendin (compound EXE-4).Whereas unmodified exendin shows detectable sensitivity to DPP4 degradation, compound Exe-4 is completely resistant to this enzyme. EC50 values are indicated in pM.FIG. 15 provides a graph showing that a triagonist that is N-terminally decorated withCHCF3("F-TA" or TA-4 in Fig. 6) co-activates the GLP-1, GIP and glucagon receptors with similar potencies. EC50 values are indicated in pM.FIG. 16 provides a schematic showing modifications that are made to amino acids found at the N-termus of secretin family peptides.FIG. 17 provides a schematic showing the molecular structures of various charged modifications.FIG. 18 provides a series of graphs comparing sensitivity of GLP-1 (left panel) vs. CHCF3-GLP-1 (right panel; G-4 in Fig. 6) to enzymatic degradation. Activity of these peptides, after overnight incubation without enzyme (control) or with either DPP4, DPP9, or FAP, was measured by luciferase assay in cells expressing GLP-1 receptors. In contrast to unmodified GLP-1, the G-4 derivative is resistant to enzyme induced potency loss (no rightward shift of concentration-response curve).FIG. 19 provides a series of graphs comparing sensitivity of native GHRH (top panel) vs. CHCF3-GHRH ("C2-GHRH", bottom panel, compound GH29-4 in Fig. 6) to enzymatic degradation. Activity of these peptides, tested as fresh stock or after overnight (O / N) incubation either with or without DPP4, was measured by luciferase assay in cells expressing GHRH receptors (GHRHR). In contrast to native GHRH, the GH29-4 derivative is resistant to enzyme induced potency loss (no rightward shift of concentration-response curve).FIG. 20 provides a helical wheel diagram of GLP-2 and interactions of the extracellular domain (ECD) of GLP-2R. Expected extracellular domain shown as a grey ellipse. Black arrow points to site modified and white arrow to proposed future modification (arginine substitution; attachment of a linker and a lipid; see Fig. 6A). L17K and N24K modifications / acylations have already been tested, in combination with an N-terminal modification. Other possible modification sites for attaching a lipid-linker moiety include positions 113, R20, 127 and 131.FIG. 21 provides a series of graphs showing that native GLP-2 is degraded by DPP4 whereas a trifluoroethyl decorated analog (GLP2-4) is completely resistant to degradation. Peptides were incubated with recombinant DPP4. Serial dilutions of GLP-2 and GLP2-4were then applied to HEK293 cells, which had been transfected with cDNA encoding human GLP-2R and a cAMP-responsive reporter gene. DPP4 induced a >40-fold loss in GLP-2 potency, reflecting that >97% of peptide was degraded. In contrast, no potency loss was noted with GLP2-4. N=4, mean+SEM.Fig. 22A provides a graph comparing the time-dependent decrease of plasma drug activity after a bolus injection of either liraglutide or a CHCF3 -decorated derivative, Lira-4. Rats received a bolus injection of either drug via central catheter, followed by serial blood draws after indicated intervals and measurement of plasma drug activity by bioassay of receptor agonism. Potency of each peptide immediately following injection was defined as 100%. Plasma survival of liraglutide is extended by the CHCF3 modification of Lira-4.Fig. 22B demonstrates sustained hypoglycemic activity of Lira-4 following an oral glucose tolerance test. Mice received a s.c. injection of either vehicle, G-4, Liraglutide, or Lira-4 (represented from left to right in each group of bars). Half an hour and 5.5 hours later, two sequential oral glucose loads were applied by gavage. Blood glucose levels were measured just before drug injection (-30 minutes) and at indicated time intervals after the glucose loads. A single injection of compound G-4 attenuated glycemic excursion after the first glucose load, and still remained active to attenuate a second glucose challenge several hours later.FIG. 23A provides a graph demonstrating extended bioactivity in vivo of GLP2- L17K( / 7)-4, a fluorinated / acylated GLP-2 analogue shown in Fig. 6A. Clearance of this compound was compared to that of Gattex, an established GLP-2 based drug, Compounds (1.25μg) were injected subcutaneously (s.c.) in mice. Plasma was collected after 24h and analyzed by luciferase reporter gene assay for GLP-2R agonist activity.FIGs. 23B-D demonstrate that GLP2-L17K( / 7)-4 (alternatively named oTTx-88 in these figures) induces intestinal mucosal growth. C57BL / 6J mice were injected s.c. once daily for five days with either vehicle, GLP2-L17K( / 7)-4, or Gattex at indicated doses. Animals were sacrificed on day 6, followed by analysis of intestinal tissue.FIG. 23B shows that GLP2-L17K( / 7)-4 (oTTx-88) enhances intestinal weight. N=6 animals / group, Mean + / -SEM. *p < 0.05 vs. vehicle.FIG. 23C provides images of histology performed with hematoxylin and eosin stain of mucosal sections.FIG. 23D provides a graph showing the quantification of villus height in vehicle- or GLP2-L17K( / 7)-4 (oTTx-88) treated mice (daily dosing was 25 μg / mouse). N=6 animals / group, Mean + / -SEM. **p < 0.01 vs. vehicle. DETAILED DESCRIPTION OF THE INVENTIONThe present invention generally provides modified peptides that resist proteolytic degradation while retaining the biological activity of the unmodified peptide, methods of synthesizing such modified peptide, and therapeutic methods featuring the modified peptides.The present invention is based, at least in part, on the discovery that certain chemical modifications of polypeptides improve their resistance to proteolysis in vitro or vivo, without significantly altering their biological activity.In certain embodiments, the chemical modification comprises derivatization of an N- terminus amino group, the NH of the amide bond formed between the N-terminus amino acid and the subsequent amino acid in the polypeptide {i.e. , the N-terminus first internal amide bond), other free primary amino group, thiol group and thioether group of the polypeptide, wherein the derivatization comprises alkylation, cycloalkylation, alkenylation oralkynylation. In other embodiments, each of the at least one alkyl, alkenyl or alkynyl group that modifies the polypeptide is independently unsubstituted or substituted. In yet other embodiments, at least one of the alkyl, alkenyl or alkynyl group that modifies the polypeptide is inert to in vivo metabolism.In certain embodiments, the chemical modification of the N-terminus amino group and / or the NH of the N-terminus first internal amide bond comprises substitution of an NH with NX, wherein each occurrence of X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR^. 6-phenyl,→0, -OH, -OR, alkoxy, NH2, optionally substituted NH(Ci-Ci6alkyl) and optionally substituted N(Ci-Ci6 alkyl)(Ci-Ci6 alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted\- e alkyl.In certain embodiments, the chemically modified polypeptides of the invention have an improved property as compared to the corresponding chemically unmodified polypeptides, wherein the property is at least one selected from the group consisting of log P, penetration into the CNS, bioabsorption, renal clearance, efficacy (receptor stimulation),delivery / formulation, storage stability (non-protease mediated), solubility, lower propensity to aggregation / oligomerization, resistance to Cytochrome P450 and other enzymes, ability tobe used in combination with other drugs (such as with C4 agonists, melanocortin MC4 receptor, and / or serotonin), reduced immunogenicity, route of administration, and pharmacokinetic parameters.It should be understood that the present disclosure contemplates the sequences disclosed herein, as well as sequences with at least 75%. 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity to the sequences disclosed herein.As described herein, the invention provides a novel method of increasing proteolysis resistance in polypeptides using minimal chemical modification. In certain embodiments, a 2,2,2-trifluoroethyl group is chemically attached to the N-terminus amino group and / or other amino group and / or thiol group and / or thioether group in the polypeptide. The chemically modified N-terminus amino group is not charged at physiological pH, in a similar fashion to the N-terminus acetylation analogues, which are known to have good proteolytic stability. The 2,2,2- trifluoroethyl group is chemically inert. Unlike an acetyl group, the 2,2,2- trifluoroethyl group is not removed by enzymatic processes in vivo. Exemplary results on N- 2,2,2-trifluoroethyl GLP-1 showed no loss of binding and activity in a cell-based assay, in sharp contrast to N-acetyl-GLP-1, which was about 10-50 times less active as compared to GLP-1.In certain embodiments, the GLP-1 analogues of the invention carry low risk of hypoglycemia, have cardio- and neuroprotective effects, and stimulated GLP-1 Rs in the brain to reduce appetite in the subjects to which they are administered. In other embodiments, the GLP-1 analogues of the invention promote weight loss or maintenance, or prevent weight gain, in the subjects to which they are administered.DefinitionsUnless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al , Dictionary of Microbiology and Molecular Biology (2ndEd. 1994); The Cambridge Dictionary of Science and Technology (Walker, Ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger, et al. (Eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). Generally, the nomenclature used herein and the laboratory procedures in medicine, organic chemistry and polymer chemistry are those well known and commonly employed in the art.As used herein, the articles "a" and "an" refer to one or to more than one (i.e. , to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.As used herein, the term "about" will be understood by persons of ordinary skill in the art and will vary to some extent on the context in which it is used. As used herein when referring to a measurable value such as an amount, a temporal duration, and the like, the term "about" is meant to encompass variations of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.As used herein, the term "administration" means providing the compound and / or composition of the present invention to a subject by any suitable method.As used herein, the term "Aib" refers to 2-amino isobutyric acid.As used herein, the term "alkenyl" employed alone or in combination with other terms means, unless otherwise stated, a stable mono-unsaturated or di-unsaturated straight chain or branched chain hydrocarbon group having the stated number of carbon atoms. Examples include vinyl, propenyl (or allyl), crotyl, isopentenyl, butadienyl, 1,3-pentadienyl, 1,4- pentadienyl, and the higher homologs and isomers. A functional group representing an alkene is exemplified by -CH2-CH=CH2.As used herein, the term "alkoxy" employed alone or in combination with other terms means, unless otherwise stated, an alkyl group having the designated number of carbon atoms, as defined above, connected to the rest of the molecule via an oxygen atom, such as, for example, methoxy, ethoxy, 1-propoxy, 2-propoxy (isopropoxy) and the higher homologs and isomers. Preferred are (Ci-C3)alkoxy, such as, but not limited to, ethoxy and methoxy.As used herein, the term "alkyl" by itself or as part of another substituent means, unless otherwise stated, a straight or branched chain hydrocarbon having the number of carbon atoms designated (i.e. , Ci-Cio means one to ten carbon atoms) and includes straight, branched chain, or cyclic substituent groups. Examples include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, tert-butyl, pentyl, neopentyl, hexyl, and cyclopropylmethyl. Most preferred is (Ci-C6)alkyl, such as, but not limited to, ethyl, methyl, isopropyl, isobutyl, n- pentyl, n-hexyl and cyclopropylmethyl.As used herein, the term "alkynyl" employed alone or in combination with other terms means, unless otherwise stated, a stable straight chain or branched chain hydrocarbon group with a triple carbon-carbon bond, having the stated number of carbon atoms. Non-limiting examples include ethynyl and propynyl, and the higher homologs and isomers. The term "propargylic" refers to a group exemplified by -CH2-C≡CH. The term"homopropargylic" refers to a group exemplified by -CH2CH2-C≡CH. The term "substituted propargylic" refers to a group exemplified by -CR.2-C≡CR, wherein each occurrence of R is independently H, alkyl, substituted alkyl, alkenyl or substituted alkenyl, with the proviso that at least one R group is not hydrogen. The term "substituted homopropargylic" refers to a group exemplified by -CR2CR2-C≡CR, wherein each occurrence of R is independently H, alkyl, substituted alkyl, alkenyl or substituted alkenyl, with the proviso that at least one R group is not hydrogen.By "ameliorate" is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease or disorder.As used herein, an "amino acid" is represented by the full name thereof, by the three- letter code, as well as the one-letter code corresponding thereto, as indicated in the following table. The structure of amino acids and their abbreviations can also be found in the chemical literature, such as in Stryer, 1988, "Biochemistry", 3rdEd., W. H. Freeman and Co., New York.As used herein, the term "aromatic" refers to a carbocycle or heterocycle with one or more polyunsaturated rings and having aromatic character, i.e. having (4n+2) delocalized π (pi) electrons, where n is an integer.As used herein, the term "aryl" or "arene" employed alone or in combination with other terms means, unless otherwise stated, a carbocyclic aromatic system containing one or more rings (typically one, two or three rings) wherein such rings may be attached together in a pendent manner, such as a biphenyl, or may be fused, such as naphthalene. Examples include phenyl, anthracyl, and naphthyl (including 1- and 2-naphthyl). Preferred are phenyl and naphthyl, most preferred is phenyl.As used herein, the term "aryl-(Ci-C3)alkyl" means a functional group wherein a one to three carbon alkylene chain is attached to an aryl group, e.g., -CH2CH2-phenyl or -CH2- phenyl (benzyl). Preferred is aryl-CH2- and aryl-CH(CH3)-. The term "substituted aryl- (Ci-C3)alkyl" means an aryl-(Ci-C3)alkyl functional group in which the aryl group is substituted. Preferred is substituted aryl(CH2)-. Similarly, the term "heteroaryl-(Ci-C3)alkyl" means a functional group wherein a one to three carbon alkylene chain is attached to a heteroaryl group, e.g. , -CEbCE -pyridyl. Preferred is heteroaryl-(CH2)-. Theterm "substituted heteroaryl-(Ci-C3)alkyl" means a heteroaryl-(Ci-C3)alkyl functional group in which the heteroaryl group is substituted. Preferred is substituted heteroaryl-(CH2)-.In one aspect, the terms "co-administered" and "co-administration" as relating to a subject refer to administering to the subject a compound and / or composition of the invention, or salt thereof, along with a compound and / or composition that may also treat any of the diseases contemplated within the invention. In one embodiment, the co-administered compounds and / or compositions are administered separately, or in any kind of combination as part of a single therapeutic approach. The co-administered compound and / or composition may be formulated in any kind of combinations as mixtures of solids and liquids under a variety of solid, gel, and liquid formulations, and as a solution.As used herein, the terms "comprises," "comprising," "containing," "having" and the like can have the meaning ascribed to them in U.S. Patent law and can mean "includes," "including," and the like; "consisting essentially of or "consists essentially " likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.As used herein, the term "composition" or "pharmaceutical composition" refers to a mixture of at least one compound useful within the invention with a pharmaceutically acceptable carrier. The pharmaceutical composition facilitates administration of the compound to a subject.As used herein, the term "cycloalkyl" by itself or as part of another substituent means, unless otherwise stated, a monocyclic or poly cyclic chain hydrocarbon having the number of carbon atoms designated (i.e. , C^-Ce means a cyclic group comprising a ring group consisting of three to six carbon atoms) and includes straight, branched chain or cyclic substituent groups. As used herein, the term "cycloalkyl" further comprises cycloalkenyl and cycloalkynyl compounds. Examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. An example is (C3-C6)cycloalkyl, such as, but not limited to, cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl. Cycloalkyl further comprises decalin, bicyclodecane, bicyclooctane, bicycloheptane, bicyclohexane, adamantyl and other poly cyclic alkyl groups.As used herein, the term "δ" refers to delta (ppm).By "decreases" is meant a negative alteration of at least about 10%, 25%, 50%, 75%, 100%, or more."Detect" refers to identifying the presence, absence or amount of the analyte to be detected.By "disease" or "disorder" is meant any condition that damages or interferes with the normal function of a cell, tissue, or organ.As used herein, the term "Acylamino-acid-releasing enzyme" also called "acylpeptide hydrolase" refers to an enzyme that in humans is encoded by the APEH gene. The enzyme is an acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides.As used herein, the term "DMSO" refers to dimethylsulfoxide.As used herein, the term "DPP2" refers to dipeptidyl protease 2.As used herein, the term "DPP4" refers to dipeptidyl protease 4.As used herein, the term "DPP8" refers to dipeptidyl protease 8.As used herein, the term "DDP9" refers to dipeptidyl protease 9.As used herein, the term "FAP" refers to fibroblast activation protein, which is also known as seprase.As used herein, the term "S9B family" refers to all S9B oligopropyl peptidases.As used herein, the term "Vitamin D-binding protein" refers to gc-globulin. belongs to the albumin gene family, together with human serum albumin and alpha-fetoprotein. Vitamin D-binding protein is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types.As used herein, "transferrin" refers to iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. Human transferrin is encoded by the TF gene.As used herein, the term "GHRH" refers to Growth hormone releasing hormone. This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors An exemplary GHRH amino acid sequence is available at NCBI Reference No. AAB37758.1 and is provided below:1 desaclqaae empnttlgcp atwdgllcwp tagsgewvtl pcpdffshfs sesgavkrdc61 titgwsepfp pypvacpvpl ellaeeesyf stvkiiytvg hsisivalfv aitilvalrr121 lhcprnyvht qlfttfilka gavflkdaal fhsddtdhcs fstvlckvsv aashfatmtn181 fswllaeavy lncllastsp ssrrafwwlv lagwglpvlf tgtwvsckla fediaYADAIFTNSYRKVLGQLSARKLLQDIMSR-amideYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-amideAs used herein, the term "GHRHR" refers to the receptor of Growth hormone releasing hormone.As used herein, the term "GLP-1" refers to glucagon-like peptide-1, a neuropeptide and an incretin derived from the transcription product of the proglucagon gene. The biologically active forms of GLP-1 are: GLP-l-(7-37) and GLP-1 -(7-36)NH2. Those peptides result from selective cleavage of the proglucagon molecule. GLP-1 is a potentantihyperglycemic hormone, inducing the β-cells of the pancreas to release the hormone insulin in response to rising glucose, while suppressing glucagon secretion. Exemplary GLP- 1 amino acid sequences are provided below:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-COOH (GLP1 7-37 acid) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2(GLP-1 7-36 amide)As used herein, the term "GLP-2" refers to glucagon-like peptide-2. GLP-2 is generated by specific post-translational proteolytic cleavage of proglucagon in a process liberates glucagon-like peptide-1 (GLP-1). Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. GLP-2 activity can include intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. An exemplary GLP-2 amino acid sequence is provided below:HADGSFSDEMNTILDNLAARDFINWLIQTKITDAs used herein, the term "PACAP" refers to Pituitary Adenylate Cyclase- ActivatingPolypeptide.As used herein, the term PYY (Peptide YY3-36, and also, YY1-36) refers to peptide tyrosine or pancreatic peptide YY3-36 is a peptide that in humans is encoded by the PYY gene.As used herein, the term "GCG" refers to Glucagon.As used herein, the term "GIP" refers to Gastric Inhibitory Polypeptide.As used herein, the term "SCT" refers to Secretin.As used herein, the term "VIP" refers Vasoactive Intestinal Peptide.By "effective amount" is meant the amount of a compound that is required to ameliorate the symptoms of a disease relative to an untreated patient. The effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.By "fragment" is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000 nucleotides or amino acids.As used herein, the term "GLP-1" refers to glucagon-like peptide- 1 or a peptide with 75% identity, preferably at least 90% identity to its sequence.As used herein, the term "GLP-2" refers to glucagon-like peptide-2 or a peptide with75% identity, preferably at least 90% identity to its sequence.As used herein, the term "halo" or "halogen" employed alone or as part of another substituent means, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom, preferably, fluorine, chlorine, or bromine, more preferably, fluorine or chlorine.As used herein, the term "heteroalkyl" by itself or in combination with another term means, unless otherwise stated, a stable straight or branched chain alkyl group consisting of the stated number of carbon atoms and one or two heteroatoms selected from the group consisting of O, N, and S, and wherein the nitrogen and sulfur atoms may be optionally oxidized and the nitrogen heteroatom may be optionally quatemized. The heteroatom(s) may be placed at any position of the heteroalkyl group, including between the rest of the heteroalkyl group and the fragment to which it is attached, as well as attached to the most distal carbon atom in the heteroalkyl group. Examples include: -0-CH2-CH2-CH3, -CH2- CH2-CH2-OH, -CH2-CH2-NH-CH3, -CH2-S-CH2-CH3, and -CH2CH2-S(=0)-CH3. Up to twoheteroatoms may be consecutive, such as, for example, -CH2-NH-OCH3, or -CH2-CH2-S-S-CH3As used herein, the term "heterocycle" or "heterocyclyl" or "heterocyclic" by itself or as part of another substituent means, unless otherwise stated, an unsubstituted or substituted, stable, mono- or multi-cyclic heterocyclic ring system that consists of carbon atoms and at least one heteroatom selected from the group consisting of N, O, and S, and wherein the nitrogen and sulfur heteroatoms may be optionally oxidized, and the nitrogen atom may be optionally quaternized. The heterocyclic system may be attached, unless otherwise stated, at any heteroatom or carbon atom that affords a stable structure. A heterocycle may be aromatic or non-aromatic in nature. In one embodiment, the heterocycle is a heteroaryl.As used herein, the term "heteroaryl" or "heteroaromatic" refers to a heterocycle having aromatic character. A poly cyclic heteroaryl may include one or more rings that are partially saturated. Examples include tetrahydroquinoline and 2,3-dihydrobenzofuryl.Examples of non-aromatic heterocycles include monocyclic groups such as aziridine, oxirane, thiirane, azetidine, oxetane, thietane, pyrrolidine, pyrroline, imidazoline, pyrazolidine, dioxolane, sulfolane, 2,3-dihydrofuran, 2,5-dihydrofuran, tetrahydrofuran, thiophane, piperidine, 1, 2,3, 6-tetrahydropyri dine, 1,4-dihydropyridine, piperazine, morpholine, thiomorpholine, pyran, 2,3-dihydropyran, tetrahydropyran, 1,4-dioxane,1.3- dioxane, homopiperazine, homopiperidine, 1,3-dioxepane, 4,7-dihydro-l,3-dioxepin and hexamethyleneoxide.Examples of heteroaryl groups include pyridyl, pyrazinyl, pyrimidinyl (such as, but not limited to, 2- and 4-pyrimidinyl), pyridazinyl, thienyl, furyl, pyrrolyl, imidazolyl, thiazolyl, oxazolyl, pyrazolyl, isothiazolyl, 1,2,3-triazolyl, 1 ,2,4-triazolyl, 1,3,4-triazolyl, tetrazolyl, 1,2,3-thiadiazolyl, 1,2,3-oxadiazolyl, 1,3,4-thiadiazolyl and 1,3,4-oxadiazolyl.Examples of poly cyclic heterocycles include indolyl (such as, but not limited to, 3-,4-, 5-, 6- and 7-indolyl), indolinyl, quinolyl, tetrahydroquinolyl, isoquinolyl (such as, but not limited to, 1- and 5-isoquinolyl), 1,2,3,4-tetrahydroisoquinolyl, cinnolinyl, quinoxalinyl (such as, but not limited to, 2- and 5 -quinoxalinyl), quinazolinyl, phthalazinyl, 1,8-naphthyridinyl,1.4- benzodioxanyl, coumarin, dihydrocoumarin, 1,5-naphthyridinyl, benzofuryl (such as, but not limited to, 3-, 4-, 5-, 6- and 7-benzofuryl), 2,3-dihydrobenzofuryl, 1,2-benzisoxazolyl, benzothienyl (such as, but not limited to, 3-, 4-, 5-, 6-, and 7-benzothienyl), benzoxazolyl, benzothiazolyl (such as, but not limited to, 2-benzothiazolyl and 5-benzothiazolyl), purinyl,benzimidazolyl, benztriazolyl, thioxanthinyl, carbazolyl, carbolinyl, acridinyl, pyrrolizidinyl, and quinolizidinyl.The aforementioned listings of heterocyclyl and heteroaryl moieties are intended to be representative and not limiting.By "identity" is meant the amino acid or nucleic acid sequence identity between a sequence of interest and a reference sequence. Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP / PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and / or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e~and e~100indicating a closely related sequence.The term "including" is used herein to mean, and is used interchangeably with, the phrase "including but not limited to."By "increases" is meant a positive alteration of at least about 10%, 25%, 50%, 75%, 100%, or more.As used herein, the term "instructional material" includes a publication, a recording, a diagram, or any other medium of expression that may be used to communicate the usefulness of the compositions and methods of the invention. In some instances, the instructional material may be part of a kit useful for specifically alkylating the N-terminus amino group, other amino group, thiol group and / or thioether group of a polypeptide. The instructional material of the kit may, for example, be affixed to a container that contains the compositions of the invention or be shipped together with a container that contains the compositions. Alternatively, the instructional material may be shipped separately from the container with the intention that the recipient uses the instructional material and the compositions cooperatively. For example, the instructional material is for use of a kit; instructions for use of the compositions; or instructions for use of a formulation of the compositions.The terms "isolated," "purified," or "biologically pure" refer to material that is free to varying degrees from components that normally accompany it as found in its native state."Isolate" denotes a degree of separation from original source or surroundings. "Purify" denotes a degree of separation that is higher than isolation. A "purified" or "biologically pure" protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.As used herein, the phrase amide "N-terminus first internal amide bond" refers to the amide bond formed between the N-terminus amino acid of a polypeptide and the subsequent amino acid in the polypeptide (i.e., residues 1 and 2 from the N-terminus of the polypeptide).As used herein, "naturally occurring amino acid" includes L-isomers of the twenty amino acids naturally occurring in proteins (plus cystine), as illustrated in Table 1. Unless specially indicated, all amino acids referred to in this application are in the L-form.Table 1. L-isomers of the twenty amino acids naturally occurring in proteins.As used herein, the terms "peptide," "polypeptide," or "protein" are usedinterchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise the sequence of a protein or peptide. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. "Polypeptides" include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogues and fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides or a combination thereof. A peptide that is not cyclic has a N- terminus and a C-terminus. The N-terminus has an amino group, which may be free (i.e. , as a NH2group) or appropriately protected (e.g. , with a BOC or a Fmoc group). The C-terminus has a carboxylic group, which may be free (i.e. , as a COOH group) or appropriately protected (e.g. , as a benzyl or a methyl ester). A cyclic peptide does not necessarily have free N- or C- termini, since they are covalently bonded through an amide bond to form the cyclic structure.As used herein, the term "pharmaceutically acceptable" refers to a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of the compound useful within the invention, and is relatively non-toxic, i.e., the material may be administered to a subject without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.As used herein, the language "pharmaceutically acceptable salt" refers to a salt of the administered compounds prepared from pharmaceutically acceptable non-toxic acids or bases, including inorganic acids or bases, organic acids or bases, solvates, hydrates, or clathrates thereof. The peptides described herein may form salts with acids or bases, and such salts are included in the present invention. In one embodiment, the salts arepharmaceutically acceptable salts. The term "salts" embraces addition salts of free acids or bases that are useful within the methods of the invention. The term "pharmaceutically acceptable salt" refers to salts that possess toxicity profiles within a range that affords utility in pharmaceutical applications. Pharmaceutically unacceptable salts may nonetheless possess properties such as high crystallinity, which have utility in the practice of the presentinvention, such as for example utility in process of synthesis, purification or formulation of peptides useful within the methods of the invention.Suitable pharmaceutically acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid. Examples of inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric (including sulfate and hydrogen sulfate), and phosphoric acids (including hydrogen phosphate and dihydrogen phosphate).Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic, acetic, propionic, succinic, gly colic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, malonic, saccharin, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic, trifluoromethanesulfonic, 2- hydroxyethanesulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, β-hydroxybutyric, salicylic, galactaric and galacturonic acid.Suitable pharmaceutically acceptable base addition salts of peptides of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts. Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, Ν,Ν'-dibenzylethylene-diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine. All of these salts may be prepared from the corresponding peptides by reacting, for example, the appropriate acid or base with the peptide.The term "prevent" or "preventing" or "prevention," as used herein, means avoiding or delaying the onset of symptoms associated with a disease or condition in a subject that has not developed such symptoms at the time the administering of an agent or compound commences. Disease, condition, and disorder are used interchangeably herein.As used herein, the term "reaction condition" refers to a physical treatment, chemical reagent, or combination thereof, which is required or optionally required to promote a reaction. Non-limiting examples of reaction conditions are electromagnetic radiation, heat, a catalyst, a chemical reagent (such as, but not limited to, an acid, base, electrophile or nucleophile), and a buffer.By "reference" is meant a standard or control condition.A "reference sequence" is a defined sequence used as a basis for sequence comparison.As used herein, the term "subject," "patient" or "individual" may be a human or non- human mammal or a bird. Non-human mammals include, for example, livestock and pets, such as ovine, bovine, equine, porcine, canine, feline and murine mammals. Preferably, the subject is human.As used herein, the term "substituted" means that an atom or group of atoms has replaced hydrogen as the substituent attached to another group. Unless stated otherwise, any group recited within the invention may be substituted.For substituted alkyl, alkenyl, alkynyl or cycloalkyl groups, substituents comprise at least one independently selected from the group consisting of C1-C16 alkyl, C3-C16 cycloalkyl, C2-C16 alkenyl, C2-C16 alkynyl (including -C≡CH), heteroaryl, heterocyclyl, C1-C6 alkoxy, azido, diaziryl N¾, -CHO, l,3-dioxol-2-yl, halo, haloalkyl (such as trifluoromethyl, difluoromethyl and fluoromethyl), cyano, nitro, triflyl, mesyl, tosyl, haloalkoxy (such as trifluomethoxy, difluoromethoxy and fluoromethoxy), heterocyclyl, aryl, heteroaryl, -SR, -alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR, -alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and - P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C6 alkyl.For substituted aryl, aryl-(Ci-C3)alkyl and heterocyclyl groups, the term "substituted" as applied to the rings of these groups refers to any level of substitution, namely mono-, di-, tri-, tetra-, or penta-substitution, where such substitution is permitted. The substituents are independently selected, and substitution may be at any chemically accessible position. In one embodiment, the substituents vary in number between one and four. In another embodiment, the substituents vary in number between one and three. In yet another embodiment, the substituents vary in number between one and two. In yet another embodiment, the substituents are independently selected from the group consisting of C1-C 16 alkyl, C3-C16 cycloalkyl, C2-C16 alkenyl, C2-C16 alkynyl (including -C≡CH), heteroaryl, heterocyclyl, Ci-C6alkoxy, azido, diaziryl N ll>¾;-CHO, l ,3-dioxol-2-yl, halo, haloalkyl (such as trifluoromethyl, difluoromethyl and fluoromethyl), cyano, nitro, triflyl, mesyl, tosyl, haloalkoxy (such as trifluomethoxy, difluoromethoxy and fluoromethoxy), heterocyclyl, aryl, heteroaryl, -SR,alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR,alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, - C(=NR)NRR, and -P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C6 alkyl. As used herein, where a substituent is an alkyl or alkoxy group, the carbon chain may be branched, straight or cyclic, with straight being preferred.The terms "treat" and "treating" and "treatment," as used herein, means reducing the frequency or severity with which symptoms of a disease or condition are experienced by a subject by virtue of administering an agent or compound to the subject.Throughout this disclosure, various aspects of the invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range and, when appropriate, partial integers of the numerical values within ranges. Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.Any compounds, compositions, or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.Other features and advantages of the invention will be apparent from the following description of the desirable embodiments thereof, and from the claims.PolypeptidesIn one aspect, the invention provides chemically modified polypeptides, wherein the chemical modification comprises at least one of the following: (i) at least one selected from the group consisting of an N-terminus amino group, the NH of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide is independently alkylated, cycloalkylated, alkenylated or alkynylated, wherein each individual alkyl, cycloalkyl, alkenyl or alkynyl group is independently optionally substituted; and (ii) the NH of at least one sel ected from the group consi sting of the N- terminus amino group and the N-terminus first internal amide bond is derivatized with X, wherein each X is independently selected from the group consisting of optionally substitutedphenyl,→0 (thus generating an N-oxide), -OH, alkoxy, N3¾, NH(Cj-C]6alkyl) and NfCr Ci6 alkyl)(Ci-Ci6 alkyl).In certain embodiments, the N-terminus amino group, the NH of the N-terminus first internal amide bond, other free primary amino group, thiol group and / or thioether group of the polypeptide are each independently alkylated, cycloalkylated, alkenylated or alkynylated with a corresponding optionally substituted group.In certain embodiments, one or more of the N-terminus amino group, other free amino group and / or thiol group of the polypeptide is independently alkylated with a first substituent and a second substituent contemplated herein, wherein the first and second substituents are independently identical or not identical. In other embodiments, one or more of the N- terminus amino group, other free amino group and / or thiol group of the polypeptide is independently alkylated with a first optionally substituted C1-C 16 alkyl and a second optionally substituted C1-C 16 alkyl, wherein the first and second alkyls are independently identical or not identical. In yet other embodiments, one or more of the N-terminus amino group, other free amino group and / or thiol group of the polypeptide is independently alkylated with a first optionally substituted methyl and a second optionally substituted methyl, wherein the first and second methyls are independently identical or not identical. In yet other embodiments, one or more of the N-terminus amino group, other free amino group and / or thiol group of the polypeptide is independently alkylated with two optionally substituted C1-C16 alkyls. In yet other embodiments, one or more of the N-terminus amino group, other free amino group and / or thiol group of the polypeptide is independently alkylated with two methyls. In yet other embodiments, at least the N-terminus amino group of the polypeptide is derivatized with a group contemplated herein, wherein the group is substituted or unsubstituted.Non-limiting examples of the alkyl, cycloalkyl, alkenyl or alkynyl groups contemplated within the invention comprise:-40 -1integer ranging from 1 to 6, and R is an optionally substituted alkyl or aryl.Without wishing to be limited by any theory, the group attached to the N-terminus group occupies a binding pocket on the receptor that is proximal to the membrane-water interface where the polypeptide binds to the receptor. It is expected that the dimensions of the binding pocket differs among receptors. In certain embodiments, for GLP-1R the binding pocket has a volume equal to or less than approximately 190 A3, as ascertained by the fact that the N-l-adamantyl-methyl derivative of GLP-1 was found to have comparable activity to the underivatized GLP-1.In certain embodiments, the polypeptides of the invention are more resistant to proteolytic activity by DPP4, DPP2 and / or a protease with > 50% homology to DPP4 and / orDPP2 than the corresponding unmodified polypeptides. In certain embodiments, the polypeptides of the invention are more resistant to endoprotease activity than thecorresponding unmodified polypeptides. In yet other embodiments, the chemically modified polypeptides have improved overall proteolytic stability in human serum over thecorresponding non-chemically modified polypeptides.In certain embodiments, the chemically modified polypeptides have improved in vivo half-lives over the corresponding non-chemically modified polypeptides. In other embodiments, the chemically modified polypeptides have improved blood-brain barrier permeability over the corresponding non-chemically modified polypeptides. In yet other embodiments, the chemically modified polypeptides have improved pharmacokinetics over the corresponding non-chemically modified polypeptides.In certain embodiments, the chemical modification contemplated in the invention includes a substituent selected from the group consisting of C1-C16 alkyl, C3-C 16 cycloalkyl, C2-C16alkenyl or C2-C16alkynyl, which is optionally substituted with at least one group selected from the group consisting of C1-C16 alkyl, C3-C 16 cycloalkyl, C2-C16alken C2-C16alkynyl (including -C≡CH), heteroaryl, heterocyclyl, C1-C6 alkoxy, azido, diaziryl;- CHO, l ,3-dioxol-2-yl, halo, haloalkyl (such as trifluoromethyl, difluoromethyl and fluoromethyl), cyano, nitro, triflyl, mesyl, tosyl, haloalkoxy (such as trifluomethoxy, difluoromethoxy and fluoromethoxy), heterocyclyl, aryl, heteroaryl, -SR, -S(=0)(Ci-C6 alkyl),alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR, -OC(=0)0(Ci- C6alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and -P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C16 alkyl. In other embodiments, at least one occurrence of the alkyl group contemplated is -CH2CF3.The polypeptides of the invention may be prepared using any methods known to those skilled in the art. In certain embodiments, the polypeptide may be prepared using standardpeptide synthesis, wherein at least one of the chemically modified residues is introduced in the reaction mixture already in its chemically modified form. In other embodiments, the polypeptide may be prepared using standard peptide synthesis, wherein all of the modified residues are introduced in the reaction mixture already in their chemically modified form. In yet other embodiments, the polypeptide of the invention, or a fragment thereof, is chemically modified in situ, whereby the N-terminus amino group, other free amino group, thiol group (such as from a cysteine residue) and / or thioether group (such as for a methionine residue) is reacted with a reagent that promotes the alkylation of that group. The resulting chemically modified polypeptide, or fragment thereof, may be used as such in therapeutic treatments and / or further chemical reactions. Alternatively, the resulting chemically modified polypeptide, or fragment thereof, may be purified and then used as a therapeutic agent and / or submitted to further chemical reactions.In certain embodiments, peptides are assembled via standard automated peptide synthesis using Fmoc chemistry. In other embodiments, lysine side chain amino groups are protected with an allyloxycarbonyl (alloc) group that can be selectively removed using for example PhSiH3and Pd(PPh3)4. In yet other embodiments, lysine side chain amino groups can be subsequently coupled to lipids using established chemistry.In certain embodiments, a free primary amino group in the polypeptide (such as the N-terminus amino group) is reacted with an aldehyde or ketone under reductive conditions (such as for example in the presence of a borohydride) to give rise to the corresponding derivatized amine. Alternatively, the derivatized amino acid is prepared separately, and coupled with the growing polypeptide chain as necessary.In certain embodiments, the polypeptides are cleaved from the resin using for example CF3C02H:TIPS:H20 (95:2.5:2.5), purified using for example reversed-phase HPLC, and analyzed using for example ESI and MALDI-MS.In certain embodiments, at least one free amino, thiol and / or thioether group of the polypeptide is modified with a 2,2,2-trifluoroethyl group. Such modification may be carried out on solid phase, whereby the immobilized polypeptide, or a fragment thereof, is reacted with a 2,2,2-trifluoroethyliodonium salt, such as a (2,2,2-trifluoroethyl)phenyliodonium salt, a (2,2,2-trifluoroethyl)(l,3,5-tri-R-phenyl)iodonium salt (wherein R is H or methyl). The salt depicted below transfers -CH2CF2CF3or -CH2CF2CF2H.In other embodiments, modification of the polypeptide with a trifluoromethyl group may be carried out on solid phase or solution phase, for example using the following non- limiting reaction:The invention further contemplates intramolecular and / or intermolecular crosslinking of the polypeptides of the present invention. In certain embodiments, at least two functional groups selected from the group consisting of a free amino, thiol and / or thioether group of the polypeptide are crosslinked using a bis(iodonium) salt, such as:In certain embodiments, the polypeptides of the invention comprise at least one of the following chemically modified amino acids (FIG. 29):In certain embodiments, the chemically modified polypeptides of the invention comprise one of the following sequences, wherein, in each polypeptide, at least one of the residues marked with an asterisk (*) is chemically modified as contemplated within the invention (Aib represents 2-amino isobutyric acid) and the polypeptide is optionally lipidated. GLP-1 :H*AEGTFTS*DVS*S*YLEGQAAK*EFIAWLVK*GRExenatide:H*GEGT*FT*S*DLS*KQM*EEEAVRLFIEWLK*NGGPS*S*GAPPPS*-NH2Liraglutide:H*AEGT*FT*S*DVS*S*Y*LEGQAA-(N6-Palmitoylglutamyl)K*EFIAWLVRGRG Semaglutide:H*AibEGT*FT*S*DVS*S*Y*LEGQAA-(X)K*EFIAWLVRGRG, wherein X attached to the ε-amino group of lysine is:Taspoglutide:H*AibEGT*FT*S*DVS*S*YLEGQAAK*EFIAWLVK*AibR-NH2Lixisenatide:H*GEGT*FT*S*DLS*K*QM*EEEAVRLFIEWLK*NGGPS*S*GAPPS*K*K*K*K *K*K*-NH2Triagonist:H*AibQGT*FT*S*D-(y-E-Ci6acy 1)KS *K* YLDERAAQDF VQWLLD GGP S * S * GAPPP S * -NH2GLP-2:H*ADGSFSDEMNTILDNLAARDFINWLIQTK*ITDExendin:H* GEGTFTS *DL S * KQMEEEAVRLFIEWLK*NGGP S * S * GAPPP SVIP:H*S *DAVFTDNYTRLRK*QMAVK*K* YLNS *ILNPACAP:H*S*DGIFTDS*YS*RYRK*QMAVK*K*YLAAVLGK*RYKQRVK*NK:*GIP:Y*AEGTFIS*DYS*IAMDK*IHQQDFVNWLLAQK*GK*K*NDWK*HNITQ Met-Enkephalin:Y*GGFMBNP:Y*PSKPDNPGEDAPAEDMARYYS*ALRHYINLITRQRYSubstance P:R*PK*PQQFFGLMTyr-MIF-1 :Y*LGTyr-W-MIF-1 :Y*PWGglucagonH*SQGTFTSDYSKYLDSRRAQDFVQWLMNTGrowth Hormone Releasing Hormone (GHRH);Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) ADCYAP1;Glucagon (GCG);Gastric Inhibitory Polypeptide (GIP);Secretin (SCT);Vasoactive Intestinal Peptid (VIP);OXM (oxyntomodulin) (dual agonist for GLP-IR and GIPR)PTH (Parathyroid hormone) ~ hPTH (1-34);PYY (Peptide YY3-36, and also, YY1-36);NPY (Neuropeptide Y);VIP peptide (Vasoactive intestinal peptide);Dual agonists for GLP-1 + GIP; GLP-1 + amylin; GLP-1 + gastrin; GLP-1 + estrogen; GLP- 1 + GLP-2, as recited for example in Finan, et al , 2015, Mol. Cell Endocrinol, Jul. 4, pii: S0303-7207(15)30012-5. doi: 10.1016 / j.mce.2015.07.003.Dual agonists for GLP-IR + glucagon, such as, but not limited to, LY2944876 / TT-401 [Eli Lilly]; ZP2929 [Zealand]; HM 12525 A [Hamni Pharmaceuticals]; MEDI0382[Medlmmune]; SAR425899 [Sanofi]; G530L / NN9030 + Liraglutide [NovoNordisk]; VPD-107 [Spitfire Pharma]; MOD-6030 / 1 [Prolor / OPKO Biologies];Mixed agonists, such as, but not limited to, MAR709 / R06811135 [MB-2]; Cpd86 {Eli Lilly]; ZP-DI-70 [Zealand]; IUB447 [MB-2]; ZP-GG-23 [Zealand]; ZP3022[Zealand];Albiglutide (GLP-1 covalently attached to albumin [GlaxoSmithKline]);Dulaglutide (GLP-1 attached to Fc antibody fragment / Eli Lilly);Other GLP-1R agonists, such as but not limited to: ITCA 650 [Intarcia]; CJC-1134-PC [ConjuChem]; Langlenatide / HM11260C [Hamni Pharmaceuticals]; PB1023 (Glymera) [PhaseBio]; VRS 859 [Diartis Pharmaceuticals]; TTP054 [Trans Tech Pharma]; ZYOG1 [Zydus Cadila]; N 9924 / OG217SC [Novo Nordisk]; NN9926 / OG987GT [Novo Nordisk]; NN9927 / OG987SC [Novo Nordisk]; ARI-1732TS [Arisaph Pharmaceuticals];Other DPP4 substrates, such as, but not limited to: GHRH; MCP-3; MCP-4; LEC;endomorphin 1; endomorphin 2; I-TAC; SDF-la; SDF-Ιβ; GRP; PACAP38; GH(1- 43); CART(55-102); IP-10; PHM; ghrelin; Gro-β; LIX; pancreatic polypeptide; eotaxin;!le-Leu-NH2 (from Penchala? etal, 2015, Nat. Chem. Biol. 11:793-800)GLP-1 analogues stabilized by other modifications, such as but not limited to biotinylation, vitamin 12 coupling, and P' modification, as recited for example in Clardy-James, et al, 2013, ChemMedChem, Apr;8(4):582-6. doi: 10.1002 / cmdc.201200461. Epub2012 Nov 30; and Heard, et al, 2013, J Med Chem., Nov 14;56(21):8339-51. doi: 10.1021 / jm400423p. Epub 2013 Oct 16.The polypeptides of the invention may possess one or more stereocenters, and each stereocenter may exist independently in either the (R) or (S) configuration. In one embodiment, polypeptides described herein are present in optically active or racemic forms. The polypeptides described herein encompass racemic, optically-active, regioisomeric and stereoisomeric forms, or combinations thereof that possess the therapeutically usefulproperties described herein. Preparation of optically active forms is achieved in any suitable manner, including by way of non-limiting example, by resolution of the racemic form with recrystallization techniques, synthesis from optically-active starting materials, chiral synthesis, or chromatographic separation using a chiral stationary phase. In one embodiment, a mixture of one or more isomers is utilized as the therapeutic polypeptides described herein. In another embodiment, compounds described herein contain one or more chiral centers. These compounds are prepared by any means, including stereoselective synthesis, enantioselective synthesis and / or separation of a mixture of enantiomers and / ordiastereomers. Resolution of polypeptides and isomers thereof is achieved by any means including, by way of non-limiting example, chemical processes, enzymatic processes, fractional crystallization, distillation, and chromatography.The methods and formulations described herein include the use of N-oxides (if appropriate), crystalline forms (also known as polymorphs), solvates, amorphous phases, and / or pharmaceutically acceptable salts of polypeptides having the structure of any polypeptides of the invention, as well as metabolites and active metabolites of these polypeptides having the same type of activity. Solvates include water, ether (e.g. , tetrahydrofuran, or methyl tert-butyl ether) or alcohol (e.g. , ethanol) solvates, acetates and the like. In certain embodiments, the polypeptides described herein exist in solvated forms with pharmaceutically acceptable solvents such as water, and ethanol. In another embodiment, the compounds described herein exist in unsolvated form.In one embodiment, the polypeptides of the invention may exist as tautomers. All tautomers are included within the scope of the compounds recited herein.In one embodiment, compounds described herein are prepared as prodrugs. A "prodrug" is an agent converted into the parent drug in vivo. In one embodiment, upon in vivo administration, a prodrug is chemically converted to the biologically, pharmaceutically or therapeutically active form of the polypeptide. In another embodiment, a prodrug is enzymatically metabolized by one or more steps or processes to the biologically,pharmaceutically or therapeutically active form of the polypeptide.In one embodiment, sites on, for example, the aromatic ring portion of polypeptides of the invention are susceptible to various metabolic reactions. Incorporation of appropriate substituents on the aromatic ring structures may reduce, minimize or eliminate this metabolic pathway. In one embodiment, the appropriate substituent to decrease or eliminate thesusceptibility of the aromatic ring to metabolic reactions is, by way of example only, a deuterium, a halogen, or an alkyl group.Compounds described herein also include isotopically-labeled compounds wherein one or more atoms is replaced by an atom having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes suitable for inclusion in the polypeptides described herein include and are not limited to2H,3H,nC,13C,14C,36C1,18F,123I,125I,13N,15N,150,170,180,32P,35S,mIn,99mTec,68Ga,18F,64Cu,125I, and / or1 1I. In certain embodiments, isotopically-labeled compounds are useful in drug and / or substrate tissue distribution studies. In another embodiment, substitution with heavier isotopes such as deuterium affords greater metabolic stability (for example, increased in vivo half-life or reduced dosage requirements). In yet another embodiment, substitution with positron emitting isotopes, such asnC,18F,150 and1N, is useful in Positron Emission Topography (PET) studies for examining substrate receptor occupancy. Isotopically-labeled polypeptides are prepared by any suitable method or by processes using an appropriate isotopically-labeled reagent in place of the non-labeled reagent otherwise employed.In one embodiment, the polypeptides described herein are labeled by other means, including, but not limited to, the use of chromophores or fluorescent moieties, bioluminescent labels, or chemiluminescent labels.The invention further includes a pharmaceutical composition comprising at least one polypeptide of the invention and a pharmaceutically acceptable carrier.In certain embodiments, the pharmaceutical composition further comprises at least one additional agent that is useful to treat the diseases or disorders contemplated herein. In certain embodiments, the polypeptide of the invention and the additional agent are co- formulated in the composition.SaltsThe polypeptides described herein may form salts with acids or bases, and such salts are included in the present invention. In certain embodiments, the salts are pharmaceutically acceptable salts. The term "salts" embraces addition salts of free acids or bases that are useful within the methods of the invention. The term "pharmaceutically acceptable salt" refers to salts that possess toxicity profiles within a range that affords utility inpharmaceutical applications. Pharmaceutically unacceptable salts may nonetheless possessproperties such as high crystallinity, which have utility in the practice of the present invention, such as for example utility in process of synthesis, purification or formulation of polypeptides useful within the methods of the invention.Suitable pharmaceutically acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid. Examples of inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric (including sulfate and hydrogen sulfate), and phosphoric acids (including hydrogen phosphate and dihydrogen phosphate).Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic, acetic, propionic, succinic, gly colic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, malonic, saccharin, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic, trifluoromethanesulfonic, 2- hydroxyethanesulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, β-hydroxy butyric, salicylic, galactaric and galacturonic acid.Suitable pharmaceutically acceptable base addition salts of polypeptides of the invention include, for example, ammonium salts and metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts. Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, N,N'-dibenzylethylene- diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N- methylglucamine) and procaine. All of these salts may be prepared from the corresponding polypeptide by reacting, for example, the appropriate acid or base with the compound. MethodsIn one aspect, the invention includes a method of increasing proteolysis resistance of a polypeptide against a proteolytic enzyme, over the corresponding non-chemically modified polypeptide. In certain embodiments, the proteolytic enzyme is DPP4, DPP2 and / or other proteases with > 50% homology to DPP4 and / or DPP2.In another aspect, the invention includes a method of increasing serum stability of a polypeptide, over the corresponding non-chemically modified polypeptide.In yet another aspect, the invention includes a method of improving the in vivo half- life of a polypeptide, over the corresponding non-chemically modified polypeptide.In yet another aspect, the invention includes a method of improving the blood-brain barrier permeability of a polypeptide, over the corresponding non-chemically modified polypeptide.In yet another aspect, the invention includes a method of improving thepharmacokinetics properties of a polypeptide over the corresponding non-chemically modified polypeptide.In certain embodiments, the method comprises at least one selected from the group consisting of: (i) chemically modifying at least one substituent selected from the group consisting of an N-terminus amino group, the NH group of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide, wherein each chemical modification independently comprises derivatizing the substituent with an optionally substituted alkyl, cycloalkyl, alkenyl or alkynyl group, and (ii) chemically modifying at least one substituent selected from the N-terminus amino group and the NH of the independently comprises derivatizing the substituent with the group X, wherein each occurrence of X is independently selected from the group consisting of→0, -OH, aikoxy, NH2, NH(C C16alkyl) and N((, ·<':,. alkyl)(C C16alkyl).In certain embodiments, the invention contemplates independent occurrences of Ci- Ci6alkyl, C3-C 16 cycloalkyl, C2-C16 alkenyl or C2-C16 alkynyl, which is optionally substituted with at least one group selected from the group consisting of C1-C 16 alkyl, C3-C16 cycloalkyl, C2-C16 alkenyl, C2-C16 alkynyl (including -C≡CH), heteroaryl, heterocyclyl, C1-C6 aikoxy, azido, diaziryl N iDH¾- (including methyldiaziryl or trifluoromethyldiaziryl), -CHO, 1,3- dioxol-2-yl, halo (such as trifluoromethyl, difluoromethyl and fluoromethyl), cyano, nitro, triflyl, mesyl, tosyl, haloalkoxy (such as trifluomethoxy, difluoromethoxy andfluoromethoxy), heterocyclyl, aryl, heteroaryl, -SR, -S(=0)(Ci-C6 alkyl),alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR,alkyl), -NRR, - C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and -P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C6 alkyl. In other embodiments, at least one occurrence of the alkyl group contemplated is -CH2CF3.In yet another aspect, the invention includes a method of treating or preventing a disease or disorder in a subject in need thereof, wherein the method comprises administering a therapeutically effective amount of at least one polypeptide of the invention to the subject, wherein the polypeptide is optionally formulated as a pharmaceutically effectivecomposition. In certain embodiments, the polypeptide or composition is administered to the subject by at least one route selected from oral, rectal, mucosal (e.g., by oral or nasal inhalation), transmucosal, topical (transdermal), and intravenous, intradermal, intramuscular, subcutaneous, intracutaneous, intrauterine, epidural and intracerebroventricular injections. In other embodiments, the subject is further administered at least one additional agent useful for treating or preventing the disorder or disease. In yet other embodiments, the subject is a mammal. In yet other embodiments, the mammal is human. In yet other embodiments, the disease is congenital hyperinsulinism, non-alcoholic steatohepatitis (NASH), short bowel syndrome, Alzheimer's disease, Parkinson's disease and the cessation of smoking.In another aspect, the invention provides therapeutic compositions comprising modified forms of GLP-2, alone or in combination with valproic acid and / or CHIR99021, and methods of using such compositions to increase intestinal cell proliferation and / or enhance intestinal growth for the treatment of short bowel syndrome, Crohn's disease, radiation injury of the intestine, chemotherapy induce enteritis, or necrotizing enterocolitis.CHIR990216-[[2 [4-(2,4-Dichiorophenyi)-5 5-methyi-lH-miidazol-2~yi)-2- p rirriidinyljamino]ethyl]arainoj-3-pyridinecarbonitrile:In yet another aspect, the invention includes a method of imaging a cell or tissue in a subject. In certain embodiments, the method comprises administering to the subject in need thereof an effective amount of a polypeptide of the invention, wherein the polypeptide is labelled with a detectable isotope and / or conjugated to a detectable label. In other embodiments, the detectable label comprises a chromophore, a fluorescent group, a bioluminescent group, a chemiluminescent group or a radioactive group. In yet other embodiments, the polypeptides of the invention can be used to image insulinomas and / or pancreatic neuroendocrine tumors.Formulations / AdministrationThe compositions of the present invention may contain a pharmaceutical acceptable carrier, excipient and / or diluent, and may be administered by a suitable method to a subject.The compositions of the present invention may be formulated in various forms, including oral dosage forms or sterile injectable solutions, according to any conventional method known in the art. In other embodiments, the compositions may also be used as an inhalation-type drug delivery system. In yet other embodiments, the compositions of the invention may be formulated for injectable solutions.The compositions may be formulated as powders, granules, tablets, capsules, suspensions, emulsions, syrup, aerosol, preparations for external application, suppositories and sterile injectable solutions. Suitable formulations known in the art are disclosed in, for example, Remington's Pharmaceutical Science (Mack Publishing Company, Easton PA). Carriers, excipients and diluents that may be contained in the composition of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propyl hydroxylbenzoate, talc, magnesium stearate or mineral oil.Tablets may also contain such standard ingredients as binding and granulating agents such as polyvinylpyrrolidone, disintegrants (e.g. swellable crosslinked polymers such as crosslinked carboxymethylcellulose), lubricating agents (e.g. stearates), preservatives (e.g. parabens), antioxidants (e.g. , BHT), buffering agents (for example phosphate or citrate buffers), and effervescent agents such as citrate / bicarbonate mixtures. Such excipients are well known and do not need to be discussed in detail here. Capsule formulations may be of the hard gelatin or soft gelatin variety and can contain the active component in solid, semisolid, or liquid form. Gelatin capsules can be formed from animal gelatin or synthetic or plant derived equivalents thereof. The solid dosage forms (e.g. , tablets, capsules etc.) can be coated or uncoated, but typically have a coating, for example a protective film coating (e.g. a wax or varnish) or a release controlling coating. The coating (e.g. , a Eudragit.TM. type polymer) can be designed to release the active component at a desired location within the gastro-intestinal tract. Thus, the coating can be selected so as to degrade under certain pH conditions within the gastrointestinal tract, thereby selectively release the compound in the stomach or in the ileum or duodenum. Alternatively or additionally, the coating can be used as a taste masking agent to mask unpleasant tastes such as bitter tasting drugs. The coating may contain sugar or other agents that assist in masking unpleasant tastes. Instead of, or in addition to, a coating, the antibiotic can be presented in a solid matrix comprising a release controlling agent, for example a release delaying agent which may be adapted to selectivelyrelease the compound under conditions of varying acidity or alkalinity in the gastrointestinal tract. Alternatively, the matrix material or release retarding coating can take the form of an erodible polymer (e.g., a maleic anhydride polymer) which is substantially continuously eroded as the dosage form passes through the gastrointestinal tract. As a further alternative, the active compound can be formulated in a delivery system that provides osmotic control of the release of the compound. Osmotic release and other delayed release or sustained release formulations may be prepared in accordance with methods well known to those skilled in the art. The pharmaceutical formulations may be presented to a patient in "patient packs" containing an entire course of treatment in a single package, usually a blister pack. Patient packs have an advantage over traditional prescriptions, where a pharmacist divides a patient's supply of a pharmaceutical from a bulk supply, in that the patient always has access to the package insert contained in the patient pack, normally missing in patient prescriptions. The inclusion of a package insert has been shown to improve patient compliance with the physician's instructions. Each tablet, capsule, caplet, pill, etc. can be a single dose, with a dose, for example, as herein discussed, or a dose can be two or more tablets, capsules, caplets, pills, and so forth; for example if a tablet, capsule and so forth is 125 mg and the dose is 250 mg, the patient may take two tablets, capsules and the like, at each interval there is to administration.The compositions of the present invention may be formulated with commonly used diluents or excipients, such as fillers, extenders, binders, wetting agents, disintegrants, or surfactants. Solid formulations for oral administration include tablets, pills, powders, granules, or capsules, and such solid formulations comprise, in addition to the composition, at least one excipient, for example, starch, calcium carbonate, sucrose, lactose or gelatin. In addition to simple excipients, lubricants such as magnesium stearate or talc may also be used. Liquid formulations for oral administration include suspensions, solutions, emulsions and syrup, and may contain various excipients, for example, wetting agents, flavoring agents, aromatics and preservatives, in addition to water and liquid paraffin, which are frequently used simple diluents.Formulations for parenteral administration include sterilized aqueous solutions, non- aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories. As non-aqueous solvents or suspending agents, propylene glycol, polyethylene glycol, plant oils such as olive oil, or injectable esters such as ethyl oleate may be used. As the base of thesuppositories, witepsol, Macrogol, Tween 61, cacao butter, laurin fat, or glycerogelatin may be used.The dose of the pharmaceutical compositions of the present invention varies depending on the patient's condition and weight, the severity of the disease, the type of drug, and the route and period of administration and may be suitably selected by those skilled in the art. For certain effects, the pharmaceutical composition of the present invention may be administered at a dose of 0.01-100 mg / kg / day. The administration may be anywhere from 1 to 4 times daily, e.g., once, twice, three times or four times daily. The maximum amount administered in a 24 hour period may be up to 1500 mg. The administration may be over a course of 2 to 30 days, e.g. , 3 to 21 days, such as 7, 10 or 14 days. The skilled person can adjust dosing depending on the subject's body weight and overall health condition and the purpose for administering the antibiotic. Repeated courses of treatment may be pursued depending on the response obtained.The compositions of the present invention may be administered to a subject by various routes. All modes of administration are contemplated, for example, orally, rectally, mucosally (e.g. , by oral or nasal inhalation), transmucosally, topically (transdermal), or by intravenous, intradermal, intramuscular, subcutaneous, intracutaneous, intrauterine, epidural or intracerebroventricular injection.Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in thespecification and claims are to be understood as being modified in all instances by the term "about." Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements.It is to be understood that wherever values and ranges are provided herein, all values and ranges encompassed by these values and ranges, are meant to be encompassed within the scope of the present invention. Moreover, all values that fall within these ranges, as well as the upper or lower limits of a range of values, are also contemplated by the present application.Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures, embodiments, claims, and examples described herein. Such equivalents were considered to be within the scope of this invention and covered by the claims appended hereto. For example, it should be understood, that modifications in reaction conditions, including but not limited to reaction times, reaction size / volume, and experimental reagents, such as solvents, catalysts, pressures, atmospheric conditions, e.g., nitrogen atmosphere, and reducing / oxidizing agents, with art- recognized alternatives and using no more than routine experimentation, are within the scope of the present application.The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventor(s) regard(s) as the invention. EXAMPLESThe invention is now described with reference to the following Examples. These Examples are provided for the purpose of illustration only, and the invention is not limited to these Examples, but rather encompasses all variations that are evident as a result of the teachings provided herein.Unless noted otherwise, the starting materials for the synthesis described herein were obtained from commercial sources or known synthetic procedures and were used without further purification.Animals:20-24 weeks old C57blk6J wild type male mice are used to investigate the acute effect of GLP1 analogues on improving glucose metabolism. Mice are fed with chow diet and housed individually for the length of study (up to 8 weeks). Mice are treated with GLP-1 analogues and submitted to a glucose tolerance test to assess treatment outcome.To detect statistically significant differences in the parameters to be measured, 10 mice are used per experimental condition and end point. The male mice are housed individually to avoid fighting during handling and study. Two cohorts of mice are used: a first cohort of 40 mice (4 experimental groups of 10 mice each) to determine dosing and time interval for action of reference product liraglutide, and a second cohort of 50 mice (5 experimental groups of 10 mice each) to determine the properties of new GLP-1 analogues.A total of 130 mice are used for the GLP2 studies. Five-week old male C57BL / 6J mice are allowed to acclimatize for one week prior to any experimentation. The animals are administered with GLP-2 analogues (experimental groups) or GATTEX® (control group). 4 doses of each compound are tested. Mice are euthanased at two time points after initiating the injections (6 or 10 days) to collect intestinal segments for histomorphometry analysis. Additional groups of animals (one group per each compound) undergo PET / CT imaging at various time points after the initiation of the injections. The animals are housed and maintained on a 12-h light-dark cycle (lights on at 07:00) in a ventilated facility with a steady ambient temperature ranging from 19 to 22 °C and humidity ranging from 40 to 60%.Assay for activity and stability:Cellular assays for receptor binding and intracellular signaling were carried out with the compounds of the invention. Briefly, HEK 293 cells were transiently transfected with cDNAs encoding (i) GLP-IR (or the empty expression vector), (ii) the CRE6x-LUC reporter gene (which senses cAMP production triggered by receptor stimulation), and (iii) β- galactosidase (as a control for transfection efficiency). After transfection for 24 h, cells were incubated with a peptide at various concentrations (or control / blank) in serum-free medium for 6 h. The cells were then lysed, SteadyLite reagent (PerkinElmer) is added, and luciferase activity is measured in a TopCount NXT HTS plate luminometer. After further incubation with a chromogenic substrate (2-nitrophenyl β-D-galactopyranoside), optical density at 420 nm is determined by spectrophotometry, as a control to correct for interwell transfection variability. Sigmoidal concentration-response curves of GLP-IR ligand activity is calculated to determine potency.Plotting concentration versus the luciferase activity yielded quantitative parameters for combined binding (potency) and signaling (efficacy) in a single step. Cells were stimulated with peptides, DPP4-treated and controls, for 4 hours. DPP4 treated peptides: 10 μΐ of 0.26mM peptide were incubated with 2 μΐ, DPP4 in buffer ± DMSO for 18hrs. Controlpeptides: 10 μΐ of 0.26mM peptide was added to buffer ± DMSO. The final DMSO concentration was the same for all peptides and all peptides were diluted to 0.26 mM concentrations for the DPP4 assay.Detection of peptide inactivation by DPP4:Compounds are incubated overnight at 37 °C in the presence of recombinant DPP4 or vehicle (TRIS buffer). The samples are then assessed in GLP-1R agonist assays. As DPP4 induced N-terminal cleavage of peptides result in virtually complete loss of function, the decrease in intact peptide is reflected in a corresponding potency loss (DPP4 vs. vehicle treated; e.g. 10-fold potency loss indicates 90% degradation). An example of this analysis is illustrated in FIG. 8. Complementary assessment is made by ESI LC-MS (as in FIG. 6) to detect potential minor degrees of DPP4 mediated hydrolysis that are difficult to detect by comparison of potency in functional assays.Example 1: Modified Glucagon Like Peptide 1 (GLP-1)As demonstrated herein, the invention provides a method of ameliorating, preventing or minimizing the proteolysis instability problem that is ubiquitous to peptides. Such methods comprises the preparation of novel polypeptides that are chemically modified.In certain embodiments, the modification comprises covalently attaching at least one 2,2,2-trifluoroethyl group to the N-terminal amino group, other free amino group, thiol group and / or thioether group in a polypeptide. Such modification may be achieved using various synthetic groups. In a non-limiting example, this chemical derivatization may be performed using a rapid and efficient fluoroalkylation reaction, which is demonstrated with two analogues of Glucagon Like Peptide 1 (GLP-1).GLP-1 synthesized by solid phase peptide synthesis was derivatized while resin- bound to yield the desired trifluoroethyl analogue, with equivalent ease and speed as the predictable and well-practiced acetylation of peptides. The N-acetyl analogue of GLP-1 was prepared as a control, besides GPL-1 itself. A bis-trifluoroethyl analogue of GLP-1 was also obtained. HPLC traces of native and modified GLP-1 variants are shown at FIG. 1. The chemistry involved in this modification is illustrated in FIG. 2.Two exemplary chemically modified peptides were synthesized, along with corresponding control polypeptides, using a single automated synthesis. The sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (GLP-1 7-36 amide) was prepared via solid-phase Fmoc-chemistry in an automated synthesizer. The solid support was MBHA- Rink amide resin, loading 0.35 mmol / gram. From 0.1 meq of resin (280 mg) were obtained 629 mg of resin carrying the crude GLP-1.Three 100-mg portions of derivatized resin, carrying in theory 0.016 mmol of GLP-1 each, were treated as follows:Portion 1: Deprotection with 20% piperidine in dimethylformamide (DMF); washing with DMF; washing with dichloromethane (DCM); cleavage with trifluoroacetic acid (TFA), triisopropylsilane (TIPS) and water (95 / 2.5 / 2.5); evaporation to small volume; and precipitation in ether gave after lyophilization 26 mg of crude GLP-1.Portion 2: Deprotection with 20% piperidine in DMF; washing with DMF; treatment with acetic anhydride (1.5 mL) and diisopropylethyl amine (DIEA, 0.15 mL) in DMF (10 mL); washing with DMF; washing with DCM; cleavage with TFA / TIPS / water 95 / 2.5 / 2.5; evaporation to small volume; and precipitation in ether gave after lyophilization 21 mg of crude N-Acetyl-GLP-1.Portion 3: Deprotection with 20% piperidine in DMF; washing with DMF; washing with DCM; adding phenyl(trifluoroethyl)iodonium triflimide la (9 mg, 0.016 mmol, in DCM, 2 mL) for 3 minutes; then adding collidine (10 mg, 0.08 mmol, in DCM, 4 mL) for 5 min; then washing with DMF; washing with DCM; cleavage with TFA / TIPS / water 95 / 2.5 / 2.5; evaporation to small volume; and precipitation in ether gave after lyophilization 30 mg of crude N-trifluoroethyl-GLP-1. This crude material contained 2,2,2-trifluoroethyl- GLP-1 (FIG. 4) as a major component and (bis-2,2,2-trifluoroethyl)-GLP-l as a minor component (according to ESI / MS).Each crude material was purified by HPLC. Analytical HPLC showed purities in excess of 96%. Retention times (Vydac 218TP104 C-18 column, 35-55% solvent B in solvent A over 20 minutes) were 9.6 min (GLP-1), 10.9 min (N-acetyl-GLP-1), 11.6 min (N- (2,2,2-trifluoroethyl)-GLP-l), and 13.4 min ((Na,Nn-Bis-2,2,2-trifluoroethyl)-GLP-l).ESI / MS data were consistent with pure compounds. Solvent A = 99% H20, 1% CH3CN, 0.1% TFA; Solvent B = 90% CH3CN, 10% H20, 0.07% TFA.Example 2: Sensitivity to DPP4Compounds were incubated overnight at 37 °C in the presence of recombinant DPP4 or vehicle (TRIS buffer, pH 8.0). The samples were then assessed in GLPIR agonist assays as described elsewhere herein. As DPP4 induced N-terminal cleavage of peptides result in virtually complete loss of function, the decrease in intact peptide was reflected in a corresponding potency loss (DPP4 vs. vehicle treated; e.g. , 10-fold potency loss indicates 90% degradation). Non-limiting examples are illustrated in FIG. 3. Complementary assessment can be made by ESI LC-MS to detect potential minor degrees of DPP4 mediated hydrolysis that may be difficult to detect by comparison of potency in functional assays.Table 2: Agonist potency and sensitivity to DPP4-mediated hydrolysis.Non-limiting constructs contemplated within the invention are illustrated in Scheme 1 (FIG. 6), wherein X represents a chemical modification contemplated within the invention:Scheme 1:GLP-1 (7-36) amide: X = H;GIP(l-42) acid: X = H;dual agonist: X = H, Lys40 is acyl C16 derivatized, Ala 2 and / or Ala 20 are independently optionally Aib;liraglutide = GLP(7-37) acid with residue 34 = Arg, residue 37 = glycine, and Lys26 isacylated with y-Glu-C16 acidAssessing the role of size and other molecular properties of residue modification:In order to establish the molecular parameters that best complement the receptor binding site (that may be elastic depending on the ligand), constructs are tested for various attributes such as size, hydrophobicity, charge, polarizability, stereochemistry and electronegativity. While the predicted p ^a values of appendages that were tolerated in GLP- 1 indicate that the positive charge is not essential, the native ligand is partially charged at physiological pH. Assuming that the attached groups are accommodated in the binding pocket, the electron withdrawing and donating nature of the substituent at the 4-position on the aryl ring of the N-benzyl derivative is varied to assess electronic factors.Photoaffinity probes for identifying the site of residue interaction with the receptor:The N-terminal regions of GLP-1 and related peptides that interact directly with their cognate receptors have eluded structural characterization using either crystallization or cross- linking approaches. A limitation to the latter is the lack of suitable photoaffinity probes with modifications of His7 that are compatible with GLP-1 binding to its receptor. To generate such tools, modest structural perturbation to the already characterized ligands that exhibitpotencies and efficacies similar to the native ligand is utilized. Thus, the para- trifluoromethyldiazirine benzyl derivative was prepared. This compound, while maintaining full agonist efficacy, was 123-fold less potent than GLP-1, presumably due to the steric bulk at the 4-position of the aryl group. The para-azido benzyl and the methyldiazirine ethyl derivatives are further prepared and studied. The photoactive groups diazirine and phenylazide are selected due to their spectral characteristics and their ability to rapidly insert into C-H bonds in close vicinity once reactive carbene or nitrene are generated. In certain embodiments, the polypeptide constructs are additionally equipped with another affinity tag (e.g. , biotin) coupled to Lys26, a site where attachments (e.g., lipidation in liraglutide) are well tolerated. After incubation with isolated cell membranes containing GLP1R and photocross-linking, the receptor-ligand complex is affinity purified, followed by digestion with proteases. The site of labeling is then identified by mass analysis, to be carried out either on gel by MALDI MS or by LC ESI-MS.The data presented herein demonstrates that a diverse range of modifications are accepted at the N-terminus of the ligand without compromising receptor agonism. At the same time, these alterations provide complete protection against hydrolytic action mediated by DPP4. Together, these findings open new opportunities to elucidate the structural determinants of receptor activation that may be applicable to other Class B GPCRs. Example 3: DPP4-resistant analoguesResistant analogs are shown at Fig. 6-10, 12,13, 14, 18, 19 and 21. DPP4-insensitive analogues of liraglutide, a palmitoylated form of GLP-1, are generated by derivatizing the His7 residue. Palmitoylation promotes peptide multimerization and enhances reversible serum albumin binding as mechanisms to partially protect liraglutide. The potential synergistic effects of His7 N-alkylation and lipidation in liraglutide are investigated. His7 modifications in a GLP-1 analogue with an alternative lipidation (compound "A6"), which may also enhance albumin binding, are also explored.In certain embodiments, the presently contemplated modifications of the terminal His7 in GLP-1 and analogues selectively abolish cleavage by DPP4 without compromising agonist activity. In other embodiments, the presently contemplated modifications of the terminal His7 in GLP-1 and analogues essentially maintain the native non-helical N-terminal conformation of GLP-1 and interactions with the receptor that are critical for affinity and agonist function. In yet other embodiments, the presently contemplated modifications of theterminal His7 in GLP-1 and analogues allow for exploring details of the GLP-1R ligand binding pocket vs. recognition by DPP4, and also enable fine-tuning the polypeptide to facilitate access to different biological compartments (e.g., mucosal uptake after oral or nasal application; crossing the blood brain barrier to potentially optimize drug-induced weight loss as future directions).As demonstrated herein, liraglutide is in fact quite extensively inactivated by DPP4. Assessment of active drug levels in serum by an improved sensitive bioassay presents a significant technological advance vs. conventional peptide-specific RIAs / ELISAs (as typically used in the industry, e.g. during drug development of liraglutide and exenatide). Whereas conventional sandwich immunoassays rely on specific antibodies that concomitantly detect a peptide's intact N- and C-termini, the present approach is universally applicable to new potent agonists regardless of structural modification.In vitro StudiesAs part of the structure-function analyses with native GLP-1, seven analogues with differential chemical attributes are engineered. His7 modifications are introduced in either liraglutide or an analogue with an alternative lipid moiety. Cell based assays are used to assess the potency and efficacy of these peptides at the GLP-1R. Parallel studies are used to quantify inactivation after prolonged exposure to DPP4 in vitro. Direct comparison is made with liraglutide. Potent / stable analogues may be selected for in vivo study.In vitro experiments confirmed that unmodified GLP-1 is highly susceptible to DPP4 degradation. After overnight incubation with the enzyme, apparent potency was >500-fold reduced, indicating more than 99.8% of the peptide was degraded / inactivated. Liraglutide, a lipidated GLP-1 analogue for use as a diabetes drug, isreported to be more DPP4 resistant but is still degraded by this enzyme in vivo. In fact, liraglutide was shown to suffer a >50-fold potency loss after incubation with DPP4, indicating that more than 98% of the peptide was degraded.His7 at the N-terminus of GLP-1 plays a crucial role in GLP-1R activation, but at the same time enables peptide recognition and degradation by DPP4. Modifications of His7 have been considered impractical for stabilizing GLP-1. Prior attempts to substitute or modify His7, e.g. by acetylation, provide DPP4 resistance but also lead to a major loss of agonist potency (FIG. 8, 9, and 9a). The present functional assays showed that this analogue had stability against DPP4, coupled with a ~50-fold potency loss of GLP-lb.However, as demonstrated herein, the present modifications of selectively enhance the stability of GLP-1 without disrupting its agonist function. Trifluoroethyl, isobutyl, or benzyl analogues caused barely detectable, and non-significant potency changes while conferring virtually complete DPP4 resistance.Further, trifluoroethylation did not affect liraglutide potency. Furthermore, this analogue showed complete resistance to DPP4 degradation. The remaining analogues contemplated within the invention may be evaluated for agonist activity and enzymatic stability using similar assays. Such analogues include liraglutide analogue "A6", which includes an alternative lipid moiety in position R2 that confers markedly higher albumin binding (lipid / 2). A6 is cleared as quickly as liraglutide, possibly due to remaining degradation of A6 by DPP4.Peptides are assembled via standard automated peptide synthesis using Fmoc chemistry. Lys26 is side chain-protected with an allyloxycarbonyl (alloc) group that can be selectively removed using PhSiH3and Pd(PPh3)4, and subsequently coupled to h or in position R2(FIG. 7) using established chemistry. The N-terminal modifications in position R1is introduced via reductive amination on the solid phase, using the corresponding aldehydes and NaBFL. In the case of the trifluoroethyl containing compounds (GLP-1 c, MG1 and MG4; FIG. 7), the histidine derivative is independently synthesized. The constructs are cleaved from the resin using CF3C02H:TIPS:H20 (95:2.5:2.5), purified using reversed-phase HPLC, and analyzed using ESI and MALDI-MS.In vivo StudiesIn one aspect, attenuation of blood glucose excursion by GLP-1 analogues was analyzed (FIG. 22A) . FIG. 21 provides a series of graphs showing that native GLP-2 is degraded by DPP4 whereas a trifluoroethyl decorated analog (GLP2-4) is completely resistant to degradation. Peptides were incubated with recombinant DPP4. Serial dilutions of GLP-2 and GLP2-4 were then applied to HEK293 cells, which had been transfected with cDNA encoding human GLP-2R and a cAMP-responsive reporter gene. DPP4 induced a >40-fold loss in GLP-2 potency, reflecting that >97% of peptide was degraded. In contrast, no potency loss was noted with GLP2-4. N=4, mean+SEM.Fig. 22A provides a graph comparing the time-dependent decrease of plasma drug activity after a bolus injection of either liraglutide or a CHCF3 -decorated derivative, Lira-4. Rats received a bolus injection of either drug via central catheter, followed by serial blood draws after indicated intervals and measurement of plasma drug activity by bioassay ofreceptor agonism. Potency of each peptide immediately following injection was defined as 100%. Plasma survival of liraglutide is extended by the CHCF3 modification of Lira-4.Fig. 22B demonstrates sustained hypoglycemic activity of Lira-4 following an oral glucose tolerance test. Mice received a s.c. injection of either vehicle, G-4, Liraglutide, or Lira-4 (represented from left to right in each group of bars). Half an hour and 5.5 hours later, two sequential oral glucose loads were applied by gavage. Blood glucose levels were measured just before drug injection (-30 minutes) and at indicated time intervals after the glucose loads. A single injection of compound G-4 attenuated glycemic excursion after the first glucose load, and still remained active to attenuate a second glucose challenge several hours later.Example 4: Modified Forms of GLP-2Enhanced DPP4 resistance may be achieved using a simple chemical modification of the amino terminus of GLP-2. In addition, a position in GLP-2 tolerates both an amino acid substitution (Leul7 to Lys) as well as palmitoylation without compromising activity. These modifications yield compound GLP-2 L17K [Ll-4] shown in FIG 6B, which comprises Asp 3→ Glu substitution as compared to GLP-2 (FIG. 6A). Lipidation generally increases binding to serum albumin. In certain embodiments, the GLP-2 analogues of the invention have improved protease resistance, reduced renal clearance, and improved pharmacokinetics over GLP-2 (FIG. 18). In other embodiments, the GLP-2 analogues of the invention can be used to treat diseases such as mucositis, radiation induced intestinal damage and Crohn's disease.As demonstrated herein, novel lipidated stable GLP-2 analogues are prepared by sequentially introducing different lipid anchors into stable GLP-2, wherein each replaces the palmitic acid in the prototype compound, GLP-2 L17K [Ll-4]. The corresponding ligands are compared with F-GLP2-palm GLP-2 L17K [Ll-4] as well as with GATTEX® using established in vitro cell based assays. Potency, efficacy, protease resistance, albumin binding, and oligomer formation are assessed and utilized to select compounds for in vivo studies. The intestinal growth promoting effects of the GLP-2 analogues is assessed, by administering the lipidated stable GLP-2 analogs and GATTEX® subcutaneously to mice. The efficacy of the peptides is evaluated using histomorphometric analyses including quantification of intestinal weight, villus height, and crypt depth. In addition, proliferation indices (Ki67 staining) and glucose uptake (PET scanning) is determined.F-GLP2-palm is a novel high potency (EC50= 44±13 pM (mean ± SEM, n=4), protease (DPP4) resistant, lipidated GLP-2 peptide analogue. A Leu to Lys substitution was made at position 17 (denoted as "K*") to facilitate conjugation of the lipid tail (palmitic acid, "CI 6") via a β- Alanine spacer. DPP4 resistance was conferred by introduction of a trifluoromethyl modified N-terminal histidine.Example 5: Modifications to the N-terminus of GLP-1.The following experiments address an ongoing challenge in the design of therapeutics based on agonism at the GLP-1 R: combining resistance to DPP4 with retention of potency and efficacy during receptor activation (See Table 3). The data established that the GLP- 1 / GLP-lR system is tolerant of a wide range of derivatives that exhibit both of the desired properties. First explore the structural space available for creation of GLP-1 analogs will be explored. A two-pronged approach is used to narrow the potentially large landscape of possible candidates (vide infra). The chemical decorations of the a-amine of His7, situated at the N-terminus of GLP-1, span a range of functionalities and sizes. From known SAR in the literature and the data presented herein, there are a few known requirements: (i) the presence of the methyl imidazole side chain of His7 is critical; (ii) N-acyl (including N-acetyl) derivatives result in poor potency and efficacy (iii) large polar appendages on the nitrogen are not tolerated (e.g. N-mannitol or N-glucitol). Nevertheless, the data demonstrate that a range of modifications, including charged groups at physiological pH are allowed. Here, the working model envisions a binding pocket on the receptor, proximal to the membrane-water interface that accommodates the chemical alterations made to histidine. The exact dimensions of this pocket and the precise functional makeup remain to be defined, however a GLP-1 R binding box with a volume of approximate 240 A3or slightly larger can be assumed (based on the activity of the N- methyl adamantly derivative G-10). To test this assumption, and to explore the nature of putative receptor-ligand interactions within this binding box, a library of 50 GLP-1 derivatives is prepared to explore criteria of size, hydrophobicity, charge, polarity, stereochemistry (G17-21) and polarizability. Exemplary GLP-1 derivatives are shown in FIG. 6A.Example 6: Chemical synthesis of conjugates.Peptides will be assembled via standard automated peptide synthesis using Fmoc chemistry. Lys26 in GLP-1 will be side chain-protected with an allyloxycarbonyl (alloc)group that can be selectively removed using PhSiH3and Pd(PPh3)4, and if required subsequently coupled to lipids using established chemistry. The N-terminal modifications ("X", FIG. 6A and 6B) will be introduced via reductive amination on the solid phase, using the corresponding aldehydes and NaBH4(89). In the case of the compounds containing fluoroalkyl (X = 4, 8, 9) and azido (X = 29, 32) functionalities, the histidine derivative is independently synthesized using previously reported procedures (90-95). The constructs will be cleaved from the resin using CF3C02H:TIPS:H20 (95:2.5:2.5), purified using reversed- phase HPLC, and analyzed using ESI and MALDI-MS. Example 7: Photoaffinity probes for identifying the site of His7 interaction in GLP-1 with the receptor.The N-terminal regions of GLP-1 and related peptides that interact directly with their cognate receptors have eluded structural characterization using crystallization or cross- linking approaches. A critical limitation to the latter is the lack of suitable photoaffinity probes with modifications of His7 that are compatible with GLP-1 binding to its receptor. To generate such tools, structural perturbations will be made to the ligands that exhibit potencies and efficacies similar to the native ligand. The compound G-22 while maintaining full efficacy showed markedly reduced potency compared to unmodified GLP-1, presumably due to the steric bulk at the 4-position of the aryl group (FIG. 6A). Agonist potency was conserved in photoprobe G-30 suggesting that the latter will recapitulate the interaction of unmodified GLP-1 with the receptor. To facilitate detection in cross-linking studies, further a biotin moiety may be attached to residue K26 in GLP-1. The data has shown that this addition does not affect GLP-1 affinity, consistent with the fact that the same residue is also used for acylation of liraglutide (FIG. 6A).Example 8: Assessing the role of size and other molecular properties of His7.In order to establish the molecular parameters that best complement the receptor binding site (that is likely to be elastic depending on the ligand), fifty constructs will be tested for various attributes such as size (G-23, G-24), hydrophobicity, charge (G-17, G-18, G-23, polarizability (G-4, G-5, G-12, G-l 1, G-27)), stereochemistry (G-17, G-18, G-20, G-21) and electronegativity (G-4, G-8, G-9). While the predicted pKavalues of appendages that were tolerated in GLP-1 indicate that the positive charge is not essential, the native ligand is partially charged at physiological pH. Assuming that the "X" groups are accommodated inthe binding pocket, the electron withdrawing and donating nature of the substituent will be varied at the 4-position on the aryl ring of the N-benzyl derivative [a total of 8 compounds ranging from the most electron withdrawing -ΝΟ2 (Hammett σ = 0.81) to the most electron donating -N(CH3)2(σ = -0.83)] . Plots of log(EC5o,x / EC5o,H) versus σχwill be used to determine the slope p (a measure of the equilibrium's sensitivity to substituents relative to benzoic acid dissociation) as a thermodynamically assessed parameter. The pKaof the examine is estimated to be 6.91 and can be altered in either direction depending on the identity of the X appendage.Table 3 and FIG 8: Agonist potency and sensitivity to DPP4-mediated hydrolysis.Example 9: Impact of alkylation on the stability and function of glucagon.The N-terminus of glucagon (His-Ser) is different than that of either GLP-1 (His-Ala) or GIP (Tyr-Ala). While the serine residue in the penultimate position of glucagon reduces DPP4 sensitivity of this peptide vs. either of the incretins, glucagon is still degraded by DPP4 and would benefit from N-terminal protection to extend its half life. The data has shown in experiments that attachment of a trifluoroethyl group affords complete DPP4 resistance of glucagon without compromising agonist potency (FIG.13 and Table 3). The glucagon receptor has recently been crystallized (albeit at limited resolution and including only part of the molecule), however there remains uncertainty how the N-terminus of glucagon fits with its cognate GPCR. Following the experimental design outlined for GIP, which of 30 selected N-terminal decorations are tolerated in glucagon receptor will be determined, enabling an initial profile comparison of the agonist pockets of all three glucagon-family peptides to be studied.Example 10- A novel strategy enables generation of GLP-2 and related peptides that are refractory to DPP4 degradation without compromising biological activity.The data indicated the conventional modification, an Ala2Gly substitution (as applied in Gattex), provides only partial DPP4 resistance (Table 4). It has been a major challenge to identify N terminal modifications that confer complete DPP4 resistance while maintaining receptor potency. To address this limitation, a broadly applicable strategy has been developed whereby the amino-terminal residue of corresponding peptides can be decorated with members of a large library of candidate moieties, thus eliminating DPP4 sensitivity. Providing proof of principle, the data has demonstrated that, while -97% of native GLP-2 is degraded by DPP4, decoration of His 1 with fluoroethyl confers complete enzymatic resistance (FIG. 21). In addition to conferring DPP4 resistance, the fluoroethyl and alternative decorations at the N-terminus of GLP-2 analogs provide a novel means to optimize stability and in vivo efficacy.FIG. 21 shows data indicating native GLP-2 is degraded by DPP4 whereas a trifluoroethyl decorated analog is resistant to degradation. Peptides were incubated with recombinant DPP4. Serial dilutions of GLP-2 and GLP-2-4 were then applied to HEK293 cells, transfected with cDNA encoding human GLP-2R and a cAMP -responsive reporter gene. DPP4 induced a >40-fold loss in GLP-2 potency, reflecting that >97% of peptide was degraded. In contrast, no potency loss was noted with GLP-2-4 (FIG. 6A). N=4, mean+SEMExample 11- Attachment of a lipid side chain to GLP-2, in combination with N terminal stabilization results in prolonged bioactivity.In addition to an N-terminal trifluoroethyl decoration, GLP2-L17K [Ll]-4 (FIG. 6A) also incorporates a lysine-bound lipid moiety as a strategy to enhance albumin binding, reduce renal clearance, and further prolong peptide retention in the plasma. The data has demonstrated by bioassay that GLP2-L17K [Ll]-4 is refractory to DPP4 degradation in vitro. The structure of GLP2-L17K [Ll]-4 is shown in FIG. 6A. To form GLP2-L17K [Ll]-4 , GLP-2 is modified by N-terminal trifluoroethyl decoration, Leul7Lys substitution, and attachment of CI 6 palmitate via a β- Alanine linker.In addition, the data demonstrated prolonged bioactivity of GLP2-L17K [LI] -4 (vsGattex); GLP2-L17K [Ll]-4 remains at high levels in the circulation 24 hours after subcutaneous (s.c.) injection in mice. The extended bioactivity of GLP2-L17K [LI] -4 vs. Gattex in vivo is shown in FIG. 23. Compounds (1.25μg) were injected s.c. in mice. Plasmawas collected after 24h and analyzed by luciferase reporter gene assay for GLP- 2R agonist activity.Example 12- Identification of two positions where Lys-conjugated lipids can be introduced into GLP-2.In GLP2-L17K [LI] -4 the amino acid at position 17 was identified as a site where lysine can be introduced (i.e. Leul7Lys) without disrupting potency or efficacy, thus providing a site for lipid conjugation to enhance pharmacokinetic properties as summarized above. An alternative position was also identified at position 24, where lysine substitution (Asn24Lys) and lipidation are well tolerated (FIG. 20). Since the biophysical and pharmacological properties of GLP-2 analogs are modulated by both, N terminal decoration and lipidation, identification of position 24 offers a means to generate additional GLP2-L17K [LI] -4 derivatives that may show further optimized in vivo efficacy. Compounds shown in FIG 6A were characterized in vitro by luciferase reporter gene assay and DPP4-induced potency shift as illustrated in FIG. 20 (n=3).Example 13- In vivo test showing GLP2-L17K [LI] -4 enhances intestinal and mucosal growth.After 5 daily subcutaneous (s.c.) injections in C57BL / 6J mice, a prototype compound GLP2-L17K [Ll]-4 increased intestinal weight in a dose dependent manner (FIG. 23A-23C). GLP2-L17K [Ll]-4 enhances intestinal weight.C57BL / 6J mice were injected s.c. once daily for five days with either vehicle, GLP2-L17K [Ll]-4 or Gattex at indicated doses. Animals were sacrificed on day 6, followed by measurement of intestinal weight. N=6 animals / group, Mean + / -SEM. *p < 0.05 vs. vehicle Furthermore, GLP2-L17K [Ll]-4 has a trophic effect on the intestinal mucosa, a predictor of efficacy in treating SBS (FIGs. 23B and 23C).C57BL / 6J mice were injected s.c. once daily for five days with either 25 μg of GLP2-L17K [Ll]-4 or vehicle. Animals were sacrificed on day 6.FIG.23B shows hematoxylin & eosin stain of mucosal sections. FIG. 23C shows quantification of villus height. N=6 animals / group, Mean + / -SEM. **p < 0.01 vs. vehicle.Example 14- Comparison of GLP-2 analog pharmacological properties.In vitro assays with transfected HEK293 cells expressing GLP-2R are used to pharmacologically characterize the synthetic GLP-2 analogs. Methodologies parallel thoseapplied for characterization of GLP2-L17K [Ll]-4 (to be assayed in parallel together with Gattex as points of reference). The following are tested: (i) Gas mediated signaling to determine potency and efficacy,and (ii) DPP4 resistance.HEK293 cells will be transiently transfected with cDNAs encoding the GLP-2R, a CRE luciferase reporter gene and a β-galactosidase construct (enabling normalization of transfection efficiency). Efficacy and potency of each peptide is determined as illustrated in FIG. 36A. DPP4 resistance is tested after an overnight incubation (16 hrs) in the presence vs. the absence of DPP4, receptor mediated function isassessed as shown in FIG. 21A. As a DPP4 susceptible control, parallel experiments is performed using GLP-2.Example 15- Comparison of GLP-2 analog plasma stability in mice.In addition to DPP4 resistance, many other parameters affect the pharmacokinetics and bioactivity of compounds in vivo (including digestion by other proteases, albumin binding / oligomerization, and renal filtration). The gradual decline of agonist activity in plasma after subcutaneous (s.c.) injection in mice is followed, mimicking the clinical route of Gattex administration and anticipating that the same mode of administration is used for second generation drugs. As illustrated in Fig. 23, 12.5 μg of either Gattex, GLP2-L17K[LI] -4 (controls), or each of the proposed 7 new derivatives, is injected s.c. into 6 week old male C57 / BL6 mice (3 animals / compound / time point). The mice are sacrificed after 24 or 72 hours, and plasma samples are collected. Bioactivity is measured using routine methods known in the art and described herein.Example 16- GLP-2 analog analysisFIGs. 23 A-C demonstrate that GLP2-L17K( / 7)-4 (alternatively named oTTx-88 in these figures) induces intestinal mucosal growth. C57BL / 6J mice were injected s.c. once daily for five days with either vehicle, GLP2-L17K( / 7)-4, or Gattex at indicated doses. Animals were sacrificed on day 6, followed by analysis of intestinal tissue.FIG. 23 A shows that GLP2-L17K( / 7)-4 (oTTx-88) enhances intestinal weight. N=6 animals / group, Mean + / -SEM. *p < 0.05 vs. vehicle.FIG. 23B provides images of histology performed with hematoxylin and eosin stain of mucosal sections.Example 17- GHRH Analogs (FIG. 6A)FIG. 19 provides a series of graphs comparing sensitivity of native GHRH vs.CHCF3-GHRH ("C2-GHRH", bottom panel, compound GH29-4 in Fig. 6) enzymatic degradation. Activity of these peptides, tested as fresh stock or after overnight (O / N) incubation either with or without DPP4, was measured by luciferase assay in cells expressing GHRH receptors (GHRHR). In contrast to native GHRH, the GH29-4 derivative is resistant to enzyme induced potency loss (no rightward shift of concentration-response curve). GHRH analogs are useful to treat growth failure due to growth hormone deficiency (GHD), Growth failure in girls due to gonadal dysgenesis (Turner syndrome), Growth retardation in prepubertal children due to chronic renal disease, Growth disturbance (current height SDS < - 2.5 and parental adjusted height SDS < -1) in short children bom small for gestational age (SGA), with a birth weight and / or length below -2 SD, who failed to show catch-up growth (HV SDS < 0 during the last year) by 4 years of age or later. Example 18- Helical wheel diagram of GLP2 shows spatial identity and orientation of amino acid residues suitable for lipidation.To determine possible locations for lipidation, alanine mutagenesis data was analyzed in conjunction with expected GLP-2 and GLP-2R interaction data. From NMR data, GLP-2 appears to have an alpha helical secondary structure between residues Phe6 and Ile27 in water solvent system and between residues Phe6 and Arg24 in a micelle system. At the C- terminus there is a loose helical segment, whereas the N-terminus to Ser6 is completely unstructured.35 As the majority of the GLP-2 structure is a-helical, a helical wheel diagram was constructed to visualize the locations and properties of the residues (FIG. 20). The amino acid sequence is plotted around the helical axis, with each amino acid 100°from the last due to the secondary structure with 3.6 amino acids per helical turn. The properties of each residue are indicated by color to allow determination of patterns.By using the known GLP-1R extracellular domain surface interactions with GLP-1 and comparing the helical wheel diagrams of GLP-1 and GLP-2, an extracellular domain surface of GLP-2R could be approximated. This is correlated with the NMR observations that the GLP-2 binding interface occurs between Leul7 and Lys30, the hydrophobic face of the helix.35 Hydrogen bonds likely form between Asp21 and Lys30 of GLP-2 and the ECD of GLP-2R residues Thr72, AsplOl, and Aspl51.35 In addition, exposure of Leul7, Alal8, Alal9, Phe22, Ile23, Trp25, 1127, and Thr29 may allow hydrophobic interactions betweenGLP-2 and GLP-2R.35 Mutagenesis of Leul7 to Ala showed no decrease in GLP-2R binding but a decrease in GLP-2R activation.45 However, acylation at this position after a mutation to lysine proved to maintain potency.45, 167 In specific, GLP-2 with a Leul7Lys modification and with a β-alanine linker and palmitic acid attached to the ε-amine had similar potency to native GLP-2 as measured by a luciferase assay.167 Thus, the first location for acylation of GLP-2 was performed at the 17th residue after a L17K modification. Arg24 was also of interest for acylation after modification to lysine as it resides on the helical face away from the ECD of GLP-2R and does not significantly affect binding or potency of GLP-2.Various analogs of GLP-2 can be produced with acylation at the 17th position with different linkers and lipids. The hydrophobic nature of GLP-2 limits its solubility in water, which is not improved by the β-alanine linker in the original construct. To improve solubility in the future, 2 Oligo Ethylene Glycol (OEG) linkers and the γ-glutamic acid may be adopted. From the studies of semaglutide, this modification will also improve albumin binding. The goal is optimization of the equilibrium between the serum albumin and GLP-2R to allow better circulation and durability, exploration of other lipids is entailed.Example 19: Analog StabilityAnalogs of the invention are resistant to a variety of proteases. FIG. 18 provides a series of graphs comparing sensitivity of GLP-1 (left panel) vs. CHCF3-GLP-1 (right panel; G-4 in Fig. 6) to enzymatic degradation. Activity of these peptides, after overnight incubation without enzyme (control) or with either DPP4, DPP9, or FAP, was measured by luciferase assay in cells expressing GLP-1 receptors. In contrast to unmodified GLP-1, the G-4 derivative is resistant to enzyme induced potency loss (no rightward shift ofconcentration-response curve).Not only are analogs of the invention resistant to proteases in vitro, but also demonstrate resistance in vivo relative to liraglutide. Fig. 22 provides a graph comparing the time-dependent decrease of plasma drug activity after a bolus injection of either liraglutide or a CHCF3-decorated derivative, Lira-4.Rats received a bolus injection of either drug via central catheter, followed by serial blood draws after indicated intervals and measurement of plasma drug activity by bioassay of receptor agonism. Potency of each peptide immediately following injection was defined as 100%. Plasma survival of liraglutide is extended by the CHCF3 modification of Lira-4.Fig. 22A demonstrates sustained hypoglycemic activity of Lira-4 following an oral glucose tolerance test. Mice received a s.c. injection of either vehicle, G-4, Liraglutide, or Lira-4 (represented from left to right in each group of bars). Half an hour and 5.5 hours later, two sequential oral glucose loads were applied by gavage. Blood glucose levels were measured just before drug injection (-30 minutes) and at indicated time intervals after the glucose loads. A single injection of compound G-4 attenuated glycemic excursion after the first glucose load, and still remained active to attenuate a second glucose challenge several hours later.FIG. 23A provides a graph demonstrating extended bioactivity in vivo of GLP2- L17K( / 7)-4, a fluorinated / acylated GLP-2 analogue shown in Fig. 6A. Clearance of this compound was compared to that of Gattex, an established GLP-2 based drug, Compounds (1.25μg) were injected subcutaneously (s.c.) in mice. Plasma was collected after 24h and analyzed by luciferase reporter gene assay for GLP-2R agonist activity.The results described herein above, were obtained using the following methods and materials.In vitro StudiesDifferent lipid anchors are sequentially introduced into the prototype compound, F- GLP2-palm, each replacing palmitic acid. The corresponding compounds arepharmacologically characterized and compared with F-GLP2-palm and GATTEX®. In certain embodiments, lipidation can influence potency, efficacy, albumin binding, interaction with cells, oligomer formation, and protease resistance. Exemplary lipids contemplated within the invention include myristic acid, stearic acid, palmitoleic acid, oleic acid, and linoleic acid. Because of cis unsaturation in the chains, these lipids have higher two- dimensional diffusional rates within membranes and a faster koii in their binding to albumin and cell membranes.All methodologies to generate these lipidated peptides and to modify histidine are well established in theIn vitro assays using transfected HEK293 cells expressing GLP-2R are used to pharmacologically characterize the synthetic lapidated constructs. As a point of reference, assays include the prototype lipidated stable GLP-2 analog (F-GLP2-palm).Gas signaling to assess potency and efficacy: HEK293 cells are transiently transfected with cDNAs encoding the GLP-2R, a CRE luciferase reporter gene and a a-galactosidase construct (enabling normalization of transfection efficiency). Efficacy and potency of each lipidated peptide is determined.Wash resistant activity / albumin binding: Lipidated peptides are in equilibrium between binding to cell membranes and to circulating proteins (e.g. albumin). The success of liraglutide as a drug is in part attributed to its ability to bind to albumin thus favorably altering multiple pharmacological parameters. Work with GPCR peptide ligand, protease resistant chemerin ("stable chemerin") was done to establish a sensitive assay reflecting the equilibrium between cell membranes and albumin (FIG. 11). The studies allowed for assessing how lipidation of the ligand and / or the presence of albumin in the medium alters binding equilibria to cells (receptor mediated signaling is utilized as an index of ligand availability; FIG. 12). With stable chemerin (not lipidated), washing after addition of ligand markedly reduced activity (FIG. 12, Panel A). With lipidated stable chemerin (no albumin in the medium), activity persisted despite washing reflecting membrane anchoring (FIG. 12, Panel B). With lipidated stable chemerin and albumin in the medium, washing tended to decrease activity (FIG. 12, Panel C) reflecting lapidated ligand binding to albumin and resulting in loss of ligand with washing (and a subsequent decrease in signaling). For this method, CMKLR1 expressing cells were incubated with ligand for 4 hours. A luciferase reporter gene assay was used to monitor God coupled second messenger signaling. "Wash": 15 minutes after addition of ligand, cells were washed three times. Following an additional 4-hour incubation, luciferase activity was determined. For albumin interaction studies physiological concentrations of albumin (4.5g / dL) were dissolved in cell culture medium. This assay provides a sensitive index of how a lipidated peptide equilibrates between cell membranes and albumin.DPP 4 resistance (FIG. 13): Lipidated peptides are compared with the prototype, F- GLP2-palm. After an overnight incubation (16 hrs) in the presence vs. the absence of DPP4, receptor mediated function is assessed as shown elsewhere herein. As a DPP4 susceptible control, parallel experiments are done using GLP-2. As for DPP4 assays, F-GLP2-palm and native GLP-2 (81 μΜ) were preincubated with or without DPP4 (27.5 μg / ml) overnight at 37°C. Following overnight preincubation, serial dilutions of ligands were prepared and added to GLP-2R expressing cells for 4 hours. A luciferase reporter gene assay was used to monitor Gas coupled second messenger signaling.Multimer formation: Lipidated stable GLP-2 may be administered subcutaneously. Lipidated GLP-1 (liraglutide) forms heptamers that enable slow absorption. To examine thisfeature in the lipidated GLP-2 analogs, analytical sedimentation equilibrium studies are run to determine the apparent molecular weight in solution. The compounds are examined in the 5- 100 μΜ range on a Beckman XL-I analytical ultracentrifuge at three different rotor speeds. Equilibrium is judged to be complete when successive absorbance scans are superimposable. The presence of tryptophan allows monitoring at 275 nm. The data is fit to a single ideal species model; if required, other equilibria (e.g. monomer→ ft-mer) may be included.Interspecies differences: In acknowledgement that species differences can potentially alter receptor mediated function, lipidated stable GLP-2 analogues are tested on both mouse and human receptors.In vivo StudiesTo assess the intestinal growth promoting effects of GLP-2 compounds, the lipidated stable GLP-2 analogs are administered subcutaneously to mice. Histomorphometric analyses, proliferation indices and functional assessment of the intestine are assessed, in comparison to GATTEX®.Administration of GLP-2 leads to intestinal proliferation, expansion of the mucosal epithelial surface and enhanced nutrient absorption. Multiple rodent models have been utilized to assess the impact of GLP-2, GATTEX®, and other GLP-2 analogs on the gastrointestinal tract. One model that is highly informative yet straightforward involves twice daily administration of GLP-2 or a stable analog to wild type mice. Corresponding experiments with GLP-2 were done over a ten day period, given twice daily. A significant increase in small bowel weight was seen after 6 days. Daily administration of GATTEX® to mice also showed a significant increase in both large and small bowel weights (normalized to body weight). Additional parameters which were increased with GLP-2 analogs included epithelial height of the small intestine (crypt plus villus height) and the proliferative index, particularly in the lower portion of the villus. Utilization of a mouse model enables the direct comparison of the physiological effects of the lipidated stable GLP-2 analogs withGATTEX®.Histomorphometric / proliferation indices. A group of seven C57 / B6 mice is studied for each condition (drug / time point). Compounds are administered twice daily at 12 hour intervals for 6 days and for 10 days, as a 100 μΐ subcutaneous injection. Initial dosing is adjusted to correspond to 25 μg of GATTEX® (mole equivalent), which is highly effective in triggering intestinal growth at 6 days. The 10 day time point defines the maximal effect. Mice are then euthanized and weighed. Small and large intestines are removed, flushed withPBS, and length / wet weights of the intestinal segments recorded. Multiple well established indices are used to assess in vivo efficacy of the GLP-2 analogs under study.Histomorphometric analyses (FIG. 14) includes quantification of intestinal weight / thickness, villus height, and crypt depth. Proliferation indices include Ki67 staining and mitotic indices (FIG. 15).To assess duration of drug activity, over a six day period each drug (two lipidated GLP-2 analogs and GATTEX® as a control) is given SC to three groups of 7 mice. Group one receives daily administration (six doses), group two receives drug every two days (3 doses), and group three receives drug every three days (2 doses). Animals are sacrificed and analyzed.The changes in the intestinal metabolic function in response to the stabilized lipidated GLP-2 analog are determined using positron emission tomography (PET) along with 2- deoxy-2[18F]-D-glucose, "[18F]FDG" as a tracer. The dosing schedule of the GLP-2 analogues are selected based on histomorphometric analysis. Overnight fasted mice are administered 2 mCi / kg of [18F]FDG via tail vein injection. Fifty minutes post injection, the mice are anesthetized with isoflurane and imaged using a microPET Focus 220 scanner (Siemens Medical Solutions USA, Inc., Malvern, PA), followed by a whole-body CT scan (portable CereTom CT scanner; NeuroLogica Inc., Danvers, MA). The PET and CT images are superimposed to accurately calculate the FDG uptake of each intestinal section. Direct comparison is made with GATTEX®.Depending on the potency of the drug, there is a possibility that PET does not provide adequate resolution. If this situation arises, biodistribution is used instead of PET imaging. In biodistribution studies, following the administration of FDG (using a method similar to that described for PETimaging), the mice are euthanized and intestinal segments are collected, weighed, and quickly transferred to a γ-counter to measure radioactivity. [18F]FDG tissue uptake levels are expressed as a percentage of injected dose per gram of tissue.There is a distinction between promoting healthy epithelial regeneration, and accelerating growth of early stage adenomas or cancer. In the animal studies, histological sections are examined for abnormal growth.The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety.While the invention has been disclosed with reference to specific embodiments, it is apparent that other embodiments and variations of this invention may be devised by othersskilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such embodiments and equivalent variations.
Claims
CLAIMSWhat is claimed:
1. A chemically modified polypeptide, or a salt or solvate thereof, wherein the polypeptide has at least one of the following chemical modifications:(i) at least one selected from the group consisting of an N-terminus amino group, the NH of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide is independently derivatized with optionally substituted C1-C16alkyl, optionally substituted C3-C16cycloalkyl, optionally substituted C3- Ci6 aryl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl; and(ii) the NH group of at least one selected from the group consisting of the N- terminus amino group and the N-terminus first internal amide bond is derivatized with X, wherein each X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR2)i_6-phenyl, -→0, -OH, - OR, aikoxy, NH2, optionally substituted NHfCj -C-.e alkyl) and optionally substituted N(C Ci6alkyl)(Ci-Ci6alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted C1-C 16 alkyl;wherein the chemically modified polypeptide has essentially the same biological activity and / or is more resistant to proteolytic degradation, as compared to the corresponding non- chemically modified polypeptide.
2. The chemically modified polypeptide of claim 1, wherein the proteolysis is catalyzed by at least one selected from the group consisting of Acyl Peptide Hydrolase, DPP4, DPP2, DPP8, DPP9, Fibroblast Activation Protein (FAP), an S9B family oligopropyl peptidase and a protease with > 50% homology to DPP4 and / or DPP2.
3. The chemically modified polypeptide of claim 1 , wherein the non-chemically modified polypeptide comprises an incretin.
4. The chemically modified polypeptide of claim 1, which has greater serum stability as compared to the corresponding non-chemically modified polypeptide.
5. The chemically modified polypeptide of claim 1, which has longer in vivo half-life as compared to the corresponding non-chemically modified polypeptide.
6. The chemically modified polypeptide of claim 1, which has greater blood-brain barrier permeability or greater oral bioavailability as compared to the corresponding non- chemically modified polypeptide.
7. The chemically modified polypeptide of claim 1, wherein in (i) the polypeptide is derivatized with at least one non-substituted C1-C6 alkyl, non-substituted C3-C 16 cycloalkyl, non-substituted C2-C16 alkenyl, non-substituted aryl, or non-substituted C2-C16 alkynyl.
8. The chemically modified polypeptide of claim 1, wherein in (i) one or more of the N- terminus amino group, other free amino group and / or thiol group of the polypeptide is independently derivatized with a first substituent and a second substituent independently selected from the group consisting of optionally substituted C1-C16 alkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16 alkynyl, wherein the first substituent and the second substituent are independently identical or not identical.
9. The chemically modified polypeptide of claim 1 , wherein in (i) the N-terminus amino group is derivatized with a first substituent and a second substituent independently selected from the group consisting of optionally substituted C1-C16 alkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16alkynyl, wherein the first substituent and the second substituent are independently identical or not identical.
10. The chemically modified polypeptide of claim 1, wherein in (i) the alkyl, cycloalkyl, alkenyl or alkynyl group is independently substituted with at least one independently selected from the group consisting of C1-C16 alkyl, C3-C 16 cycloalkyl, C2-C16alkenyl, C2-C16alkynyl, heteroaryl, heterocyclyl, C1-C6 alkoxy, azido, diaziryl N¾;-CHO, l,3-dioxol-2-yl, halo, haloalkyl, haloalkoxy, cyano, nitro, triflyl, mesyl, tosyl, heterocyclyl, aryl, heteroaryl, -SR, -alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR, -alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and - P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C16 alkyl.1 1. The chemically modified polypeptide of claim 10, wherein the alkyl group is halogenated C cie alkyl.
12. The chemically modified polypeptide of claim 11, wherein the alkyl group is 2,2,2,- trifluoroethyl.
13. The chemically modified polypeptide of claim 1, wherein at least one alkyl, cycloalkyl. alkem , aryl, or alkynyl group is selected from the group consisting of:wherein n is an integer ranging from 1 to 6, and R is hydrogen or an optionally substituted alkyl or aryl.
14. The chemically modified polypeptide of claim 1, wherein at least one alkyl, cycloalkyl, alkenyl or alkynyl group is selected from the group consisting of 2,2,2-trifluoro- 1-ethyl, 2,2,3, 3,3-pentafluoro-l -propyl, 2,2,3,3,4,4,4-heptafluoro-l -butyl, ethyl, isopropyl, benzyl, substituted benzyl, adamant- 1-yl-methyl, quinolin-4-yl-methyl, 2-amino-l -propyl, 4- phenyl-benzyl, lH-imidazol-4-yl-methyl, 4-hydroxy-benzyl, 4-[3-(trifluoromethyl)-3H- diazirine] -benzyl, and (8R,9R, 13S, 14R)-3, 17-dihydroxy-13-methyl- 7,8,9, 1 1 , 12, 13, 14, 15, 16, 17-decahy dro-6H-cy clopenta[a]phenanthren- 17-yl-ethynyl-methyl.
15. The chemically modified polypeptide of claim 1, wherein the polypeptide is chemically modified with a group that occupies a volume equal to or lower than about 240A3.
16. The chemically modified polypeptide of claim 15 wherein the polypeptide is chemically modified at the N-terminus amino group with a group that occupies a volume equal to or lower than about 190 A3.
17. The chemically modified polypeptide of claim 1, wherein the polypeptide comprises from about 3 to about 100 amino acids.
18. The chemically modified polypeptide of claim 1, wherein the polypeptide comprises from about 3 to about 49 amino acids.
19. The chemically modified polypeptide of claim 1, wherein the polypeptide comprises from about 80 to about 100 amino acids.
20. The chemically modified polypeptide of claim 1, wherein at least the N-terminus amino group is derivatized with an optionally substituted C1-C 16 alkyl, optionally substituted C3-C 16 cycloalkyl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl.
21. The chemically modified polypeptide of claim 1, which comprises at least one amino acid residue selected from the group consisting of:
22. The chemically modified polypeptide of claim 1, wherein the polypeptide is selected from the group consisting of:GLP-1 (H* AEGTFTS *D VS * S * YLEGQ AAK*EFIAWLVK* GR);Exenatide (H*GEGT*FT*S*DLS*KQM*EEEAVRLFIEWLK*NGGPS*S*GAPPPS*-NH2); Liraglutide (H*AEGT*FT*S*DVS*S*Y*LEGQAA-(N6-Palmitoylglutamyl)K*EFIAWLVRGRG);Semaglutide (H*AibEGT*FT*S*DVS*S*Y*LEG Xattached to the ε-amino group of lysine is:Taspoglutide (H*AibEGT*FT*S*DVS*S*YLEGQAAK*EFIAWLVK*AibR-NH2);Lixisenatide(H*GEGT*FT*S*DLS*K*QM*EEEAVRLFIEWLK*NGGPS*S*GAPPS*K*K*K*K*K*K*-NH2);Triagonist (H*AibQGT*FT*S*D-(y-E-Ci6acy 1)KS *K* YLDERAAQDFVQWLLDGGP S * S * GAPPPS *-NH2);Exendin (H*GEGTFTS*DLS*KQMEEEAVRLFIEWLK*NGGPS*S*GAPPPS);VIP (H*S*DAVFTDNYTRLRK*QMAVK*K*YLNS*ILN);PACAP (H*S*DGIFTDS*YS*RYRK*QMAVK*K*YLAAVLGK*RYKQRVK*NK*); GIP (Y*AEGTFIS*DYS*IAMDK*IHQQDFVNWLLAQK*GK*K*NDWK*HNITQ); Met-Enkephalin (Y*GGFM);BNP (Y*PSKPDNPGEDAPAEDMARYYS*ALRHYINLITRQRY);Substance P (R*PK*PQQFFGLM);Tyr-MIF-1 (Y*LG);Tyr-W-MIF-1 (Y*PWG);glucagon (H*SQGTFTSDYSKYLDSRRAQDFVQWLMNT);Growth Hormone Releasing Hormone (GHRH);Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) ADCYAP1;Glucagon (GCG);Gastric Inhibitory Polypeptide (GIP);Secretin (SCT);Vasoactive Intestinal Peptid (VIP);OXM (oxyntomodulin);PTH (Parathyroid hormone);Peptide YY3-36 and Peptide YY1-36 (PYY);NPY (Neuropeptide Y);VIP peptide (Vasoactive intestinal peptide);Dual agonists for at least one selected from the group consisting of GLP-1 + GIP; GLP-1 + amylin; GLP-1 + gastrin; GLP-1 + estrogen; GLP-1 + PYY, GLP-1 + cholecystin kinase (CCK);Dual agonists for GLP-1 R + glucagon receptor;Mixed agonists;Albiglutide;Dulaglutide;Other GLP-1R agonists;Amylin;Other substrates of DPP4, DPP2 and / or a protease with > 50% homology to DPP4 and / or DPP2;GLP-1 analogues stabilized by other modifications;or a sequence with at least 75% identity to any of these sequences,wherein at least one of the residues marked with * is alkylated or acylated with R.
23. The chemically modified polypeptide of claim 1, wherein the polypeptide's half-life is increased by at least 10-fold relative to the corresponding non-chemically modified polypeptide.
24. The chemically modified polypeptide of claim 1, wherein the modified peptide retains at least about 5% of the biological activity of the corresponding non-chemically modified polypeptide.
25. A chemically modified polypeptide selected from the group consisting parathyroid hormone (PTH), PYY3-36, cholecystokinin, PYY1-36, corticotropin releasing hormone receptor 1 or 2, growth hormone releasing factor, glucagon, Exendin, GLP-1, gastric inhibitory peptide, Liraglutide, prealbumin, peptide HI-27, PACAP, secretin, and vasoactive intestinal peptide (VIP),wherein the N-terminus amino group is derivatized with (i) one selected from the group consisting of optionally substituted C1-C16alkyl, optionally substituted C3-C16cycloalkyl, optionally substituted C2-C16alkenyl and optionally substituted C2-C16alkynyl, or (ii) one selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl,→0, -OH, aikoxy, NH2, NH(Cj-C] 6 alkyl) and N(Ci-Ci6alkyi)(Ci-Ci6alkyl),wherein the derivatization stabilizes the polypeptide against degradation by at least one selected from the group consisting of Acylamino-acid-releasing enzyme, DPP4, DPP2, DPP8, DPP9, all S9B family Oligopropyl peptidases and a protease with > 50% homology to DPP4 and / or DPP2, without reducing the polypeptide's biological activity relative to the corresponding non-chemically modified protein.
26. A pharmaceutically acceptable composition comprising at least one polypeptide of any of claims 1-25.
27. A method of treating or preventing at least one disease or disorder comprising administering at least one polypeptide of any of claims 1-25, wherein the disease or disorder is selected from the group consisting of short bowel syndrome, Non- Alcoholic steatohepatitis, smoking cessation, neurodegeneration, Alzheimer's disease, Parkinson's disease, congenital hyperinsulism, hypoglycemia, diabetes, weight gain, obesity, and metabolic syndrome.
28. A method of increasing the in vivo half-life of a polypeptide as compared to the corresponding non-chemically modified polypeptide, wherein the method comprises at least one the following chemical modifications:(i) chemically modifying at least one substituent selected from the group consisting of an N-terminus amino group, the NH group of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of thepolypeptide, wherein each chemical modification independently comprises derivatizing the substituent with an optionally substituted C1-C16 alkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C3-C16 aryl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl, and(ii) chemically modifying at least one substituent selected from the N-terminus amino group and the NH of the independently comprises derivatizing the substituent with the group X, wherein each occurrence of X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR2)i- „ phenvl . -→0, -OH, alkoxy, NH2, NH(Cr-C16alkyl) and N(C Ci6alky])(Ci-Ci6alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted (· ; ·(· ]., alkyl.
29. A method of improving the blood-brain barrier permeability or oral bioavailability of a polypeptide as compared to the corresponding non-chemically modified polypeptide, wherein the method comprises at least one the following chemical modifications:(i) chemically modifying at least one substituent selected from the group consisting of an N-terminus amino group, the NH group of the N-terminus first internal amide bond, other free primary amino group, thiol group and thioether group of the polypeptide, wherein each chemical modification independently comprises derivatizing the substituent with an optionally substituted C1-C16 alkyl, optionally substituted C3-C16 cycloalkyl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl, and(ii) chemically modifying at least one substituent selected from the N-terminus amino group and the NH of the independently comprises derivatizing the substituent with the group X, wherein each occurrence of X is independently selected from the group consisting of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR?)i_ 6-phenyi,→0, -OH, alkoxy, M l , M HOC*,., alkyl) and N(C C16alkyl)(Ci-C16alkyl), where R is independently selected at each occurrence from hydrogen or optionally substituted Cj-C i6 alkyl.
30. The method of any one of claims 27-29, wherein in (i) the polypeptide is derivatized with at least one non-substituted C1-C6 alkyl, non-substituted C3-C 16 cycloalkyl, non- substituted C2-C16 alkenyl or non-substituted C2-C16 alkynyl.
31. The method of any one of claims 27-29, wherein in (i) the alkyl, cycloalkyl, alkenyl or alkynyl group is independently substituted with at least one independently selected from the group consisting of C1-C16 alkyl, C3-C16 cycloalkyl C2-C16 alkenyl, C2-C16 alkynyl, heteroaryl, heterocyclyl, C1-C6 alkoxy, azido, diaziryl, -CHO, l,3-dioxol-2-yl, halo, haloalkyl, haloalkoxy, cyano, nitro, triflyl, mesyl, tosyl, heterocyclyl, aryl, heteroaryl of optionally substituted phenyl, optionally substituted benzyl, optionally substituted -(CR2)1-6- phenyl, -SR, -S(=0)(Ci-C6alkyl), -S(=0)2(Ci-C6alkyl), -S(=0)2NRR, -C(=0)R, -OC(=0)R, -C(=0)OR,alkyl), -NRR, -C(=0)NRR, -N(R)C(=0)R, -C(=NR)NRR, and -P(=0)(OR)2, wherein each occurrence of R is independently H or C1-C 16 alkyl.
32. The method of any one of claims 33-36, wherein the alkyl group is halogenated C1-C6 alkyl.
33. The method of any one of claims 33-36, wherein the alkyl group is 2,2,2,- trifluoroethyl.
34. The method of any one of claims 33-36, wherein the at least one alkyl, cycloalkyl, alkenyl or alkynyl group is selected from the group consisting of:wherein n is an integer ranging from 1 to 6, and R is an optionally substituted alkyl or optionally substituted aryl.
35. The method of any one of claims 27-29, wherein at least one alkyl, cycloalkyl, alkenyl or alkynyl group is selected from the group consisting of 2,2,2-trifluoro-l -ethyl,2,2,3,3, 3-pentafluoro-l -propyl, 2,2,3,3,4,4,4-heptafluoro-l -butyl, ethyl, isopropyl, benzyl, substituted benzyl, adamant- 1-yl-methyl, quinolin-4-yl-methyl, 2-amino-l -propyl, 4-phenyl- benzyl, lH-imidazol-4-yl-methyl, 4-hydroxy-benzyl, 4-[3-(trifluoromethyl)-3H-diazirine]- benzyl, and (8R,9R,13S, 14R)-3, 17-dihydroxy-13-methyl-7,8,9, l 1, 12, 13, 14,15,16, 17- decahydro-6H-cyclopenta[a]phenanthren-17-yl-ethynyl-methyl.The method of any one claims 27-29, wherein the polypeptide is chemically modified with a group that occupies a volume equal to or lower than about 240 A3.
37. The method of any one claims 27-29, wherein the polypeptide is chemically modified at the N-terminus amino group with a group that occupies a volume equal to or lower than about 240 A3.
38. The method of any one of claims 27-29, wherein the polypeptide comprises from about 5 to about 100 amino acids.
39. The method of any one of claims 27-29, wherein the polypeptide comprises from about 3 to about 49 amino acids.
40. The method of any one of claims 27-29, wherein the polypeptide comprises from about 80 to about 100 amino acids.
41. The method of any one of claims 27-29,, wherein at least the N-terminus amino group is derivatized with an optionally substituted C1-C16 alkyl, optionally substituted C3-C 16 cycloalkyl, optionally substituted C2-C16 alkenyl or optionally substituted C2-C16 alkynyl.
42. The method of any one of claims 27-29, wherein the polypeptide comprises at least one amino acid residue selected from the group consisting of:
43. The method of any one of claims 27-29, wherein the polypeptide comprises a d44. A method of derivatizing a polypeptide that comprises a free amino group, the method comprising contacting the derivatized amino acid of claim 43 with the polypeptide under conditions under which the free carboxylic acid of the derivatized amino acid forms an amide bond with the free amino acid of the polypeptide.
45. A method of imaging a cell or tissue in a subject, the method comprisingadministering to the subject in need thereof an effective amount of a polypeptide of any one of claims 1-26, wherein the polypeptide is labeled with a detectable isotope and / or conjugated to a detectable label.
46. The method of claim 45, wherein the detectable label comprises a chromophore, a fluorescent group, a bioluminescent group, a chemiluminescent group or a radioactive group.
47. A method for characterizing a gastrinoma in a subject, the method comprising administering to the subject a chemically modified secretin polypeptide of claim 24, and detecting an increase in gastrin in the subject, thereby characterizing the presence or absence of a gastrinoma in the subject.
48. The chemically modified polypeptide of claim 1 , wherein the modification increases binding to a plasma component.
49. The chemically modified polypeptide of claim 48, wherein the plasma component is Vitamin D3 binding protein, Albumin or Transthyretin.
50. The chemically modified polypeptide of claim 48, wherein the polypeptide is not GLP2.
51. The chemically modified polypeptide according to claim 1, wherein the polypeptide comprises a derivatized amino acid, a salt or solvate thereof having the structure: