Multi-domain molecules
Patent Information
- Authority / Receiving Office
- IL · IL
- Patent Type
- Applications
- Current Assignee / Owner
- IMMUNOCORE LTD
- Filing Date
- 2025-01-03
- Publication Date
- 2026-08-01
AI Technical Summary
Current treatments for autoimmune diseases like atopic dermatitis are systemic, leading to undesirable side effects and limited efficacy due to the systemic nature of immune checkpoint inhibitors, and there is a need for localized therapeutic strategies that target CDla to inhibit autoreactive T cells.
Development of a multi-domain molecule comprising a PD-1 binding domain and a CDla binding domain, linked via a half-life extending domain, to provide localized inhibition of autoreactive T cells in the skin, utilizing a bispecific agonist approach.
The multi-domain molecule achieves localized inhibition of inflammatory T cells in atopic dermatitis, reducing systemic immunosuppression and enhancing T cell exhaustion, thereby providing effective treatment with minimized side effects.
Abstract
Description
CD1A-PD-1 BISPECIFIC AGONIST FOR THE TREATMENT OF ATOPIC DERMATITISFIELD OF THE INVENTION[1] The present disclosure provides multi-domain molecules comprising, (i) a first binding domain that binds to an inhibitory immune checkpoint receptor, such as PD-1; and (ii) a second binding domain that binds to CD la. Such multi-domain molecules can be useful in the development of soluble immunotherapeutics for the treatment of autoimmune diseases, such as atopic dermatitis (AD).BACKGROUND[2] Autoimmune diseases are often chronic and debilitating, and constitute an area of clinical need. The current treatment landscape is dominated by systemically acting therapies, even where inflammation occurs in a single tissue. These systemic treatments can often lead to undesirable side effects and discontinuation of treatment.[3] In autoimmunity, there is mounting evidence that PD-1 pathway impairment plays an important role in disease pathogenesis. PD-1, PD-L1 and PD-L2 gene polymorphisms are associated with several autoimmune diseases. In addition, the PD-1 receptor is a key inhibitory immune checkpoint that regulates T cell activation and is involved in T cell exhaustion, a state of cellular paralysis. Auto reactive T cells are often main drivers of autoimmunity and T cell exhaustion correlates with good prognosis in autoimmune disease settings. Activating PD-1 on autoreactive lymphocytes thus may serve as a mechanism to treat autoimmune diseases. However, few PD-1 agonists have reached the clinic. In addition, treatment with PD-1 agonists alone harbors the risk of systemic effects.[4] The present disclosure provides for the first time immunotherapeutic candidates for the treatment of autoimmune disease that utilize two modes of action. The first mode of action is PD-1 mediated-inhibition. The second mode of action is localized blockade of autoreactive T cells by targeting of CDla. CD la is structurally related to an MHC I complex, and like an MHC I complex, presents antigen to T cells. However, the antigens are typically from lipids, either self or foreign, and not proteins. Furthermore, CDla is non-restricted, that is, its expression is not limited to any particular subset (e.g., HLA subtype) of individuals. TCRs on CD la-homing T cells can interact with CDla by recognizing CDla independently of antigen, or by recognizing a lipid-CDla complex.[5]Autoimmune diseases with limited treatment options include moderate to severe atopicdermatitis (AD). For treatment of AD in particular, PD-1 mediated inhibition is compelling because of the relevance of the PD-1 pathway in AD. (Rosskopf, S., Jahn-Schmid, B., Schmetterer, K.G. et al. PD-1 has a unique capacity to inhibit allergen-specific human CD4+ T cell responses. Sci Rep 8, 13543 (2018)). Furthermore, activation of CD4 T helper cells by antigen presenting cells (APCs) in skin and draining lymph nodes is a key step in the pathogenesis of atopic dermatitis (AD). In addition, CD la is constitutively and highly expressed on Langerhans cells and antigen presenting cell (APC) subsets in the skin, as well as being expressed by dendritic cells (DCs) in mucosal tissues. A large number of CD la-homing T cells are contained within the skin and blood indicating that CD la-specific T cells may play a role in skin diseases.[6]The present disclosure demonstrates that a bispecific molecule targeting CDla is a compelling therapeutic candidate for AD and other autoimmune diseases, particularly when employed together with PD-1 mediated inhibition. Therapies to deliver localized inhibition of skin T cells are a novel strategy to treat AD.SUMMARY OF THE INVENTION[7] In some aspects, the present disclosure relates to a multi-domain molecule comprising: (i) a first binding domain that binds to PD-1, and (ii) a second binding domain that binds to CDla, wherein the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (SEQ ID NO: 8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.[8] In some aspects, the first binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutationstherein.[9] In some embodiments, the multi-domain molecule further comprises (iii) a half-life extending domain, where the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain, and wherein the C-terminus of the first binding domain is linked to the N-terminus of the second binding domain. In some embodiments, the C-terminus of the second binding domain is linked to the N-terminus of FC1.
[0010] In some aspects, the first binding domain is an antibody or fragment thereof, e.g. a VHH or scFv. In some aspects, the first binding domain is a VHH. In some aspects, the first binding domain to PD-1 comprises a KD in the range of about 1 nM to about 500 nM or in the range of about 50 nM to about 70 nM. In some aspects, the first binding domain binds to an epitope in PD-1 comprising one or more or all of the following amino acids: E38, F59, P60, E61, T75, Q76, L77, P78, N79 and G80, numbered according to SEQ ID NO: 13.
[0011] In some aspects, the first binding domain comprises FR1-CDR1-FR2-CDR2-FR3- CDR3-FR4, wherein FR is a framework region, and wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - AVQLVESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 14), with zero, one, two or three mutations therein,FR2 - MTWVRQAPGKGPEWVSA (SEQ ID NO: 15), with zero, one, two or three mutations therein,FR3 -SYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYY (SEQ ID NO: 16), with zero, one, two or three mutations therein,FR4 - YLTYDRYGQGTLVTVSS (SEQ ID NO: 17), with zero, one, two or three mutations therein.
[0012] In some aspects, the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 18 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 18. In some aspects, the first binding domain comprises the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 20.
[0013] In some aspects, the first binding domain comprises a non-polymorphic, HLA -related molecule such as a CD1 epitope. In some aspects, the second binding domain binds toCD la. In some aspects, the second binding domain is a VHH or scFv. In some aspects, thesecond binding domain is a VHH. In some aspects, the second binding domain is an antiCD la VHH. In some aspects, the second binding domain is a humanized anti-CDla VHH. In some aspects, the second binding domain is a humanized llama anti-CDla VHH. In some aspects, the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: P24, F38, E45, R46, F48, A50, Y73, R75, V78, and G97, numbered according to SEQ ID NO: 21. In some aspects, the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: P24, F38, F48, Y73, R75, and V78, numbered according to SEQ ID NO: 25. In some aspects, the humanized llama anti- CDla VHH comprises one or more or all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, P87 and V97, numbered according to SEQ ID NO: 28. In some aspects, the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, and G97, numbered according to SEQ ID NO: 29. In some aspects, the humanized llama anti-CDla VHH comprises a reduced hook effect as compared to wild-type llama anti-CDla VHH. In some aspects, the second binding domain is humanized to human IGHV3-23*01 and human IGHJ*04.
[0014] In some aspects, the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), with zero, one, two or three mutations therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), with zero, one, two or three mutations therein.
[0015] In some aspects, the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRAFRPHNVMA (SEQ ID NO: 5), with zero, one, two or three mutations therein,CDR2 - AARWSGIYYAESVKG (SEQ ID NO: 8), with zero, one, two or three mutations therein,CDR3 - STAQDMTLALMSDYDY (SEQ ID NO: 11), with zero, one, two or three mutations therein.
[0016] In some aspects, the second binding domain comprises a CDR1, a CDR2 and a CDR3comprising the following sequences:CDR1 - GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein,CDR3 - GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
[0017] In some aspects, the second binding domain comprises FR1-CDR1-FR2-CDR2-FR3- CDR3-FR4, wherein FR is a framework region, and wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - EVQLLESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 30), with zero, one, two or three mutations therein,FR2 - WVRQAPGKGLEWVS (SEQ ID NO: 31), with zero, one, two or three mutations therein,FR3 - RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAK (SEQ ID NO: 32), with zero, one, two or three mutations therein,FR4 - WGQGTLVTVSS (SEQ ID NO: 33), with zero, one, two or three mutations therein.
[0018] In some aspects, the mutation(s) in the second binding domain framework regions are selected from A24P, V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 21. In some aspects, the mutation(s) in the second binding domain framework regions are selected from A24P, V38F, W48F, N73Y, K75R, and L78V numbered according to SEQ ID NO: 25. In some aspects, the mutation(s) in the second binding domain framework regions are selected from V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V, A87P and A97V numbered according to SEQ ID NO: 28. In some aspects, the mutation(s) in the second binding domain framework regions are selected from V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 29.
[0019] In some aspects, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 34 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 21. In some aspects, the second binding domain comprises the amino acid sequence, or a humanized version thereof, provided in SEQ ID NO: 25, or an amino acid sequence having at least90%, at least 95% or at least 98% identity to SEQ ID NO: 25. In some aspects, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 35 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 28. In some aspects, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 36 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 29. In some aspects, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 27.
[0020] In some aspects, the multi-domain molecule described herein comprises a half-life extending domain. In some aspect, the half-life extending domain comprises:(a) one or more amino acid substitutions which facilitate dimerisation of FC1 and FC2; and / or(b) one or more amino acid substitutions which prevent or reduce binding to FcyR; and / or(c) one or more amino acid substitutions which promote binding to FcRn.
[0021] In some aspects:(i) one of the FC 1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, T394S, F405A, Y407A, Y407T and Y407V according to SEQ ID NO: 37; and(ii) the other of the FC1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366W, T366Y, T366W, T394W and F405W according to SEQ ID NO: 37.
[0022] In some aspects:(i) one of the FC 1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, and Y407V according to SEQ ID NO: 37; and(ii) the other of the FC1 and the FC2 comprises a T366W amino acid substitution according to SEQ ID NO: 37.
[0023] In some aspects, the half-life extending domain comprises one or more amino acid substitutions which attenuate an effector function of the Fc domain. In some aspects, the half-life extending domain comprises one or more amino acid substitutions selected fromthe group consisting of S228P, E233P, L234A, L235A, L235E, L235P, G236R, G237A, P238S, F241A, V264A, D265A, H268A, D270A, N297A, N297G, N297Q, E318A, K322A, L328R, P329G, P329A, A330S, A330L, P331A and P331S according to SEQ ID NO: 37. In some aspects, the FC1 and / or the FC2 comprise a N297G amino acid substitution according to SEQ ID NO: 37.
[0024] In some aspects:(a) either FC1 or FC2 comprises the amino acid sequence provided in SEQ ID NO: 38 or 39, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 38 or 39, and(b) the other of FC1 and FC2 comprises the amino acid sequence provided in SEQ ID NO: 40 or 41, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 40 or 41 .
[0025] In some aspects, the first binding domain is linked to the N-terminus of the second binding domain by a linker and / or IgG hinge sequence. In some aspects, the linker comprises the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein. In some aspects, the C-terminus of the second binding domain is linked to the N-terminus of FC1 via an IgG hinge sequence. In some aspects, the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2. In some aspects, the IgG hinge comprises the amino acid sequence of SEQ ID NO: 43 or SEQ ID NO: 42.
[0026] In some aspects, the multidomain molecule of the present disclosure comprises the amino acid sequence of: (i) SEQ ID NO: 57; and (ii) SEQ ID NO: 58. In some aspects, the multidomain molecule of the present disclosure comprises the amino acid sequence of: (i) SEQ ID NO: 59; and (ii) SEQ ID NO: 58. In some aspects, the multidomain molecule of the present disclosure comprises the amino acid sequence of: (i) SEQ ID NO: 63; and (ii) SEQ ID NO: 58.
[0027] In some aspects, the present disclosure relates to a single domain antibody that binds to CDla comprising a CDR1, CDR2 and CDR3, comprising the following amino acid sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (SEQ ID NO: 8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or threemutations therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
[0028] In some aspects, (a) the single domain antibody is isolated; and / or (b) the single domain antibody is a VHH; and / or (c) the single domain antibody is an anti-CDla antibody; and / or (d) the single domain antibody binds to CD la with a KD in the range of about 100 pM to about 5000 pM or in the range of about 600 pM to about 3000 pM; and / or (e) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 34 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 21; and / or (f) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 35 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 28; and / or (g) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 36 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 29. In some aspects, the single domain antibody is linked to a binding domain that binds an immune checkpoint receptor. In some aspects, the immune checkpoint receptor is PD-1.
[0029] In some aspects, the present disclosure provides a nucleic acid encoding the multidomain molecule described herein, wherein (a) the first and second binding domains are encoded within a single open reading frame, or within two distinct open reading frames; (b) the first binding domain, second binding domain and half-life extending domain are encoded within a single open reading frame, or within distinct open reading frames; and / or (c) the single domain antibody.
[0030] In some aspects, the present disclosure provides an expression vector comprising the nucleic acid disclosed herein. In some aspects, the present disclosure provides a cell harbouring: (a) the expression vector described herein; (b) a first expression vector comprising a nucleic acid encoding a first binding domain and a second expression vector comprising a nucleic acid encoding a second binding domain as described herein; or (c) a first expression vector comprising a nucleic acid encoding the first binding domain of the multi-domain molecule, a second expression vector comprising a nucleic acid encoding the second binding domain of the multi-domain molecule, and a third expression vector comprising a nucleic acid encoding the half-life extending domain of the multi-domainmolecule as described herein.
[0031] In some aspects, the present disclosure provides a non-naturally occurring and / or purified and / or engineered cell, preferably a T-cell, presenting the multi-domain molecule described herein. In some aspects, the present disclosure provides a pharmaceutical composition comprising the multi-domain molecule, the single domain antibody, the nucleic acid, the expression vector, and / or the cell, together with one or more pharmaceutically acceptable carriers or excipients.
[0032] In some aspects, the present disclosure provides the single domain antibody, the nucleic acid, the expression vector, and / or the cell, for use in medicine, preferably in a human subject. In some aspects, the present disclosure provides a multi-domain molecule for use in a method of treating atopic dermatitis, psoriasis and / or skin lichenoid diseases.
[0033] In some aspects, the present disclosure provides a method of producing the multidomain molecule or the single domain antibody, the method comprising a) maintaining the cell under optimal conditions for expression of the multi-domain molecule or single domain antibody and b) isolating the multi-domain molecule or single domain antibody.
[0034] In some aspects, the present disclosure provides a multi-domain molecule comprising: (i) a PD-1 agonist VHH, (ii) a humanized CDla-binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero or one mutation therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero or one mutation therein, CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero or one mutations therein;(b) the humanized CDla-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), with zero or one mutation therein, CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), with zero or one mutation therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), with zero or one mutation therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain;wherein the C-terminus of the PD- 1 agonist VHH is linked to the N-terminus of the humanized CD la-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; and wherein the C- terminus of the humanized CD la-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
[0035] In some aspects, the present disclosure provides a multi-domain molecule comprising: (i) a PD-1 agonist VHH, (ii) a humanized CDla-binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein,CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein;(b) the humanized CDla-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 -GRAFRPHNVMA (SEQ ID NO: 5), with zero, one, two or three mutations therein,CDR2 -AARWSGIYYAESVKG (SEQ ID NO: 8), with zero, one, two or three mutations therein,CDR3 -STAQDMTLALMSDYDY (SEQ ID NO: 11), with zero, one, two or three mutations therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain; wherein the C-terminus of the PD- 1 agonist VHH is linked to the N-terminus of the humanized CDla-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; and wherein the C- terminus of the humanized CDla-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
[0036] In some aspects, the present disclosure provides a multi-domain molecule comprising:(i) a PD-1 agonist VHH, (ii) a humanized CDla-binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein,CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein;(b) the humanized CDla-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein,CDR3 - GSSTFSANYRDYEY (SEQ ID NO: 12) with zero, one, two or three mutations therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain; wherein the C-terminus of the PD- 1 agonist VHH is linked to the N-terminus of the humanized CDla-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; and wherein the C- terminus of the humanized CDla-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
[0037] In some aspects, the IgG hinge comprises the amino acid sequence of SEQ ID NO: 43 or SEQ ID NO: 42.
[0038] In some aspects, the disclosure provides a method for treating an autoimmune disease in a subject, the method comprising administering the multi-domain molecule as described herein, the single domain antibody as described herein, the nucleic acid as described herein, the expression vector as described herein, and / or the cell as described herein. In some aspects, the autoimmune disease is atopic dermatitis, psoriasis and / or skin lichenoid diseases.
[0039] In some aspects, the disclosure provides a bispecific molecule that binds to PD-1 and CD la, wherein the bispecific molecule comprises a means for binding PD-1 and a means for binding CD la. In some aspects, the means for binding PD-1 comprises a first binding domain that corresponds to a PD-1 agonist, a PD-1 agonist ligand, or a fragment or modification thereof. In some aspects, the means for binding PD-1 comprises a first binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, andCDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein.
[0040] In some aspects, the means for binding CD la comprises a second binding domain that corresponds to a soluble TCR, an antigen-binding fragment, or a fragment or modification thereof. In some aspects, the means for binding CD la comprises a first binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences: (i) CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein, (ii) CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (SEQ ID NO: 8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, and (iii) CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
[0041] In some aspects, the disclosure provides a method for treating an autoimmune disease in a subject, the method comprising: administering to the subject a means for binding PD-1 and CD la. In some aspects, the means for binding PD-1 comprises a first binding domain that corresponds to a PD-1 agonist, a PD-1 agonist ligand, or a fragment or modification thereof. In some aspects, the means for binding CD la comprises a second binding domain that corresponds to a soluble TCR, an antigen-binding fragment, or a fragment or modification thereof. In some aspects, the means for binding PD-1 comprises a first binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences: (i) CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, (ii) CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, and (iii) CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutationstherein. In some aspects, the means for binding CD la comprises a second binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences: (i) CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein, (ii) CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (SEQ ID NO: 8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, and (iii) CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
[0042] In some aspects, the present disclosure further provides a method comprising measuring levels of soluble PD-1 (sPDl) from a sample in the subject. In some aspects, increased levels of soluble PD-1 (sPDl) indicate PD-1 binding. In some aspects, increased levels of soluble PD-1 (sPDl) indicate CD la binding. In some aspects, increased levels of soluble PD-1 (sPDl) indicate simultaneous CDla and PD-1 binding.
[0043] In some aspects, the present disclosure provides a method of measuring engagement, or efficacy of engagement, of the multi-domain molecule, the single domain antibody, or the bispecific molecule of the present disclosure with a target PD- 1 marker and / or a CD 1 -a marker in a subject, wherein the method comprises: (i) administering to the subject the multi-domain molecule, single domain antibody, or bispecific molecule; and (ii) measuring a level of soluble PD-1 (sPD-1) in a biological sample obtained from the subject, wherein a relative increase in the measured level of sPD-1 compared to a control sample indicates engagement of the multi-domain molecule, single domain antibody, or bispecific molecule with the target PD-1 marker and / or CD la marker.
[0044] In some aspects, the present disclosure provides a method of treating an autoimmune disease in a subject, the method comprising: (i) determining a baseline level of soluble PD- 1 (sPD-1) in a biological sample obtained from the subject (TO), (ii) administering to the subject a first dosage amount of a multi-domain molecule binding to PD-1 and CD la, and (iii) determining a level of sPD-1 (Tl) after (ii) in a biological sample obtained from the subject (Tl), wherein if Tl is greater than or equal to TO, then a second dosage amount of the multi-domain molecule is administered, wherein the second dosage amount is the same or less than the first dosage amount , or wherein if Tl is less than TO, then the second dosage amount of the multi-domain molecule is greater than the first dosage amount and / or further comprises a second autoimmune disease treatment.
[0045] The present disclosure further provides a method of enhancing T cell exhaustion comprising administering the multi-domain molecule of the present disclosure by simultaneously targeting PD-1 and CDla.BRIEF DESCRIPTION OF THE DRAWINGS
[0046] The following drawings form part of the present specification and are included to further demonstrate exemplary embodiments of certain aspects of the present disclosure.
[0047] FIG. 1A is a schematic showing the dual action mechanism of a CD la- PD-1 bispecific molecule.
[0048] FIG. IB. Immunohistochemistry (IHC) of CD la expression on skin APCs in healthy and AD lesional skin using an anti-CDla antibody (Abeam C1A / 711).
[0049] FIG. 2. Schematic showing the process utilized for selection of potential therapeutic CDla-PD-1 bispecific candidate molecules. The process is further described in Example 1.
[0050] FIG. 3 Schematic of CDla-PD-1 bispecific formats tested. The domain labeled “1” represents a PD-1 agonist VHH antibody domain (referred to as H5). The domain labeled “2” represents a CD la VHH antibody domain. The cross-sectional domains labeled “3” represent a CD la scFv comprising a VH domain and a VL domain. Lines connecting the domains correspond to linker sequences. The domains labeled 4 and 5 represent the FC1 and FC2 domains of an Fc molecule, respectively.
[0051] FIG. 4. Schematic of the Raji CDla: Jurkat NFAT PD-1 reporter assay utilized to assess percent CD la targeting-dependent inhibition of NFAT activity by CDla-PDl ImmTAAI molecules. Inhibition of NFAT activity is an indicator of inhibition of TCR activation.
[0052] FIG. 5 A. Graph showing levels of percent inhibition of NFAT activity as demonstrated by the Jurkat NFAT PD-1 reporter assay (as diagrammed in FIG. 4) using five (5) different humanized half-life extended (HLE) CDla targeting bispecific molecules (Hum HLE Ab002.10-H5, Hum HLE Ab007.11-H5, Hum HLE Ab052.9-H5, Hum HLE Ab092.6-H5, and Hum HLE Ab096.12-H5), in the presence CDla-positive (CDla+) or CD la-negative (CDla-) antigen presenting cells (APCs). The bispecific molecules in thisfigure were obtained after one round of humanization. Each molecule comprises the designated CD la targeting antibody domain, a half-life extending (HLE) domain, and the PD-1 agonist H5 domain.
[0053] FIG. 5B. Graph showing levels of percent inhibition of NF AT activity as demonstrated by the Jurkat NFAT PD- 1 reporter assay (as diagrammed in FIG. 4) using humanized halflife extended (HLE) CDlatargeting bispecific molecules (Ab002.10.18nR-H5 and Ab002.10.21nR-H5), in the presence CDla-positive (CDla+) or CDla-negative antigen presenting cells (APCs).
[0054] FIG. 5C and FIG 5D. Graphs showing levels of percent inhibition of NFAT activity as demonstrated by the Jurkat NFAT PD-1 reporter assay (as diagrammed in FIG. 4) using humanized half-life extended (HLE) CDlatargeting bispecific molecules Ab002.10.18nR- H5 (FIG. 5C) and Ab002.10.21nR-H5 (FIG. 5D) in the presence or absence of CDla / b / c / d in the Raji A2 cells.
[0055] FIG. 6. Crystal structures of the wild-type VHH antibody molecules Ab002, Ab007 and Ab096 bound to CD la.
[0056] FIG. 7A. Schematic of the Raji SEB human IL-2 cytokine release assay utilized to assess levels of CD4 T cell activation by CDla-PDl ImmTAAI molecules. FIG. 7B presents the results of dose response studies of the CD la wild-type Ab002-H5 HLE construct as compared to CR2113, a CD la-specific high affinity tool antibody, using the Raji SEB human CD4 T cell IL-2 assay with CDla+ or CD la Raji cells (as diagrammed in FIG. 7A).
[0057] FIG. 7C presents the results of dose response studies of the wild-type PD-l / CDla HLE constructs Hum HLE Ab007-H5, Hum HLE Ab052-H5, Hum HLE Ab092-H5, and Hum HLE Ab096-H5 using the Raji SEB human CD4 T cell IL-2 assay with CDla+ or CDla- Raji cells (as diagrammed in FIG. 7A). Each of the PD-l / CDla HLE constructs comprise the specified CDla VHH domain, a half-life extending (HLE) domain, and the PD-1 agonist H5 domain.
[0058] FIG. 7D presents the results of dose response studies, as diagrammed in FIG. 7A, of the variant PD-l / CDla HLE constructs Ab002-10.18nr-H5, Ab002.10.21nr-H5, and Ab002.10- H5, and the wild-type PD-l / CDla HLE construct Ab002-H5, using the Raji SEB human CD4 T cell IL-2 assay with CDla+ or CDla- Raji cells. Each of the PD-l / CDla HLEconstructs comprise the specified CDla VHH domain, a half-life extending (HLE) domain, and the PD-1 agonist H5 domain.
[0059] FIG. 8 shows tissue sections stained with a fluorescently labeled HLE Ab002 (anti- CDla-AF488) and with DAPI (blue) indicating that the CDla ImmTAAI bound specifically to CD la-positive APCs in human skin cell explants.
[0060] FIG. 9A displays flow cytometry data for the differentiated monocyte-derived Langerhans cells (MoLCs) as described in Example 4. FIG. 9B is a schematic of a Jurkat NFAT PD-1 reporter cell assay with SEB-pulsed MoLCs.
[0061] FIG. 9C displays a graph showing levels of percent inhibition of NFAT activity using CD la-targeted wild-type Ab002-HLE ImmTAAIs, with and without PD-L1 blocking in a model using primary human Langerhans cells (LCs) with endogenous CDla (FIG. 9B).
[0062] FIG. 9D displays a graph showing levels of percent inhibition of NFAT activity using CD la-targeted variant Ab002.10.18nR VHH and Ab002.10.21nR VHH constructs, with and without PD-L1 blocking in a model using primary human Langerhans cells (LCs) with endogenous CDla (FIG. 9B).
[0063] FIG. 10A is a schematic of an assay used to assess blockade of primary CDla autoreactive T cells. FIG. 10B shows a bar graph indicating the level of IFNy-producing CD3+ T cell stimulation with CD3+ T cells alone (first bar from left), CD3+ T cells in the presence of CDla+ K562 cells (second bar from left), or further adding to CD3+ T cells and K562 cells an anti-CDla antibody (third bar from left), or increasing doses of the CDla / PD-1 bispecific Ab002.10-H5 HLE (fifth, six and seventh bars from left). The negative control (CD3+ T cells and K562 cells, further adding IgGl isotype control) is shown as the fourth bar from left.
[0064] FIG 11A is a schematic of an assay used to assess ImmTAAI-dose dependent blockade of CDla TCR reporter. FIG. 1 IB and FIG.11C presents NFAT activity from the CDla TCR Jurkat NFAT reporter assay as diagrammed in FIG. 11A in the presence of the CDla / PD-1 bispecific molecule Ab002.10-H5 or the half-life extended (HLE) version of Ab002.10-H5 (FIG. 1 IB), or in the presence of the HLE CDla / PD-1 bispecific molecules indicated as compared to an anti-CDla clone (H149) and an IgGl isotype control(FIG.11 C).[65JFIG. 12A. Schematic of mol427 bispecific ImmTAAI format. FIG. 12B. Results ofstability studies of Ab002.10, Ab007. l l and Ab052.9.[66JFIG. 13A. Schematic of a T cell exhaustion assay. FIG. 13B. T Cell exhaustion determined by primary' CD4 T cell activation. Raji viability, CDla / PD-1 ImmTAAl binding, CD4 T cell activation, and PD-1 expression were noted over the course of ten days (DO to DIO) when assay (as diagrammed in FIG.13A) was performed. FIG 13C and FIG 13D. Stability measurements of CD la-PD-1 -ImmTAAl binding to Raji-CDla at 1 hour, 1 day, 2 day, 3 day and 4 day time points during the course of T cell exhaustion (assay performed as shown in FIG. 13A and FIG. 13B). FIG 13E, FIG. 13F. Stability of irradiated Raji-CDla cells shown at 1 hour, 1 day, 2 day, 3 day and 4 day time points during the course of T cell exhaustion (assay performed as shown in FIG. 13A and FIG. 13B). FIG. 13G. CD25 and CD69 activation marker expression shown at 1 hour, 1 day, 2 day, 3 day, 4 day, and 10 day time points during the course of T cell exhaustion (assay performed as shown in FIG. 13A and FIG. 13B).[67JFIG. 13H, FIG. 131, and FIG. 13J. Graphs representing levels of proliferation (via Ki67 expression) (FIG. 13H), IL-2 cytokine secretion (FIG. 131) and TIM-3 and PD1 expression (FIG. 13 J) shown at 1 hour, 1 day, 2 day, 3 day, 4 day, and 10 day time points during the course of T cell exhaustion (assay performed as shown in FIG. 13A and FIG. 13B).[68JFIG. 14A and FIG. 14B. Schematic of a T cell exhaustion assay protocol (FIG. 14A) where IL-2 is provided initially between Day 0 (DO) and Day 3 (D3), and following activation of CD4 between Day 10 (DIO) and Day 13 (D13). Graphs representing levels of IL-2, TNF-a, and IFN-y on day 3 as compared to day 13 from the T cell exhaustion assay (FIG.14B).
[0069] FIG. 15 A, FIG. 15B and FIG. 15C. IL-2 is provided in a T cell exhaustion assay from DO to D4, or from DO to D8 (FIG. 15A). CD1 a-PD-1 -ImmTAAl decreases IL-2 and TNFa secretion throughout CD4 T cell activation either when IL-2 provided from DO to D4 (FIG. 15B) or when provided between DO to D8 (FIG. 15C)
[0070] FIG. 16A. Schematic of assay with CD4 cells activated in the presence of CD la-PD-1 - ImmTAAl. FIG. 16B. CD4 T cells activated in the presence of CD la-PD-1 -ImmTAAl produce significantly less proinflammatory (IL-2 and TNF-a) cytokines during reactivation. FIG. 16C. CD4 T cells activated in the presence of CD la-PD-1 -ImmTAAl produced significantly more anti-inflammatory (IL- 10) cytokines during re -activation. FIG. 16D. Levels of proinflammatory' and anti-inflammatory cytokines when primary CD4 Tcells were treated with the PD-1 agonist antibody, peresolimab, compared to CD4 T cells with no treatment.[71JFIG. 17. Graphs showing levels of IL-2, IL-13, IL17A, IL-22, TNF-a, and IL012p70 using Luminex analysis of explant culture media from atopic dermatitis lesional or perilesional skin punches treated with either a CDla / PD-1 bispecific molecule or a control vehicle as described in Example 7.
[0072] FIG. 18. The percentage of proliferating (Ki67+) T cells calculated by staining T cells with an anti-CD3 Ab (Invitrogen A51001) and staining proliferating cells with an anti-Ki67 ab (Cell Signaling 94495) in epidermis or papillary dermis of lesional or perilesional skin punches treated with either a CDla / PD-1 bispecific molecule or a control vehicle as described in Example 7.[73JFIG. 19. Graph showing levels of soluble PD-1 using Luminex analysis of explant culture media from atopic dermatitis lesional or perilesional skin punches treated with either a CDla / PD-1 bispecific molecule or a control vehicle as described in Example 7.[74JFIG. 20A, FIG. 20B, and FIG. 20C. A schematic of the CDla / PD-1 bispecific molecule illustrating Chain 1 of the bispecific molecule in FIG. 20A, Chain 2 in FIG. 20B, and the complete folded structure in FIG. 20C.DETAILED DESCRIPTION
[0075] It should be understood that any embodiment described herein, including those described only in the examples, can be combined with any one or more other embodiments, unless such combination is expressly disclaimed or is improper. Thus, the term “embodiment”, as used herein, is not to be considered as excluding features recited in other embodiments.
[0076] Unless otherwise defined herein, scientific and technical terms used in the present disclosure shall have meanings that are commonly understood by one of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
[0077] The articles “a” and “an” are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
[0078] The use of the term “or” in the claims is used to mean “and / or,” unless explicitly indicated to refer only to alternatives or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and / or.”
[0079] As used herein, the terms “comprising” (and any variant or form of comprising, such as “comprise” and “comprises”), “having” (and any variant or form of having, such as “have” and “has”), “including” (and any variant or form of including, such as “includes” and “include”) or “containing” (and any variant or form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited, elements or method steps.
[0080] The use of the term “for example” and its corresponding abbreviation “e.g.” means that the specific terms recited are representative examples and embodiments of the disclosure that are not intended to be limited to the specific examples referenced or cited unless explicitly stated otherwise.
[0081] As used herein, “about” can mean plus or minus 10% of the provided value. Where ranges are provided, they are inclusive of the boundary values. “About” can additionally or alternately mean either within 10% of the stated value, or within 5% of the stated value, or in some cases within 2.5% of the stated value; or “about” can mean rounded to the nearest significant digit.
[0082] As used herein, “between” is a range inclusive of the ends of the range. For example, a number between x and y explicitly includes the numbers x and y and any numbers that fall within x and y.
[0083] As used herein, the term “antibody” includes, but is not limited to, genetically engineered or otherwise modified forms of immunoglobulins, such as intrabodies, chimeric antibodies, fully human antibodies, humanized antibodies (e.g. generated by “CDR- grafting”), antibody fragments, and heteroconjugate antibodies (e.g., bispecific antibodies, diabodies, triabodies, tetra-bodies, etc.). The term “antibody” includes cys-diabodies and minibodies. Thus, each and every embodiment provided herein in regard to “antibodies”, or “antibody like constructs” is also envisioned as, bi-specific antibodies, diabodies, scFv fragments, chimeric antibody receptor (CAR) constructs, diabody and / or minibody embodiments, unless explicitly denoted otherwise. The term “antibody” includes a polypeptide of the immunoglobulin family or a polypeptide comprising fragments of an immunoglobulin that is capable of non-covalently, reversibly, and in a specific mannerbinding a corresponding antigen, as disclosed herein. An exemplary antibody structural unit comprises a tetramer. In some embodiments, a full-length antibody can be composed of two identical pairs of polypeptide chains, each pair having one “light” and one “heavy” chain (connected through a disulfide bond). The term “antibody” also comprises immunoglobulins (Ig’s) of different classes (i.e., IgA, IgG, IgM, IgD and IgE) and subclasses (such as IgGl, IgG2 etc.). An “antibody” is an example of an “antigen-binding molecule,” where the molecule is capable of specifically recognizing and binding to an antigen.
[0084] Antibody formats include functional antibody fragments, single chain antibodies, single domain antibodies, and chimeric, humanized, bispecific or multispecific antibodies. An “antigen binding fragment” of an antibody refers to a portion of a full-length antibody, or a protein that resembles a portion of a full-length antibody, that retains the ability to bind to its target antigen, in particular the antigen binding region or variable region of the full- length antibody. Examples of “antigen binding fragments” include Fv, Fab, F(ab')2, Fab', dsFv, (dsFv)2, scFv, sc(Fv)2 and diabodies. For example, a multi-domain binding molecule of the disclosure may comprise a scFv. A “antigen binding fragment” may also be a single domain antibody, such as a heavy chain antibody. As is known in the art, the antigen binding site of a single domain antibody, such as a VHH, may comprise three CD Rs (as opposed to six in a conventional antibody). The term “antigen binding moiety” or “antigen binding fragment” of an antibody, as used herein, encompasses such binding sites. Alternatively, or additionally, the binding molecule may comprise a Fab or Fv fragment. The term “Fab” denotes an antibody fragment having a molecular weight of about 50,000 Dalton and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, e.g. papain, are bound together through a disulfide bond. The Fv fragment is the N-terminal part of the Fab fragment of an antibody and consists of the variable portions of one light chain and one heavy chain.
[0085] Accordingly, the term “humanized” immunoglobulin refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human (usually a mouse or rat) immunoglobulin. The non-human immunoglobulin providing the CDR's is called the “donor” and the human immunoglobulin providing the framework is called the “acceptor”. Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, preferably about 95% or more identical. Hence, all parts of a humanized immunoglobulin, exceptpossibly the CDR's, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A “humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. For example, a humanized antibody would not encompass a typical chimeric antibody as defined above, e.g., because the entire variable region of a chimeric antibody is non-human. In embodiments, the antibody nomenclature used in the present disclosure for the targeting arm is referred to as AbXXX or AbXXX WT, wherein the initials “WT” indicate the wildtype version of AbXXX. In embodiments, the antibody nomenclature used as AbXXX.# indicates a humanized antibody version of AbXXX, at a numbered variant (#). For example, Ab002.10 indicates a humanized Ab002 antibody of variant numbered 10. In embodiments, Ab002 or Ab002 WT indicates the wild-type Ab002 antibody without humanization.
[0086] The term “phenotypically silent variants” is understood to refer to a variant which incorporates one or more further amino acid changes, including substitutions, insertions and deletions, in addition to those set out above, which variant has a similar phenotype to the corresponding molecule without said change(s). For the purposes of this application, phenotype comprises binding affinity (KD and / or binding half-life) and specificity. Preferably, the phenotype for a soluble multi-domain binding molecule includes potency of immune activation and purification yield, in addition to binding affinity and specificity.
[0087] Phenotypically silent variants may contain one or more conservative substitutions and / or one or more tolerated substitutions. By tolerated substitutions it is meant those substitutions which do not fall under the definition of conservative as provided below but are nonetheless phenotypically silent. The skilled person is aware that various amino acids have similar properties and thus are ‘conservative’. One or more such amino acids of a protein, polypeptide or peptide can often be substituted by one or more other such amino acids without eliminating a desired activity of that protein, polypeptide or peptide.
[0088] Thus, the amino acids glycine, alanine, valine, leucine and isoleucine can often be substituted for one another (amino acids having aliphatic side chains). Of these possible substitutions it is preferred that glycine and alanine are used to substitute for one another (since they have relatively short side chains) and that valine, leucine and isoleucine are used to substitute for one another (since they have larger aliphatic side chains which are hydrophobic). Other amino acids which can often be substituted for one another include: phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains); lysine,arginine and histidine (amino acids having basic side chains); aspartate and glutamate (amino acids having acidic side chains); asparagine and glutamine (amino acids having amide side chains); and cysteine and methionine (amino acids having sulfur containing side chains). It should be appreciated that amino acid substitutions within the scope of the present disclosure can be made using naturally occurring or non-naturally occurring amino acids. For example, it is contemplated herein that the methyl group on an alanine can be replaced with an ethyl group, and / or that minor changes can be made to the peptide backbone. Whether or not natural or synthetic amino acids are used, it is preferred that only L- amino acids are present.
[0089] Substitutions of this nature are often referred to as “conservative” or “semiconservative” amino acid substitutions. The present disclosure therefore extends to use of a molecule comprising any of the amino acid sequence described above but with one or more conservative substitutions and or one or more tolerated substitutions in the sequence, such that the amino acid sequence of the TCR has at least 90% identity, such as 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity, to the TCR sequences disclosed herein.
[0090] “Identity” as known in the art is the relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case can be, as determined by the match between strings of such sequences. While there exist a number of methods to measure identity between two polypeptide or two polynucleotide sequences, methods commonly employed to determine identity are codified in computer programs. Preferred computer programs to determine identity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic Acids Research, 12, 387 (1984), BLASTP, BLASTN, and FASTA (Atschul et al., J. Molec. Biol. 215, 403 (1990)). In embodiments, the protein numbering scheme is based on the Kabat numbering scheme proposed by Wu and Kabat in 1970 and relied only on the amino acid sequence. In embodiments, the protein numbering scheme is based on the Eu numbering scheme. In embodiments, the protein numbering scheme is based on the Chothia proposed by Chothia (1987), who introduced structure-based factors into the numbering scheme. In embodiments, protein numbering scheme is based on the IMGT and Aho numbering schemes, which allow for greater flexibility when dealing with insertions and deletions (Honneger and Pltickthun 2001 ; Lefranc et al. 1999). The IMGT unique numbering provides positions of the amino acids(and corresponding codons) in coding sequences, in 2D graphical representations or IMGT Colliers de Perles and in 3D structures. A person of ordinary skill in the art would understand and know how to use the tools available in the art to convert from one protein numbering scheme to another. One such available resource is the IMGT Scientific conversion chart available at: https: / / www.imgt.org / IMGTScientificChart / Numbering / Hu_IGHGnber.html.
[0091] One can use a program such as the CLUSTAL program to compare amino acid sequences. This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or similarity (identity plus conservation of amino acid type) for an optimal alignment. A program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. Both types of identity analysis are contemplated in the present disclosure.
[0092] The percent identity of two amino acid sequences or of two nucleic acid sequences is determined by aligning the sequences for optimal comparison purposes (e.g., gaps can be introduced in the first sequence for best alignment with the sequence) and comparing the amino acid residues or nucleotides at corresponding positions. The “best alignment” is an alignment of two sequences which results in the highest percent identity. The percent identity is determined by the number of identical amino acid residues or nucleotides in the sequences being compared (i.e., % identity = number of identical positions / total number of positions x 100).
[0093] The determination of percent identity between two sequences can be accomplished using a mathematical algorithm known to those of skill in the art. An example of a mathematical algorithm for comparing two sequences is the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. The NBUAST and XBUAST programs of Altschul, et al. (1990) J. Mol. Biol. 215:403-410 have incorporated such an algorithm. BUAST nucleotide searches can be performed with the NBUAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to nucleic acid molecules. BUAST protein searches can be performed with the XBUAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to protein molecules for use in the disclosure. To obtain gapped alignments for comparison purposes, GappedBLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389- 3402. Alternatively, PSI-Blast can be used to perform an iterated search which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See http: / / www.ncbi.nlm.nih.gov. Another example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, CABIOS (1989). The ALIGN program (version 2.0) which is part of the CGC sequence alignment software package has incorporated such an algorithm. Other algorithms for sequence analysis known in the art include ADVANCE and ADAM as described in Torellis and Robotti (1994) Comput. Appl. Biosci., 10 :3-5; and FASTA described in Pearson and Lipman (1988) Proc. Natl. Acad. Sci. 85:2444-8. Within FASTA, ktup is a control option that sets the sensitivity and speed of the search.
[0094] Mutations, including conservation and tolerated substitutions, insertions, and deletions, can be introduced into the sequences provided using any appropriate method including, but not limited to, those based on polymerase chain reaction (PCR), restriction enzyme-based cloning, or ligation independent cloning (LIC) procedures. These methods are detailed in many of the standard molecular biology texts. For further details regarding polymerase chain reaction (PCR) and restriction enzyme-based cloning, see Sambrook & Russell, (2001) Molecular Cloning - A Laboratory Manual (3rdEd.) CSHL Press. Further information on ligation independent cloning (LIC) procedures can be found in Rashtchian, (1995) 24urrO pin Biotechnol 6(1): 30-6. The TCR sequences provided by the disclosure can be obtained from solid state synthesis, or any other appropriate method known in the art.
[0095] Activation of CD4 T helper cells by antigen presenting cells (APCs) in skin and draining lymph nodes is a key step in the pathogenesis of atopic dermatitis (AD). Therapies to deliver localized inhibition of skin T cells are a novel strategy to treat AD. The present disclosure has achieved this local inhibition by targeting CD la, an HLA -unrestricted target that presents lipids to CDla-autoreactive T cells, a subpopulation of T cells implicated in inflammatory skin diseases. CD la, a non-polymorphic, HLA -related molecule, is highly expressed on Langerhans cells and skin dendritic cells. Because CD la is non-polymorphic, the present disclosure provides the potential to treat patients without being restricted by HLA subtype.
[0096] The present disclosure provides novel molecules, referred to generally as ImmTAAIs®(Immune Modulating Monoclonal TCRs Against Autoimmune Disease, Immunocore Ltd.). ImmTAAI generally refers to a bispecific molecule comprising an organ-specific or antigen-specific soluble TCR capable of specifically binding to a peptide MHC (pMHC) or MHC-like complex, where the soluble TCR is fused to an immune suppressive effector function. In some instances, the molecule binding to the pMHC or MHC-like complex in an ImmTAAI can be a TCR mimic (TCRm), or an antigen-binding molecule, such as antibody, or fragment thereof. The present disclosure provides novel bi-specific molecules that exhibit high levels of PD-l-mediated T cell suppression and blockade of CD la-auto reactive T cell activation by tethering in a localized fashion to specific CD la-specific target cells. These CD la-targeted PD-1 agonist ImmTAAIs deliver localized inhibition of inflammatory T cells in AD skin while avoiding systemic immunosuppression.Multi-domain molecule
[0097] The disclosure as described herein provides a multi-domain molecule comprising: (i) a first binding domain that binds to an inhibitory immune checkpoint receptor, such as PD-1, (ii) a second binding domain that binds to a CD la, wherein the C-terminus of the first binding domain is linked to the N-terminus of the second binding domain. In some aspects, the muti -domain protein further comprises (iii) a half-life extending domain. In some aspects, the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain, and wherein the C-terminus of the second binding domain is linked to the N-terminus of FC1. i. First binding domain - inhibitory immune receptor
[0098] As described herein, the first binding domain binds to PD-1, i.e., the first binding domain comprises an immune suppressor. In some embodiments, the inhibitory immune checkpoint receptor comprises an antigen binding fragment that binds to an antigen located on an immune cell. In the context of the present disclosure, “immune cell” can refer to, for example, a T cell or a B cell. In particular, the antigen of the antigen-binding fragment can be a T cell surface antigen.
[0099] In some embodiments, the target (i.e., antigen) of the first binding domain is an immune modulator. In some embodiments, the target can be an immune checkpoint molecule, such as PD-1 (Programmed Death 1 receptor), A2AR (Adenosine A2A receptor), A2BR (Adenosine A2B receptor), B7-H3 (B7 Homolog 3, also called CD276) B7-H4 (B7Homolog 4, also called VTCN1), BTLA (B and T Lymphocyte Attenuator, also called CD272), CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4, also called CD 152), IDO (Indoleamine 2,3 -dioxygenase), CD200 Receptor, KIR (Killer-cell Immunoglobulin- like Receptor), TIGIT (T cell Immunoreceptor with Ig and ITIM domains), LAG3 (Lymphocyte Activation Gene-3), N0X2 (nicotinamide adenine dinucleotide phosphate NADPH oxidase isoform 2), TIM-3 (T-cell Immunoglobulin domain and Mucin domain 3), VISTA (V-domain Ig suppressor of T cell activation), SIGLEC7 (Sialic acid-binding immunoglobulin-type lectin 7, also called CD328), and SIGLEC9 (Sialic acid-binding immunoglobulin-type lectin 9, also called CD329). In some embodiments, the target is PD- 1. In some embodiments, the first binding domain can be an agonist of one or more of the above immune checkpoint molecules. Thus, in some embodiments, the immune suppressor can be an immune checkpoint agonist (i.e., to inhibit immune activation). Some suitable immune checkpoint agonists, including native ligands and antibodies, are reviewed in Paluch et al Front Immunol, 2018, 9:2306, for example.
[0100] In some embodiments, instead of comprising an antigen binding frament of an antibody, the first binding domain comprises one of a receptor-ligand pair, whereby the first binding domain is capable of binding to the other of the receptor-ligand pair. In some embodiments, the target ligand or receptor can be located on an immune cell. In some embodiments, the first binding domain comprises a ligand of an immune checkpoint molecule described above. In some embodiments, the first binding domain comprises the extracellular region of PD-L1 (Uniprot ref: Q9NZQ7) or PD-L2 (Q9BQ51) or a functional fragment thereof (i.e., a portion that is capable of binding to PD-1). In some embodiments, the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 19, or an amino acid sequence having at least 90% or at least 95% identity to SEQ ID NO: 19. Such an immune suppressor in some embodiments can engage an immune cell by binding to PD-1 and stimulate PD-1 signaling.
[0101] In some embodiments, the first binding domain comprises an agonist antibody or agonist antibody binding fragment that binds to, and preferably stimulates signaling of, an immune checkpoint molecule. In some embodiments, the first binding domain can be, or comprise, a PD-1 agonist antibody (e.g., single domain antibody). In some embodiments, such PD-1 agonists do not compete with PD-L1 for binding to PD-1. In some embodiments, such PD-1 agonists have a high degree of specificity for PD-1 and give rise to a potent inhibitory response when tested in reporter assays. In some embodiments, the PD-1 agonist can be a full-length antibody or fragment thereof, such as a scFv or a Fab fragment, or asingle domain antibody, such as a VHH. Examples of such antibodies are provided in WO2011110621 and WO2010029434 and WO2018024237. Thus, in some embodiments the antigen of the first binding domain can be PD- 1 and the antigen binding fragment of the first binding domain can be a PD-1 agonist. In some embodiments, the antigen binding fragment of the first binding domain can comprise a single domain antibody, optionally a VHH. In some embodiments, the first binding domain is a PD-1 agonist VHH.
[0102] As described above, the first binding domain is preferably a PD-1 agonist. As used herein, the term “PD-1 agonist” refers to any molecule that is capable of binding to PD-1 and activating PD-1 signaling, including e.g., the PD-1 ligand, PD-L1, and PD-1 agonist antibodies. Activation of the PD-1 pathway down-regulates immune activity, promoting peripheral immune tolerance and preventing autoimmunity (Keir et al., Annu Rev Immunol, 26:677-704, 2008; Okazaki et al., Int Immunol 19:813-824, 2007). PD-1 is a transmembrane receptor protein expressed on the surface of activated immune cells, including T cells, B cells, NK cells and monocytes (Agata et al., Int Immunol 8:765-772, 1996). The cytoplasmic tail of PD-1 comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). PD-L1 and PD-L2 are the natural ligands of PD-1 and are expressed on the surface of antigen presenting cells (Dong et al., Nat Med., 5:1365-1369, 1999; Freeman et al., J Exp Med 192: 1027-1034, 2000; Latchman et al., Nat Immunol 2:261-268, 2001 ). Upon ligand engagement, phosphatases are recruited to the ITIM region of PD-1 leading to inhibition of TCR-mediated signaling, and subsequent reduction in lymphocyte proliferation, cytokine secretion and cytotoxic activity. In some embodiments, PD-1 can also induce apoptosis in T cells via its ability to inhibit survival signals from costimulation (Keir et al., Annu Rev Immunol, 26:677-704, 2008). Targeted activation of the PD-1 pathway therefore provides an approach for the treatment of autoimmune conditions, such as T1DM.
[0103] In some embodiments, the antigen binding fragment of the immune suppressor can have the general structure:FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively. In some embodiments, the disclosure provides a multidomain molecule comprising a first binding domain that binds to PD-1, (ii) a second binding domain that binds to CD la, wherein thefirst binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein.
[0104] In some embodiments, the first binding domain is a single domain antibody that binds to PD-1 and comprises CDRs, CDR1, CDR2 and CDR3, having the following amino acid sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, andCDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein.
[0105] In some embodiments, the antigen-binding moiety is a VHH.
[0106] In some embodiments, the first binding domain can be a VHH comprising the amino acid sequence of SEQ ID NO: 18, or a humanized version thereof, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 18. Alternatively, the first binding domain can be a VHH comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 20.
[0107] In some embodiments, the single domain antibody is a VHH comprising the amino acid sequence provided in SEQ ID NO: 20.
[0108] In some embodiments, the first binding domain is covalently linked to the second binding domain via the C- or N-terminus of the second binding domain, optionally via a linker sequence. In some embodiments, the C-terminus of the first binding domain is covalently linked to the Nterminus of the second binding domain, optionally via a linkersequence. Suitable linker sequences are known in the art. Linker sequences are usually flexible, in that they are made up primarily of amino acids such as glycine, alanine and serine, which do not have bulky side chains likely to restrict flexibility. In some embodiments, linkers with greater rigidity can be desirable. Usable or optimum lengths of linker sequences can be determined by the skilled artisan. In some embodiments, the linker sequence is less than about 12, such as less than 10, or from 2-10 amino acids in length. In some embodiments, the first binding domain can be covalently linked to the second binding domain via the C- or N-terminus of the alpha chain or beta chain via a linker sequence selected from GGGGS (SEQ ID NO: 44), GGGSG (SEQ ID NO: 45), GGSGG (SEQ ID NO: 46), GSGGG (SEQ ID NO: 47), GSGGGP (SEQ ID NO: 48), GGEPS (SEQ ID NO: 49), GGEGGGP (SEQ ID NO: 50), GGEGGGSEGGGS (SEQ ID NO: 51), GGGSGGGG (SEQ ID NO: 52), GGGGSGGGGSGGGGSGGGGSGGGS (SEQ ID NO: 53), GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 54), EAAAK (SEQ ID NO: 55) and EAAAKEAAAKEAAAK (SEQ ID NO: 56).
[0109] In some embodiments, the first binding domain can be covalently linked to the C- or N-terminus of the second binding domain via a linker sequence of GGGGS (SEQ ID NO: 44). In some embodiments, the C-terminus of the first binding domain can be covalently linked to the N terminus of the beta chain via a linker sequence of GGGGS (SEQ ID NO: 44).[HO] In some embodiments, the first binding domain, i.e. the immune suppressor, sequence can optionally have zero, one, two, three, or four amino acid substitutions relative to the sequences recited above.[Hl] In some embodiments, the immune suppressor can comprise CDRs that are at least 90%, at least 95%, at least 98%, or at least 99% identical to the sequence of SEQ ID NO: 1, 2, and 3 as CDR1, CDR2 and CDR3, respectively.
[0112] In some embodiments, the first binding domain comprises CDRs with sequence as described in any of combinations 1-19 described below:
[0113] The skilled person would appreciate that the format of the multi-domain molecule of the disclosure could equally be applied to PD-1 agonist sequences other than those recited above.
[0114] In some embodiments, the first binding domain to PD-1 comprises an affinity, i.e., KD, in the range of about 1 nM to about 500 nM or in the range of about 50 nM to about 70 nM. In some embodiments, the first binding domain comprises a KD in the range of about 10 nM to about 500 nM, about 20 nM to about 400 nM, about 30 nM to about 300 nM, about 40 nM to about 200 nM, or about 50nM to about 100 nM. In some embodiments, the first binding domain comprises a KD in the range of about 50 nM to about 70 nM. In some embodiments, a first binding domain can have a binding half-life of from about 1 seconds to about 40 seconds, or preferably from about 15 seconds to about 20 seconds. The affinity of the first binding domain can be measured using methods described herein, e.g., in the examples, and by methods known to the skilled artisan.
[0115] In some embodiments, the first binding domain binds to an epitope in PD-1 comprising one or more or all of the following amino acids: E38, F59, P60, E61, T75, Q76,L77, P78, N79 and G80, numbered according to SEQ ID NO: 13. In some embodiments, the first binding domain binds to an epitope in PD-1 comprising two, three, four, five, six, seven, eight, nine or all 10 of the following amino acids: E38, F59, P60, E61, T75, Q76, L77, P78, N79 and G80, numbered according to SEQ ID NO: 13.
[0116] In some embodiments, the first binding domain comprises FR1-CDR1-FR2-CDR2- FR3-CDR3-FR4, wherein FR is a framework region, and wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - AVQLVESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 14), with zero, one, two or three mutations therein,FR2 - MTWVRQAPGKGPEWVSA (SEQ ID NO: 15), with zero, one, two or three mutations therein,FR3 -SYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYY (SEQ ID NO: 16), with zero, one, two or three mutations therein,FR4 - YLTYDRYGQGTLVTVSS (SEQ ID NO: 17), with zero, one, two or three mutations therein.
[0117] In some embodiments, the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 18 or a humanized version thereof, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 18. In some embodiments, the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 18 but with one, two, three, four, five, six, seven, eight, nine, ten, eleven or twelve mutations.
[0118] In some embodiments, the first binding domain comprises the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 20. In some embodiments, the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 20 but with one, two, three, four, five, six, seven, eight, nine, ten, eleven or twelve mutations.
[0119] As is well-known in the art, protein molecules such as the muti-domain molecules described herein, can be subject to post-translational modifications. Glycosylation is one such modification, which comprises the covalent attachment of oligosaccharide moieties todefined amino acids in an antibody chain. For example, asparagine residues, or serine / threonine residues are well-known locations for oligosaccharide attachment. The glycosylation status of a particular protein depends on a number of factors, including protein sequence, protein conformation and the availability of certain enzymes. Furthermore, glycosylation status (i.e., oligosaccharide type, covalent linkage and total number of attachments) can influence protein function. Therefore, when producing recombinant proteins, controlling glycosylation is often desirable. Controlled glycosylation has been used to improve antibody-based therapeutics. (Jefferis et al., (2009) Nat Rev Drug Discov Mar;8(3):226-34.). Glycosylation can be controlled, by using particular cell lines for example (including but not limited to mammalian cell lines such as Chinese hamster ovary (CHO) cells or human embryonic kidney (HEK) cells), or by chemical modification. Such modifications can be desirable, since glycosylation can improve pharmacokinetics, reduce immunogenicity and more closely mimic a native human protein (Sinclair and Elliott, (2005) Pharm Sci.Aug; 94(8): 1626-35). Alternatively, glycosylation can lead to a lack of consistency in manufacturing which is not desirable for a therapeutic molecule.77. Second binding domain
[0120] In some embodiments, the second binding domain of the multi-domain molecule described herein binds to a non-polymorphic, HLA-related molecule. In some embodiments, the non-polymorphic, HLA-related molecule comprises a CD1 epitope. In some embodiments, the CD1 epitope comprises a CD la, CD lb, CDlc, CD Id or a CDle epitope. Preferably, the second binding domain binds to CD la.
[0121] In some embodiments, the second binding domain is a VHH or scFv. In some embodiments, the second binding domain is a VHH. In some embodiments, the second binding domain is an anti-CDla VHH. In some embodiments, the second binding domain is a humanized anti-CDla VHH. In some embodiments, the second binding domain is a humanized llama anti-CDla VHH.
[0122] The terms “anti-CDla antibody” and “anti-CDla antibody fragment,” as used herein, mean antibodies or antibody fragments which recognize or bind to CD la. The anti-CDla HHV for use in the present disclosure can include one or more conservative substitutions which have a similar amino acid sequence and / or which retain the same function (i.e. are phenotypically silent). The skilled person is aware that various amino acids have similar properties and thus substitutions between them are “conservative”. One or more such aminoacids of a protein, polypeptide or peptide can often be substituted by one or more other such amino acids without eliminating a desired activity of that protein, polypeptide, or peptide. As used herein, the term “antibody” encompasses such fragments and variants. Examples of anti-CDla antibodies include but are not limited to RM393, NA1 / 34, OlO and EP80. Antibody fragments and variants / analogues which are suitable for use in the compositions and methods described herein include minibodies, Fab fragments, F(ab’)z fragments, dsFv and scFv fragments, Nanobodies™ (these constructs, marketed by Ablynx (Belgium), comprise synthetic single immunoglobulin variable heavy domain derived from a camelid (e.g. camel or llama) antibody) and Domain Antibodies (Domantis (Belgium), comprising an affinity matured single immunoglobulin variable heavy domain or immunoglobulin variable light domain) or alternative protein scaffolds that exhibit antibody like binding characteristics such as Affibodies (Affibody (Sweden), comprising engineered protein A scaffold) or Anticalins (Pieris (Germany)), comprising engineered anticalins) to name but a few.
[0123] In some embodiments, the second binding domain comprises a VHH antibody against CD la, a non-polymorphic, HLA -related molecule that is highly expressed on Langerhans cells and skin dendritic cells. CD la is an unrestricted target and accessible to all patients. In some embodiments, CDla presents lipids to CDla-autoreactive T cells, a subpopulation of T cells implicated in inflammatory skin diseases. In some embodiments, blockade of CDla-autoreactive T cells could provide a mode of action for CD la-targeted binding domain. In some embodiments, CDla antibodies show negligible cross-reactivity with CDlb-d expressing or antigen negative target cells. Ins some embodiments, the VHH CDla antibody binds to CDla epitopes distal to the F’ portal. In some embodiments, binding is not influenced by CD-I bound lipids. In some embodiments, the VHH CDla antibody binds to the side face of CDla antigen.
[0124] In some embodiments the seconding bind domain comprises a humanized llama anti- CDla VHH comprising one or more or all of the following amino acids: P24, F38, E45, R46, F48, A50, Y73, K75, V78, and G97, numbered according to SEQ ID NO: 21.
[0125] In some embodiments, the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, P87 and V97, numbered according to SEQ ID NO: 28.
[0126] In some embodiments, the humanized llama anti-CDla VHH comprises one or moreor all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, and G97, numbered according to SEQ ID NO: 29.
[0127] In some embodiments, the humanized llama anti-CDla VHH comprises a reduced hook effect. The hook effect refers to the prozone phenomenon, also known as antibody excess or the Postzone phenomenon, also known as antigen excess. It is an immunologic phenomenon whereby the effectiveness of antibodies to form immune complexes can be impaired when concentrations of an antibody or an antigen are very high. The formation of immune complexes stops increasing with greater concentrations and then decreases at extremely high concentrations, producing a hook shape on a graph of measurements. An important practical relevance of the phenomenon is as a type of interference that plagues certain immunoassays and nephelometric assays, resulting in false negatives or inaccurately low results. Other common forms of interference include antibody interference, crossreactivity and signal interference. The phenomenon is caused by very high concentrations of a particular analyte or antibody and is most prevalent in one-step (sandwich) immunoassays.
[0128] In some embodiments, the second binding domain is humanized to human IGHV3- 23*01 and / or human IGHJ*04. In some embodiments, the second binding domain is humanized to any human antibody chain variable region known in the art.
[0129] In some embodiments, the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), with zero, one, two or three mutations therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), with zero, one, two or three mutations therein.
[0130] In some embodiments, the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRAFRPHNVMA (SEQ ID NO: 5), with zero, one, two or three mutations therein,CDR2 - AARWSGIYYAESVKG (SEQ ID NO: 8), with zero, one, two or three mutations therein,CDR3 - STAQDMTLALMSDYDY (SEQ ID NO: 11), with zero, one, two or three mutations therein.
[0131] In some embodiments, the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein,CDR3 - GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
[0132] In some embodiments, CDR2 and CDR3 are defined by Kabat method. In some embodiments, CDR1 is defined by a union of Kabat and Chothia. See, e.g., Sulea, T. (2022). Humanization of Camelid Single-Domain Antibodies. In: Hussack, G., Henn', K.A.(eds) Single-Domain Antibodies. Methods in Molecular Biology, 2446, 299-312.
[0133] In some embodiments, the second binding domain comprises the following sequence: FR 1 -CDR1 -FR2-CDR2-FR3 -CDR3 -FR4
[0134] In some embodiments, FR is a framework region, wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - EVQLLESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 30), with zero, one, two or three mutations therein,FR2 - WVRQAPGKGLEWVS (SEQ ID NO: 31), with zero, one, two or three mutations therein,FR3 - RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAK (SEQ ID NO: 32), with zero, one, two or three mutations therein,FR4 - WGQGTLVTVSS (SEQ ID NO: 33), with zero, one, two or three mutations therein.
[0135] In some embodiments, the mutation(s) in the second binding domain framework regions are selected from A24P, V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 21.
[0136] In some embodiments, the mutation(s) in the second binding domain framework regions are selected from V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V, A87Pand A91N numbered according to SEQ ID NO: 28.
[0137] In some embodiments, the mutation(s) in the second binding domain framework regions are selected fromV38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 29.
[0138] In some embodiments, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 34 or a humanized version thereof, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%identity to SEQ ID NO: 21.
[0139] In some embodiments, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 35 or a humanized version thereof, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 28.
[0140] In some embodiments, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 36 or a humanized version thereof, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 29.
[0141] In some embodiments, the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27.
[0142] In some embodiments, the second binding domain can comprise CDRs that are at least 90%, at least 95%, at least 98%, or at least 99% identical to the sequence of SEQ ID NOs: 4, 7, and 10 as CDR1, CDR2 and CDR3, respectively. In some embodiments, the second binding domain can comprise CDRs that are at least 90%, at least 95%, at least 98%, or at least 99% identical to SEQ ID NO: 5, 8, and 11 as CDR1, CDR2 and CDR3, respectively. In some embodiments, the second binding domain can comprise CDRs that are at least 90%, at least 95%, at least 98%, or at least 99% identical to SEQ ID NO: 6, 9, and 12 as CDR1, CDR2 and CDR3, respectively.
[0143] In some embodiments, the second binding domain comprises CDRs with sequence asdescribed in any of combinations 1-19 described below:
[0144] In some embodiments, the second binding domain comprises CDRs with sequence as described in any of combinations 20-38 described below:
[0145] In some embodiments, the second binding domain comprises CDRs with sequence as described in any of combinations 39-57 described below:
[0146] In some embodiments, the second binding domain that binds to CD- la comprises KD in the range of about 100 pM to about 5000 pM or in the range of about 600 pM to about 3000 pM. In some embodiments, the second binding domain that binds to CD la comprises a KD in the range of about 200 pM to about 1000 pM, about 500 pM to about 4000 pM, about 700 pM to about 2000 pM, about 3000 pM to about 5000 pM, or about 100 pM to about 500 pM. In some embodiments, the second binding domain that binds to CD la comprises a KD in the range of about 700 pM to about 1000 pM, or 2000 to about 2500 pM.Hi. Half-life extending domains
[0147] In some embodiments, the multi-domain molecule described herein comprises a half-life extending domain. In some embodiments, the half-life extending domain comprises:(a) one or more amino acid substitutions which facilitate dimerisation of FC1 and FC2; and / or(b) one or more amino acid substitutions which prevent or reduce binding to FcyR; and / or(c) one or more amino acid substitutions which promote binding to FcRn.
[0148] A “half-life extending domain”, as used herein, refers to a protein domain for extending the half-life of the multi-domain binding protein, relative to a multi-domain binding protein lacking the half-life extending domain. The half-life extending domain comprises a first IgG Fc region (FC1) and a second IgG Fc region (FC2), wherein the FC1 region and FC2 region dimerise to form an Fc domain. As used herein, the term “Fc region” is used to refer to a region of a single polypeptide chain comprising at least a CH2 domain and a CH3 domain sequence, whereas the term “Fc domain” refers to a dimer of two Fc regions (i.e., FC1 and FC2).
[0149] WO 2020 / 157211 describes an approach for extending the half-life of a TCR-anti- CD3 fusion protein by fusing it to an IgG Fc domain. The present inventors have surprisingly found that the multi-domain binding molecules of the disclosure retain the extended half-life provided by the Fc domain in the format disclosed in WO 2020 / 157211, but, in addition, have significantly higher potency.
[0150] In some embodiments, (i) one of the FC1 and the FC2 in the disclosure described herein comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, T394S, F405A, Y407A, Y407T and Y407V according to SEQ ID NO: 37; and (ii) the other of the FC1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366W, T366Y, T366W, T394W and F405W according to SEQ ID NO: 37.
[0151] In some embodiments (i) one of the FC1 and the FC2 in the disclosure described herein comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, and Y407V according to SEQ ID NO: 37; and (ii) the other of the FC1 and the FC2 comprises a T366W amino acid substitution according to SEQ ID NO: 37.
[0152] In some embodiments, the half-life extending domain comprises one or more amino acid substitutions which attenuate an effector function of the Fc domain. In some embodiments, the half-life extending domain comprises one or more amino acidsubstitutions selected from the group consisting of S228P, E233P, L234A, L235A, L235E, L235P, G236R, G237A, P238S, F241A, V264A, D265A, H268A, D270A, N297A, N297G, N297Q, E318A, K322A, L328R, P329G, P329A, A330S, A330L, P331A and P331S according to SEQ ID NO: 37.
[0153] In some embodiments, the FC1 and / or the FC2 comprise a N297G amino acid substitution according to SEQ ID NO: 37.
[0154] In some embodiments, (a) either FC1 or FC2 comprises the amino acid sequence provided in SEQ ID NO: 38 or 39, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 38 or 39, and (b) the other of FC1 and FC2 comprises the amino acid sequence provided in SEQ ID NO: 40 or 41, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 40 or 41.
[0155] In some embodiments, the first binding domain of the multi-domain molecule described herein is linked to the C-terminus of the second binding domain by a linker and / or IgG hinge sequence. In some embodiments, the linker comprises the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein. In some embodiments, the C-terminus of the second binding domain is linked to the N- terminus of FC1 via an IgG hinge sequence. In some embodiments, the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2. In some embodiments, the IgG hinge comprises the amino acid sequence of SEQ ID NO: 43 or SEQ ID NO: 42
[0156] In some embodiments, the immunoglobulin Fc domain can be any antibody Fc domain. The Fc domain is the tail region of an antibody that interacts with cell surface Fc receptors and some proteins of the complement system. The Fc domain comprises two polypeptide chains (i.e., two Fc “regions”) both having two or three heavy chain constant domains (termed CH2, CH3 and CH4), and optionally a hinge region. In some embodiments, the two Fc region chains can be linked by one or more disulfide bonds within the hinge region. Fc domains from immunoglobulin subclasses IgGl, lgG2 and lgG4 can bind to and undergo FcRn mediated recycling, affording a long circulatory half-life (3 - 4 weeks), thus extending the half-life of the multidomain binding molecule of the disclosure. The interaction of IgG with FcRn has been localized in the Fc region covering parts of the CH2 and CH3 domains. Preferred immunoglobulin Fc domains for use in the present disclosure include but are not limited to Fc domains from IgGl or lgG4. For example, theFc domain can be an IgGl Fc domain, i.e., the FC1 and FC2 regions can be IgGl Fc regions. The Fc domain can be derived from human sequences.
[0157] In some embodiments, the FC1 region can comprise, or consist of, an amino acid sequence that is at least 80% identical to the sequence of SEQ ID NO: 38 or 39 and the FC2 region can comprise, or consist of, an amino acid sequence that is at least 80% identical to the sequence of SEQ ID NO: 40 or 41. In some embodiments, the FC1 region can comprise, or consist of, an amino acid sequence that is at least 90%, at least 95%, or at least 98% identical to the sequence of SEQ ID NO: 38 or 39 and the FC2 region can comprise an amino acid sequence that is at least 90%, at least 95%, or at least 98% identical to the sequence of SEQ ID NO: 40 or 41. Preferably, the FC1 region comprises the amino acid sequence provided in SEQ ID NO: 38 or 39 and the FC2 region comprises the amino acid sequence provided in SEQ ID NO: 40 or 41. As the skilled person would appreciate, the sequences provided above for FC1 and FC2 are suitable vice versa. For example, the FC1 region can comprise the amino acid sequence provided in SEQ ID NO: 38 or 39 and the FC2 region can comprise the amino acid sequence provided in SEQ ID NO: 40 or 41.
[0158] In some embodiments, the disclosure provides a multi-domain molecule as described herein, comprising the following amino acid sequences, in the following order, from N- terminus to C-terminus: (a) a first binding domain that binds to PD-1, optionally followed by a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO 44:; (b) a second binding domain that binds to CDlaa; (c) a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 44 followed by an IgG hinge sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 43; (d) an Fc region having the sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 38 or 39; (e) a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 44 followed by an IgG hinge sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 43; and (f) an Fc region having the sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 38.
[0159] In some embodiments, the disclosure provides a multi-domain molecule as described herein, comprising the following amino acid sequences, in the following order, from N- terminus to C-terminus: (a) a first binding domain that binds to PD-1, optionally followed by a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 44; (b) a second binding domain that binds to CD la; (c) a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 44 followed by an IgG hinge sequenceat least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 43; (d) an Fc region having the sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 18; (e) a linker sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 47 followed by an IgG hinge sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 43; and (f) an Fc region having the sequence at least 80%, at least 90%, or at least 95% identical to SEQ ID NO: 38.
[0160] In some embodiments, the Fc regions can comprise mutations relative to a wild-type or unmodified Fc sequence. Mutations include substitutions, insertions and deletions. Such mutations can be made for the purpose of introducing desirable therapeutic properties. For example, to facilitate hetero-dimerization, knobs into holes (KiH) mutations can be engineered into the CH3 domain. Thus, in some embodiments, the half-life extending domain can comprise one or more amino acid substitutions which facilitate dimerisation of the FC1 region and the FC2 region. Such substitutions include “Knob-in-hole” substitutions. In this case, one chain (i.e. one of the FC 1 or FC2 regions) is engineered to contain a bulky protruding residue (i.e. the knob), such as Y, and the other chain (i.e., the other of the FC1 and FC2 regions) is engineered to contain a complementary pocket (i.e. the hole). For example, a knob can be constructed by replacing a small amino acid side chain with a larger side chain. In some embodiments, a hole can be constructed by replacing a large amino acid side chain with a smaller side chain. Without wishing to be bound to theory, this is thought to stabilize a hetero-dimer of the FC 1 and FC2 regions by favouring formation of the hetero-dimer over other species, for example homomultimers of FC1 and FC2, thereby enhancing the stability and manufacturability of the multi-domain binding molecule of the disclosure.
[0161] Suitable positions and substitutions for KiH mutations, and other mutations for facilitating dimerization of Fc regions, are known in the art. For example, the substitutions forming corresponding knobs and holes in two Fc regions can correspond to one or more pairs provided in the following table:
[0162] The substitutions in the table above are denoted by the original residue, followed by the position using the EU numbering system as set forth in Kabat, and then the import residue (all residues are given in single-letter amino acid code). Multiple substitutions are separated by a colon.
[0163] In some embodiments, the FC1 and FC2 regions can comprise one or more substitutions in the table above. For example:(i) one of the FC 1 region and the FC2 region can comprise one or more amino acid substitutions selected from the group consisting of T366S, L368A, T394S, F405A, Y 407 A, Y 407T and Y407V, according to the EU numbering scheme at set forth in Kabat; and(ii) the other of the FC 1 region and the FC2 region can comprise one or more amino acid substitutions selected from the group consisting of T366W, T366Y, T366W, T394W and F405W according to the EU numbering scheme as set forth in Kabat. The substitutions in (i) and (ii) are hole-forming and knob-forming substitutions respectively. The FC1 region can comprise one or more of the substitutions in (i) and the FC2 region can comprise one or more of the substitutions in (ii).
[0164] For example:(i) one of the FC1 region and the FC2 region can comprise one or more amino acid substitutions selected from the group consisting of T366S, L368A, and Y 407V, according to the EU numbering scheme as set forth in Kabat; and(ii) the other of the FC 1 region and the FC2 region can comprise a T366W amino acid substitution, according to the EU numbering scheme as set forth in Kabat. The FC1 region can comprise one or more of the substitutions in (i) and the FC2 region can comprise the substitution in (ii).
[0165] In some embodiments, (i) one of the FC1 region and the FC2 region comprises T366S, L368A, and Y407V amino acid substitutions, according to the EU numbering scheme as set forth in Kabat; and (ii) the other of the FC1 region and the FC2 region comprises a T366W amino acid substitution, according to the EU numbering scheme as set forth in Kabat. For example, the FC1 region can comprise T366S, L368A, and Y407V amino acid substitutions, according to the EU numbering scheme as set forth in Kabat; and the FC2 region can comprise a T366W amino acid substitution, according to the EU numbering scheme as set forth in Kabat.
[0166] In some embodiments, the Fc domain can also comprise one or more mutations that attenuate an effector function of the Fc domain. Exemplary effector functions include, without limitation, complement-dependent cytotoxicity (CDC) and / or antibody-dependent cellular cytotoxicity (ADCC). The modification to attenuate effector function can be a modification that alters the glycosylation pattern of the Fc domain, e.g., a modification that results in an aglycosylated Fc domain. Alternatively, the modification to attenuate effector function can be a modification that does not alter the glycosylation pattern of the Fc domain. The modification to attenuate effector function can reduce or eliminate binding to human effector cells, binding to one or more Fc receptors, and / or binding to cells expressing an Fc receptor. For example, the half-life extending domain can comprise one or more amino acid substitutions selected from the group consisting of S228P, E233P, L234A, L235A, L235E, L235P, G236R, G237A, P238S, F241A, V264A, D265A, H268A, D270A, N297A, N297G, N297Q, E318A, K322A, L328R, P329G, P329A, A330S, A330L, P331A and P331S, according to the EU numbering scheme as set forth in Kabat. Particular modifications include aN297G or N297 A substitution in the Fc region of human IgGl (EU numbering as set forth in Kabat). Other suitable modifications include L234A, L235A and P329G substitutions in the Fc region of human IgGl (EU numbering as set forth in Kabat), that result in attenuated effector function. In some embodiments, the Fc regions in the multidomain binding molecule of the disclosure can comprise a substitution at residue N297, numbering according to EU index as set forth in Kabat. For example, the substitution can be an N297G or N297A substitution. Other suitable mutations (e.g., at residue N297) are known to those skilled in the art.
[0167] In some embodiments, Fc variants having reduced effector function refers to Fc variants that reduce effector function (e.g., CDC, ADCC, and / or binding to FcR, etc. activities) by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99% or more as compared to the effector function achieved by a wildtype Fc region (e.g., an Fc region not having a mutation to reduce effector function, although it can have other mutations). In some embodiments, the Fc variants having reduced effector function can be Fc variants that eliminate all detectable effector function as compared to a wild-type Fc region. Assays for measuring effector function are known in the art and described below.
[0168] In vitro and / or in vivo cytotoxicity assays can be conducted to confirm the reduction / depletion of CDC and / or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the Fc region or fusion protein lacks FcyR binding (hence likely lacking ADCC activity) but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g., Hellstrom, I. et al. Proc. NatT Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82: 1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166: 1351-1361 (1987)).
[0169] In some embodiments, substitutions can be introduced into the FC1 and FC2 regions that abrogate or reduce binding to Fey receptors and / or to increase binding to FcRn, and / or prevent Fab arm exchange, and / or remove protease sites. In this regard, the half-life extending domain can also comprise one or more amino acid substitutions which prevent or reduce binding to activating receptors. In some embodiments, the half-life extending domain can comprise one or more amino acid substitutions which prevent or reduce binding to FcyR. For example, the FC1 region and / or the FC2 region can comprise a N297G amino acid substitution, according to the EU numbering scheme as set forth in Kabat. Both the FC1 region and the FC2 region can comprise the N297G amino acid substitution.
[0170] In some embodiments, the half-life extending domain can comprise one or more amino acid substitutions which promote binding to FcRn. Methods of measuring binding to FcRn are known to the skilled artisan. Binding to FcRn in vivo and serum half-life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which thepolypeptides having a variant Fc region are administered.
[0171] In some embodiments, mutations can be made for manufacturing reasons, for example to remove or replace amino acids that can be subject to post-translational modifications such as glycosylation, as described herein. In some embodiments, the immunoglobulin Fc can be fused to the other domains (i.e., VC1 or VC2) in the molecule of the disclosure via a linker, and / or a hinge sequence as described herein. Alternatively, no linker can be used.
[0172] In some embodiments, the two Fc regions in the molecule of the disclosure can comprise CH2 and CH3 constant domains and all or part of a hinge sequence. In some embodiments, the hinge sequence can correspond substantially or partially to a hinge region from IgGl, lgG2, lgG3 or lgG4. The hinge sequence can be an IgGl hinge sequence, such as the amino acid sequence provided in SEQ ID NO: 43. In some embodiments the hinge can comprise all or part of a core hinge domain and all or part of a lower hinge region.
[0173] In some embodiments, the multi-domain molecule comprises the amino acid sequence provided in SEQ ID NO: 57 and 58, also known as CDla-PD-l-lmmTAAI. In some embodiments, cell-bound CDla-PD-1-lmmTAAI inhibits CD4 T cell activation and enhances CD4 T cell exhaustion. In some embodiments, these molecules exhibit picomolar potency in assays of PD-1 -mediated T cell suppression and blockade of CD la-auto reactive T cell activation. In some embodiments, activity is dependent on ImmTAAI tethering to target cells and the molecules are inactive in assays using CD la-negative or CDlb-d+ target cells. In some embodiments, CDla-targeted PD-1 agonist ImmTAAIs deliver localized inhibition of inflammatory T cells whilst avoiding systemic immunosuppression. In some embodiments, the CD la-PD-1 -ImmTAAI provides two modes of action, or at least one mode of action. In some embodiments, the CD la-PD-1 -ImmTAAI long-term pharmacodynamic effect on CD4 T cell is an advantage compared to competitor drugs. In some embodiments, the competitor drugs comprise corticosteroids, calcineurin inhibitors, anti-Hl antihistamines, allergen specific immunotherapy, Cyclosporin A, Methotrexate, Azathioprine, Mycophenolate mofetil, Crisaborole, Difamilast, Roflumilast, Ruxolitinib, Peresolimab, Abrocitinib, Upadacitinib, Tofacitinib, Brepocitinib, Baricitinib, Tapinarof, Asivatrep, Dupilumab, Tralokinumab, Lebrikizumab, Nemolizumab, Tezepelumab, Fezakinumab, GBR 830 Rocatinlimab, Omalizumab, Mepolizumab, Ustekinumb, Risakizumab, Secukinumab, Itepekimab, or any combination thereof.
[0174] In some embodiments, the disclosure comprises a method of making the multidomain molecule, comprising maintaining the host cell described above under optimal conditions for expression of the nucleic acid and isolating the multi-domain molecule. In some embodiments, the method comprises culturing a cell comprising a nucleic acid, wherein the nucleic acid encodes the multi-domain molecule. In some embodiments, the method comprises an expression vector comprising the nucleic acid encoding the multidomain molecule. In some embodiments, the method comprises culturing a host cell comprising the nucleic acid or the vector of this aspect, and then expressing the multidomain molecule in the cell and secreting it from the cell into the host cell culture supernatant.Method of making the multi-domain molecule
[0175] The disclosure herein provides a method of producing the multi-domain molecule or single domain antibody, the method comprising a) maintaining the cell under optimal conditions for expression of the multi-domain molecule or single domain antibody as described herein and b) isolating the multi-domain molecule or single domain antibody.
[0176] In some embodiments, the disclosure provides a nucleic acid, and / or a cell comprising a nucleic acid encoding the multi-domain molecule of the disclosure, which can be used to express the multi-domain molecule, and then the methods as described herein can be used to purify the multi-domain molecule from the host cell. The nucleic acid can be cDNA. The nucleic acid can be mRNA. The nucleic acid can be non-naturally occurring and / or purified and / or engineered. The nucleic acid sequence can be codon optimized, in accordance with the expression system utilized. As is known to those skilled in the art, expression systems can include bacterial cells such as E. coli, or yeast cells, or mammalian cells, or insect cells, or they can be cell free expression systems. Thus, in some embodiments, the methods described herein provide for expressing the multi-domain molecule in a host cell, wherein the multi-domain molecule is secreted into a host cell culture supernatant before the isolating the supernatant of the host cell culture comprising the multi-domain molecule. In some embodiments, the host cell for expressing multidomain molecule is a mammalian cell.
[0177] The present disclosure also provides constructs in the form of plasmids, vectors, transcription or expression cassettes which comprise at least one nucleic acid as described above. The present disclosure also provides a recombinant host cell which comprises one ormore constructs as above. As mentioned, a nucleic acid encoding a specific multi-domain molecule of the disclosure forms an aspect of the present disclosure, as does a method of production of the specific binding molecule comprising expression from a nucleic acid encoding a specific binding molecule of the disclosure. In some embodiments, expression can conveniently be achieved by culturing recombinant host cells containing the nucleic acid under appropriate conditions. Following production by expression, a specific multidomain molecule can be isolated and / or purified using any suitable technique, then used as appropriate.
[0178] Systems for cloning and expression of a polypeptide, i.e., the muti-domain molecule, in a variety of different host cells are well known. Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, NSO mouse melanoma cells and many others. A common, preferred bacterial host is E. coli. The expression of antibodies and antibody fragments in prokaryotic cells such as E.coli is well established in the art. For a review, see for example Pliickthun, Bio / Technology 9:545-551 (1991). Expression in eukaryotic cells in culture is also available to those skilled in the art as an option for production of a specific binding molecule, see for recent review, for example Reff, Curr. Opinion Biotech. 4:573-576 (1993); Trill et al., Curr. Opinion Biotech. 6:553-560 (1995).
[0179] Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. Vectors can include be any suitable vectors known in the art, including plasmids or viral vectors (e.g. 'phage, or phagemid), as appropriate. For further details see, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual: 2ndEdition, Cold Spring Harbor Laboratory Press (1989). Many known techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in Ausubel et al. eds., Short Protocols in Molecular Biology, 2nd Edition, John Wiley & Sons (1992).
[0180] The present disclosure also provides a host cell containing a nucleic acid encoding the multi-domain as disclosed herein. Further, the disclosure provides a method comprising introducing such nucleic acid into a host cell. The introduction can employ any available technique. For eukaryotic cells, suitable techniques can include calcium phosphatetransfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baculovirus. For bacterial cells, suitable techniques can include calcium chloride transformation, electroporation and transfection using bacteriophage. The introduction can be followed by causing or allowing expression from the nucleic acid, e.g. by culturing host cells under conditions for expression of the gene.
[0181] Suitable host cells for cloning or expression of polynucleotides and / or vectors of the present disclosure are known in the art. Suitable host cells for the expression of (glycosylated) proteins are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which can be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See, e.g., US 5,959,177, US 6,040,498, US 6,420,548, US 7,125,978, and US 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants). Vertebrate cells can also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension can be useful, other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham, F.L. et al., J. Gen Virol. 36 (1977) 59-74); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, J.P., Biol. Reprod. 23 (1980) 243-252); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MOCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells (as described, e.g., in Mather, J.P. et al., Annals N.Y. Acad. Sci. 383 (1982) 44-68); MRC 5 cells; and FS4 cells, other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub, G. et al., Proc. Natl. Acad. Sci. USA 77 (1980) 4216-4220); and myeloma cell lines such as YO, NS0 and Sp2 / 0. For a review of certain mammalian host cell lines suitable for protein production, see, e.g., Yazaki, P. and Wu, A.M., Methods in Molecular Biology, Vol. 248, Lo, B.K.C. (ed.), Humana Press, Totowa, NJ (2004), pp. 255-268. The host cell can be eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., YO, NS0, Sp20 cell).
[0182] In some embodiments, the nucleic acid of the disclosure can be integrated into the genome (e.g. chromosome) of the host cell. In some embodiments, integration can be promoted by inclusion of sequences which promote recombination with the genome, inaccordance with standard techniques.
[0183] Further provided herein are methods for making the multi-domain molecules described herein. The methods comprise maintaining the host cell of the disclosure under optimal conditions for expression of the nucleic acid or expression vector of the disclosure and isolating the multi-domain molecule.
[0184] Methods of producing recombinant proteins such as multi-domain molecules are well known in the art. Nucleic acids encoding the protein can be cloned into expression constructs or vectors, which are then transfected into host cells, such as E.coli cells, yeast cells, insect cells, or mammalian cells, such as simian COS cells, Chinese Hamster Ovary (CHO) cells, human embryonic kidney (HEK) cells, or myeloma cells that do not otherwise produce the protein. Exemplary mammalian cells used for expressing a protein are CHO cells, myeloma cells or HEK cells. Molecular cloning techniques to achieve these ends are known in the art and described, for example in Ausubel et al. (editors), Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-lnterscience (1988, including all updates until present) or Sambrook et al. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1989). A wide variety of cloning and in vitro amplification methods are suitable for the construction of recombinant nucleic acids.Methods of producing recombinant antibodies are also known in the art, see, e.g., US4816567 or US5530101.
[0185] In some embodiments, the nucleic acid encoding the multi-domain molecule can be inserted operably linked to a promoter in an expression construct or expression vector for further cloning (amplification of the DNA) or for expression in a cell-free system or in cells. As used herein, the term "promoter" is to be taken in its broadest context and includes the transcriptional regulatory sequences of a genomic gene, including the TATA box or initiator element, which is required for accurate transcription initiation, with or without additional regulatory elements (e.g., upstream activating sequences, transcription factor binding sites, enhancers and silencers) that alter expression of a nucleic acid, e.g., in response to a developmental and / or external stimulus, or in a tissue specific manner. In the present context, the term "promoter" is also used to describe a recombinant, synthetic or fusion nucleic acid, or derivative which confers, activates or enhances the expression of a nucleic acid to which it is operably linked. Exemplary promoters can contain additional copies of one or more specific regulatory elements to further enhance expression and / or alter the spatial expression and / or temporal expression of said nucleic acid. As used herein,the term "operably linked to" means positioning a promoter relative to a nucleic acid such that expression of the nucleic acid is controlled by the promoter.
[0186] Many vectors for expression of a protein in cells, e.g., the multi-domain molecules, are commercially available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, a sequence encoding a protein (e.g., derived from the information provided herein), an enhancer element, a promoter, and a transcription termination sequence. The skilled person will be aware of suitable sequences for expression of a protein. Exemplary signal sequences include prokaryotic secretion signals (e.g., pel B, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II), yeast secretion signals (e.g., invertase leader, a factor leader, or acid phosphatase leader) or mammalian secretion signals (e.g., herpes simplex gD signal).
[0187] Exemplary promoters active in mammalian cells include cytomegalovirus immediate early promoter (CMV-IE), human elongation factor 1-a promoter (EFl), small nuclear RNA promoters (Ula and Ulb), a-myosin heavy chain promoter, Simian virus 40 promoter (SV40), Rous sarcoma virus promoter (RSV), Adenovirus major late promoter, !3-actin promoter; hybrid regulatory element comprising a CMV enhancer / ! 3-actin promoter or an immunoglobulin promoter or an active fragment thereof. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture); baby hamster kidney cells (BHK, ATCC CCL 1 O); or Chinese hamster ovary cells (CHO).
[0188] Typical promoters suitable for expression in yeast cells such as for example a yeast cell selected from the group comprising Pichia pastoris, Saccharomyces cerevisiae and S. pombe, include, but are not limited to, the ADH1 promoter, the GAL 1 promoter, the GALA promoter, the CUP1 promoter, the PHOS promoter, the nmt promoter, the RPR 1 promoter, or the TEF 1 promoter.
[0189] The host cells used to produce the protein can be cultured in a variety of media, depending on the cell type used. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPM1-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing mammalian cells. Media for culturing other cell types discussed herein are known in the art.Methods of treating autoimmune conditions
[0190] The present disclosure includes methods which comprise administering to a subject in need thereof a therapeutic composition comprising the multi-domain molecule. As used herein, the expression “a subject in need thereof’ means a human or non-human animal that exhibits one or more symptoms or indicia of an autoimmune condition. In some embodiments, the autoimmune disease is atopic dermatitis, diabetes, e.g., type 1 diabetes, allergic rhinitis, asthma, Crohn’s disease, psoriasis and / or skin lichenoid diseases. In some embodiments, “a subject in need thereof’ means a human or non-human animal, and / or who has been diagnosed with an autoimmune disease, e.g., atopic dermatitis, diabetes, e.g., type 1 diabetes, allergic rhinitis, asthma, Crohn’s disease, psoriasis and / or skin lichenoid diseases. In some embodiments, “a subject in need thereof’ means a human or non-human animal, and / or who has been diagnosed with being predisposed to an autoimmune disease, e.g., atopic dermatitis, diabetes, e.g., type 1 diabetes, allergic rhinitis, asthma, Crohn’s disease, psoriasis and / or skin lichenoid diseases, independent of whether any symptoms of such disease have been manifest.
[0191] In some embodiments, the disclosure provides a method of treating atopic dermatisis. Atopic dermatitis (AD) is a chronic / relapsing inflammatory skin disease characterized by intense pruritus (i.e., itchiness), xerosis (skin dryness), and eczematous lesions whose features include erythema, infiltration / papulation, oozing with crusting, excoriations, and lichenification. Thus, in some embodiments, the disclosure provides a method of reducing pruritus (i.e., itchiness), xerosis (skin dryness), and eczematous lesions. It is often associated with other atopic disorders, such as allergic rhinitis and asthma. Severe disease can be extremely disabling due to several factors: major psychological problems, significant sleep loss, and impaired quality of life (QOL) that lead to a high socioeconomic cost. An estimated 2% to 10% of adults are affected by AD (Bieber 2008, N. Engl. J. Med. 358: 1483-94).
[0192] The pathophysiology of AD is influenced by a complex interplay between inflammation, environmental factors, genetics and skin barrier dysfunction. AD is the most common inflammatory skin disease in childhood (Illi et al 2004, J. Allergy Clin. Immunol. 113: 925-31). The disease usually presents during early infancy and childhood, but it can persist into or start in adulthood (Kay et al 1994, J. Am. Acad. Dermatol. 30: 35-9). The disease affects 15 to 30% of children and 2 to 10% of adults in industrialized countries (Bieber 2008, N. Engl. J. Med. 358: 1483-94). Phase 1 of the International Study of Asthmaand Allergies in Childhood showed a 1-year period prevalence rate as high as 20% in Australia, England, and Scandinavia (Williams et al 1999, J. Allergy Clin. Immunol. 103: 125-38). Often AD constitutes the first step of atopic march (progression from one atopic disease to another). Approximately up to 60% of AD patients have concomitant asthma or allergic rhinitis or food allergy (Hong et al 2012, Envt. Health Toxicol. 27: e2012006).
[0193] Topical corticosteroids (TCS) are frequently prescribed for treatment of AD patients. However, long-term application of TCS is not recommended because of the risk of skin atrophy, dyspigmentation, acneiform eruptions, and risks associated with systemic absorption (e.g., hypothalamic pituitary axis effects, Cushing's disease, etc.). Topical calcineurin inhibitors (TCI) are generally effective and safe as short-term treatments, but concerns of skin malignancies and increased risk of lymphomas have prompted regulatory authorities to require a warning regarding the long-term safety of topical tacrolimus and pimecrolimus in their prescribing information. Repeated application of any topical therapy over a long period of time or to large surface areas also leads to reduced patient compliance. First generation antihistamines are widely prescribed for acute symptomatic treatment of pruritus, although their effectiveness is limited and largely attributed to their sedating effect. Oral immunosuppressants (Schmitt et al 2007, JEADV 21: 606-619) and glucocorticoids are effective, but are sometimes associated with severe toxicity and side effects, thus limiting their use to short courses and / or intermittent therapy. No systemic agents are approved in the treatment of AD in children. All systemic agents are used off label (cyclosporine, methotrexate, azathioprine, mycophenolate mofetil, systemic corticosteroids) and lack evidence basis of use. All of these agents have a broad immunosuppressive effect which predisposes the patients to serious infections and increased risk of malignancies if used for prolonged periods. Other reported significant side effects with these agents include gastritis, stunted growth, diabetes, weight gain, hypertension, osteoporosis and adrenal suppression (corticosteroids), nephrotoxicity, hypertension, tremor, hypertrichosis, headache, gingival hyperplasia (cyclosporine), gastrointestinal disturbances, ulcerative stomatitis, myelosuppression, hepatotoxicity and pulmonary fibrosis (methotrexate), hypersensitivity reactions, elevated liver enzymes and leukopenia (azathioprine). Moreover, a high proportion of patients in which disease is initially controlled by systemic agents suffer from relapse once therapy is discontinued (Granlund et al 1995, Br. J. Dermatol. 132: 106-112; Schmitt et al 2009, Br. J. Dermatol. 162: 661-8).
[0194] In some embodiments, the present disclosure provides a method for measuring levelsof soluble PD-1 (sPDl) from a sample in the subject. In embodiments, increased levels of soluble PD-1 (sPDl) indicate PD-1 binding and engagement. In embodiments, increased levels of soluble PD-1 (sPDl) indicate CD la binding and engagement. In embodiments, increased levels of soluble PD-1 (sPDl) indicate simultaneous CD la and PD-1 binding and engagement.
[0195] In some embodiments, the present disclosure provides a method for measuring engagement, or efficacy of engagement, of the multi-domain molecule, the single domain antibody, or the bispecific molecule described herein with a target PD-1 marker and / or a a target CD la marker, in a subject, wherein the method comprises administering to the subject the multi-domain molecule, single domain antibody, or bispecific molecule and measuring a level of soluble PD-1 (sPD-1) in a biological sample obtained from the subject. In embodiments, a relative increase in the measured level of sPD-1 indicates engagement of the multi-domain molecule, single domain antibody, or bispecific molecule with the target PD-1 marker and / or target CD la marker. In embodiments, the measured level of sPD-1 is increased at least about 1.5 fold, about 2 fold, about 3 fold, about 4 fold, about 5 fold, about 6 fold, about 7 fold, about 8 fold, about 10 fold, or about 20 fold relative to a sample obtained from a subject not treated with the multi-domain molecule, single domain antibody, or bispecific molecule of the present disclosure.
[0196] In some embodiments, the present disclosure provides a method of treating an autoimmune disease in a subject, the method comprising: (i) determining a baseline level (TO) of soluble PD-1 (sPD-1) in a biological sample obtained from the subject, (ii) administering to the subject a first dosage amount of a multi-domain molecule binding to PD-1 and CD la, and (iii) determining a level of sPD-1 (Tl) after (ii) in a biological sample obtained from the subject. In embodiments, if the Tl level of sPD-1 is greater than or equal to the TO level, then a second dosage amount of the multi-domain molecule is administered. In embodiments, the second dosage amount is the same or less than the first dosage amount. In embodiments, if the Tl level of sPD-1 is less than TO, then the second dosage amount of the multi-domain molecule is greater than the first dosage amount and / or further comprises administering a second autoimmune disease treatment.
[0197] In some embodiments, the present disclosure provides a method of enhancing T cell exhaustion comprising administering a multi-domain molecule simultaneously targeting PD-1 and CDla. In embodiments, T cell activation is reduced following administration of the multi-domain molecule. In embodiments, cytokine release is reduced followingadministration of the multi-domain molecule.Description of the sequencesTable 1EXAMPLES
[0198] The present disclosure has been described with respect to representative examples that are to be considered illustrative embodiments that do not limit the scope of the disclosure which is defined solely by the claims. All references to publications, including scientific publications, treatises, textbooks, patent applications and issued patents are hereby incorporated by reference for all purposes.Example 1: CDla-targeted PD-1 ImmTAAIs are functional in vitro
[0199] Molecules of the present disclosure were designed to simultaneously bind to PD1 and CD la for use in the treatment of autoimmune diseases. FIG. 1A is a schematic showing the dual modes of action of a CDla-targeted PD-1 ImmTAAI where one mode of actioncorresponds to suppression of PD-1+ T cells via PD-1 mediated T cell inhibition, and the second mode of action corresponds to inhibition of CD la autoreactive T cells via blockade of CD la. Binding of the molecules to CD la provided the further benefit that suppression of PD-1+ T cells occurs in a tissue-specific manner as binding to the CDla target localizes PD-1 agonist activity to the relevant site and cells. The PD- 1 / CD la dual targeting approach was further validated by results of immunochemistry studies shown in FIG. IB demonstrating high levels of CDla expression on skin APCs in healthy and AD lesional skin. CDla was undetectable in all other tissues tested using an IHC normal tissue array comprising thirty-five (35) different tissues. a. Production of antibodies
[0200] Generation and construction of dual action molecules effectively targeting both PD-1 and CDla involved multiple complex and nuanced steps as described below and set forth in FIG. 2. Phage display libraries derived from multiple sources, including chicken, llama and human were first utilized to select for CDla antibodies. CD la-directed antibody libraries were generated by immunization of chickens and llamas with recombinant human CDla protein. Chicken scFv phage libraries and llama VHH phage libraries were constructed using these CD la-directed antibody libraries. The CD la-directed chicken scFv phage libraries, the CD la-directed llama VHH phage libraries, a naive llama VHH phage library, a naive human ScFv library, and a naive human kappa light chain library were subjected to 3 rounds of panning on immobilized Biotinylated protein (FIG. 2) resulting in selection of over 800 CD la-specific clones. These clones were further evaluated for specific binding to CDla, and lack of binding to CDlb or CDlc, resulting in just over 400 clones for subsequent rounds of evaluation. The next round starting with the over 400 clones involved selection of unique sequences followed by further binding analyses to CDla Raji A2 cells and Jurkat cell lines. This targeted approach resulted in 126 CDla antibodies, all of which were reformatted as bispecific molecules each comprising a CDla antibody sequence linked to a humanized PD-1 VHH antibody. Different formats comprising the CDla antibodies and PD-1 VHH antibody were designed to test the two domains in different orientations and positions relative to one another in the next rounds of selection. The various dual formats (referred to by a “Mol” designation underneath each format) are pictured diagrammatically in FIG.3.
[0201] Once reformatted, these bispecific molecules underwent cell screening for PD-1 agonist function utilizing a Raji CDla: Jurkat NFAT PD-1 reporter assay. About half of the126 reformated bispecific molecules showed greater activity as compared to CR2113, a high-affinity human anti-CD la monoclonal antibody. Following this, the half of the 126 showing this greater activity were subjected to further biochemical affinity and crossreactivity assessments. In particular, surface plasmon resonance (SPR) binding analysis was performed to assess CD la affinity, and cross-reactivity against CD lb, CDlc, and CD Id were conducted. At the end of this process following this rigorous combination of steps and analyses, eight llama VHH (Ab002, Ab007, Ab052, Ab092, Ab062, Ab076, Ab077, and Ab096 with amino acid sequences according to SEQ ID NO: 34-36, 66, 122, 126, 130, and 68, respectively), and four human scFv antibody fragments (Abl06, Abl09, Abl 14 and Abl 16 with amino acid sequences according to SEQ ID NO: 118-121, respectively) were selected for half-life extension studies described further below. The PD- 1 agonist VHH had a KD value in the range of 50-70 nM and a binding half-life in the range of 15-20 seconds. The sequence of the PD-1 VHH domain is provided in SEQ ID NO: 18 and a humanised variant of the same VHH is provided in SEQ ID NO: 20.
[0202] Crystallography was used to map the epitope recognised by the PD-1 agonist VHH. All three CDR loops were shown to mediate contacts to PD-1. Molecular modelling showed that the epitope was located away from the membrane proximal region and was adjacent to but did not overlap with the binding site for PD-L1, in line with Biacore competition measurements. The key residues that the PD-1 agonist VHH (SEQ ID NO: 18 and 20) were identified to bind to are indicated in bold text in the sequence of the extracellular domain of human PD-1 below (SEQ ID NO: 13). See, e.g., GB 2306345.6, filed April 28, 2023, incorporated herein in its entirety. b. In vitro function - Raji CDla : Jurkat NFAT PD-1 reporter assay
[0203] CDla-PD-l bispecific agonist ImmTAAIs were tested for CDla targeting -dependent inhibition of TCR activation in a Raji CDla : Jurkat NFAT PD-1 reporter assay, where Raji A2 cells were either CDla-positive or CDla-negative (FIG. 4 and FIG. 5A-5D).
[0204] Raji cells transduced with an HLA-A*02 [32 -microglobulin (Raji-A2), with or without lentiviral transduction, were used as APCs.
[0205] Briefly, Jurkat NFAT Mel5 PD-1 CDla (B2M CRISPR KO) cells, expressing i) a TCR specific for an HLA-A*02 restricted peptide from Melan A (ELAGIGILTV), ii) PD-1, and iii) a luciferase reporter driven by an NFAT-response element were incubated with CDla-positive Raji-A2 cells and pulsed with a peptide derived from Melan A to triggerTCR signaling and NF AT promoter-mediated luminescence. In the presence of humanized half-life extended variants of CDla-PD-1 bispecific agonist ImmTAAIs comprising Ab002.10-H5 (SEQ ID NO: 57 and SEQ ID NO: 58), Ab007.11-H5 (SEQ ID NO: 69 and SEQ ID NO: 58), Ab052.9-H5 (SEQ ID NO: 70 and SEQ ID NO: 58), Ab092.6-H5 (SEQ 71 ID NO: and SEQ ID NO: 58) or Ab096.12-H5 (SEQ ID NO: 72 and SEQ ID NO: 58), TCR-stimulated NFAT activation was reduced (FIG. 5 A). Control experiments were performed using CD la-negative Raji-A2 cells.
[0206] Raji-A2 APCs (± CDla expression) were harvested and re-suspended in assay buffer (RPMI 1640 with 1-glutamine, 10% FBS) at 2xl06cells / ml. Raji cells were pulsed with Melan A peptide for 2 hours at 37°C, 5% CO2 and plated at 50,000 cells / well into white, flat-bottom 96-well assay plates. Assay buffer alone or assay buffer containing titrations of CDla-PD-1 bispecific agonist ImmTAAIs was added. The assay was initiated by immediately adding 50,000 Jurkat NFL Mel5 PD-1 effector cells and incubating for 16-20 hours at 37°C, 5% CO2. Bioluminescent signal was detected and quantified using Bio- Glo™ Luciferase Assay System (Promega) and a luminometer (CLARIOstar). NFAT activity was normalized against TCR-stimulated controls and dose-response data was analyzed in Prism (GraphPad) using a four-parameter, non-linear least-squares fit to determine IC50 values. c. Crystallography
[0207] Crystallography was used to map the epitope recognized by CDla antibodies (FIG. 6). Crystal structures show that Ab002 WT (SEQ ID NO: 24), Ab007 WT (SEQ ID NO: 35) and Ab096 WT (SEQ ID NO: 68) VHH CDla antibodies bind CDla epitopes distal to the F’ portal, and that binding of these antibodies is unlikely to be influenced by lipids bound to CD1. Ab002 WT and Ab096 WT bind to the side face of CDla. Ab007 WT has a small footprint on the A’ roof. Molecular modeling shows that Ab052 WT (SEQ ID NO: 36) is predicted to bind a similar epitope to that bound by Ab002. Variants of the Ab002 WT, Ab007 WT, and Ab096 WT VHH CDla antibodies would be predicted to bind in a similar fashion to their wildtype counterparts.Example 2: Half-life extending (Fc) domain a. Half-life extension selection
[0208] Because autoimmune diseases, including AD, are often chronic conditions requiring sustained treatment, the ability to increase the half-life for therapeutic candidates, and thus have the potential to be dosed less frequently, is particularly important. To extend in vivo half-life of the bispecific molecules, Knob-in-hole Fc (IgGl, truncated hinge N297G comprising SEQ ID NO: 40 was attached to the N- or C-terminus of the CDla-PD-1 scFv and VHH molecules. FIG. 3 provides a schematic of the resulting half-life-extended (HLE) CDla-PD-1 bispecific agonist ImmTAAIs.
[0209] The in vitro function of the half-life-extended (HLE) CDla-PD-1 bispecific agonist ImmTAAIs was characterized using the Raji CD la : Jurkat NFAT PD-1 reporter assay as described above (FIG. 4). The mol427 Fc HLE format (as shown in FIG. 3, 10A, 11A and 13A) was selected for further studies. b. Mammalian expression of HLE-fusions
[0210] Half-life extended (Fc-fusion) bispecific molecules were expressed in ExpiCHO cells using the Thermo ExpiCHO™ transient expression protocol, followed by purification using Protein A chromatography and size exclusion chromatography. Ab002 WT was expressed and purified with an average yield of about 60mg / L.Example 3: Binding characterization of CDla-PD-1 bispecific agonist ImmTAAIs a. Binding characterization
[0211] High affinity interactions binding parameters were determined by single cycle kinetics analysis. Five different concentrations of bispecific molecules were injected over a flow cell coated with -100 - 200 RU (or 50 -100 RU for Biacore 8K instrument) of CD la complex using a flow rate of 50-60 pl min-1. Typically, 60-120 pl (or approx. 240 pl for Biacore 8K instrument) of bispecific molecule was injected at a top concentration of between 50-100 nM (or 2-50 nM for Biacore 8K instrument), with successive 2-fold dilutions used for the other four injections. The lowest concentration was injected first. To measure the dissociation phase, buffer was injected until10% dissociation occurred, typically after 1 - 3 hours. Kinetic parameters were calculated using BIAe valuation® software. The dissociation phase was fitted to a single exponential decay equation enabling calculation of half-life. The equilibrium constant kD was calculated from koff / kon.Measurements were performed at 25 °C or 37°C in Dulbecco’s PBS buffer. The relatively greatest retention of PD-1 agonist activity with VHH antibodies was found in mol427 Fc HLE format. Trivalent (mol423 / 430) and tetravalent formats (mol419 / 428) were not tolerated. The Ab002.10, Ab007.11 and Ab096.12 CDla antibodies showed negligible cross-reactivity with CDlb-d expressing or antigen negative cells. A kD value less than 1 nM was observed for the targeting arm (CDla) with a half-life greater than 30 minutes at 37 °C. The ability to bind CDla was observed in normal and diseased skin, with lipid agnostic binding to CDla. The ability to block CDla autoreactive T cell activity in bispecific format was also observed.Example 4: Mechanism of action a. Inhibition of primary CD4 T cell function
[0212] CDla-PD-l bispecific agonist ImmTAAIs as described in Example 1 were tested for CD la targeting dependent inhibition of Staphylococcal Enterotoxin B (SEB)-stimulated primary human CD4 T cells. FIG. 7A is a schematic representing the assay used to test this inhibition. FIG. 7B presents the results of CD4 T cell activation (represented by the level of IL-2 cytokine released) in dose response studies of a half-life extended version of Ab002.10 (CDla Ab002.10 HLE)and the tool antibody CR2113 in the Raji SEB human CD4 T cell IL-2 assay using CD la-positive or CD la-negative Raji target cells.
[0213] Primary human CD4+ T cells were isolated from PBMCs using a CD4 T cell isolation kit (Miltenyi). Raji-A2 cells were used as APCs. T cells were pre-activated by SEB- loaded (Staphylococcal enterotoxin B, Sigma), CDla-positive Raji-A2 cells to induce PD-1 expression. Pre-activated CD4 PD-1+T cells were subsequently restimulated with SEB- loaded Raji CDla-positive or Raji CD la-negative cells in the presence or absence of wildtype CDla-PD-1 bispecific agonist ImmTAAIs or the CDla antibody CR2113 (disclosed in US7968092B2). Supernatants were collected after 48h and IL-2 levels were measured by ELISA (IL2 Ready-SET-Go! ELISA, Invitrogen). IL-2 release was normalized against SEB-stimulated controls and dose response data was analyzed in Prism (GraphPad) using a four-parameter, non-linear, least squares fit to determine IC50 values. As shown in FIG. 7B, Ab002-H5 using CDla-positive cells showed inhibition of SEB-stimulated primary human CD4 T cells, and showed increased inhibition as compared to CR2113. FIG. 7C shows results in this same assay for HLE versions of Ab002-H5, Ab007-H5, Ab052-H5, Ab092-H5, and Ab096-H5 . All of these molecules demonstrated inhibition of SEB-stimulated primary human CD4 T cells with the relative level of inhibition indicated in FIG. 7C. b. CDla ImmTAAIs specifically bind to CDla-positive APCs
[0214] Healthy human skin explants were incubated with 200 nM AF647-labelled CDla ImmTAAI (the HLE version of Ab002: SEQ ID NO: 73 and SEQ ID NO: 58) for 24h. Skin sections were stained with anti-CDla-AF488 and DAPI. FIG. 8 shows that the HLE Ab002 CDla ImmTAAI bound specifically to CDla-positive APCs in human cell explants. c. Inhibition of primary Langerhans cell-stimulated T cell activation[215JCD14- monocytes were differentiated into Langerhans cells (monocyte-derived Langerhan cells or MoLCs) for 6 days using a method adapted from Otsuka et al (J. Immunol, 2018, 201 (10): 3006-3016). Briefly, PBMCs were prepared from fresh blood donations and CD14 monocytes isolated using Miltenyi CD14 beads as per manufacturer’s instructions. 500ul CD14+monocytes at 2xl06cells / ml were plated into 24-well plates and 500 ul of 2x Langerhans cell (LC) differentiation media (200 ng / ml GM-CSF, 20 ng / ml IL- 4, 20 ng / ml TGFp, 40 ng / ml TNFa, 100 pM 2-ME) made up in R10 media added to 500 ul of cells. LC differentiation media was replaced on days 2 and 5, with IL-4 removed after 48 h. On day 5, LCs were detached, resuspended in LC differentiation media without IL-4 and plated at 20,000 cells / ml into white, flat-bottom 96-well assay plates and incubated for 24 hours at 37°C, 5% CO2. On day 6, assay buffer alone or assay buffer containing titrations of CDla-PD-1 bispecific agonist ImmTAAIs, in the presence or absence of a PD-L1 blocking antibody, was added. The assay was initiated by immediately adding 50,000 Jurkat NFAT Mel5 PD-1 CDla" effector cells and incubating for 16-20 hours at 37°C, 5%CO2. Bioluminescent signal was detected and quantified using Bio-Gio™ Luciferase Assay System (Promega) and a luminometer (CLARIOstar). NFAT activity was normalized against TCR-stimulated controls and dose-response data was analyzed in Prism (GraphPad) using a four-parameter, non-linear least-squares fit to determine IC50 values. Phenotyping of the MoLCs was conducted by flow cytometry. FIG. 9A contains flow cytometry data for the differentiated MoLCs. CDla ImmTAAI dose-response studies were conducted in an assay where SEB-pulsed MoLCs stimulated Jurkat NFAT PD-1 reporter cells in the presence or absence of PD-L1 blocking antibody. FIG. 9B is a schematic representing the assay utilized for this experiment, and FIG. 9C presents data from the assay for the CDla Ab002.10-HLE molecule under conditions where PD-L1 was eitheractive or blocked (anti-PD-Ll). When PD-L1 activity was blocked, the presence of the bispecific resulted in a dose -dependent suppression of NFAT activity. When PD-L1 was active, NFAT activity was suppressed as compared to PD-L1 being blocked. The presence of the bispecific under the PD-L1 active condition resulted in further additive suppression of NFAT activity in a dose-dependent manner. The results confirmed that CD la-targeted ImmTAAIs tested, in particular, HLE versions of Ab002 WT, Ab007 WT and Ab096 WT, are active in a model that uses primary human LCs with endogenous CD la. d. Blockade of primary CDla autoreactive T cells
[0216] CDla+ K562 cells were used to stimulate primary PBMC-derived CDla autoreactive T cells. FIG. 10A is a schematic showing the biological mechanism for how CDla+ K562 cells can be utilized to demonstrate blockade of primary CDla autoreactive T cells.Briefly, polyclonal CD3+ T cells were isolated from frozen PBMCs from healthy volunteers and maintained in complete RPMI (1640 RPMI, 10% FBS, P / S, L-Glu) and 200 U / ml of IL-2 (Proteintech). After 48 hours, IL-2 was removed from the media and T cells rested overnight in complete RPMI. K562 cells lentivirally transduced with CDla presenting undefined endogenous lipid antigen were used to stimulate polyclonal CD3+ T cells in an overnight culture at a 1:2 ratio of K562CDla and T cells, respectively, in the presence or absence of CDla-PD-1 bispecific agonist ImmTAAIs or a commercially available CD la-blocking antibody (clone HI 149). IFNy-release was detected using IFNy- ELISpot (BD Biosciences) and ELISpot plates scanned and IFNy-release quantified on ImmunoSpot plate reader and software. FIG. 10B shows IFNy producing CD3+ T cell stimulation in the absence of CDla K562 cells (first bar from left). When CDla+ K562 cells are added, T cell stimulation is increased (second bar from left). This stimulation can be abrogated in the presence of an anti-CDla antibody (third bar from the left), but not a negative control (fourth bar from left). This stimulation is also abrograted in a dosedependent manner in the presence of the CDla Ab002 WT HLE H5 molecule (fourth, fifth and sixth graphs from left).[217JFIG 11A is a schematic drawing showing the biological mechanism for how the assay assesses blockade of a CDla TCR reporter construct. FIG 11C presents NFAT activity from CDla TCR Jurkat NFAT reporter cells. A CDla-specific TCR was expressed in a TCR knockout Jurkat NFAT reporter line. K562 cells lentivirally transduced with CDla were used to stimulate the Jurkat CDla TCR NFAT reporter cell line in the presence or absence of HLE CDla-PD-1 bispecific agonist ImmTAAIs (HLE-Ab002 WT-H5, HLE Ab007 WT-H5, HLE Ab052 WT-H5, HLE Ab092 WT-H5, or HLE Ab096 WT-H5), or a commercially available CD la-blocking antibody (clone HI 149). The Jurkat CDla NFAT reporter cell line does not express PD-1 and allows interrogation of the CDla TCR blockade.Bioluminescent signal was detected and quantified using Bio-Gio™ Luciferase Assay System (Promega) and a luminometer (CLARIOstar), as described above. NFAT activity was normalized against TCR-stimulated controls and dose-response data was analyzed in Prism (GraphPad) using a four-parameter, non-linear least-squares fit to determine IC50 values.Example 5: Humanization of HLE CDla-PDl ImmTAAIs
[0218] As described above in Example 2a, several of the selected CDla-PDl ImmTAAIs designed to be in the mol427 format (as depicted in FIG. 12A) were further humanized. The strategy for humanization that was undertaken included (1) grafting human framework (FW) (H' V3-23*01), (2) evaluating llama residues for stability, structure and CDR conformation, (3) designing a panel of back mutants, (4) checking expression, stability and binding of the humanized versions of the construct, and (5) refining humanization-single point mutations to identify key llama residues on selected clones. The stability and binding of humanized and half-life extended variants of Ab002. 10, Ab007. 11, Ab052.9, and Ab096. 12 is shown in FIG 12B.
[0219] Additional engineering of the molecules was performed to further humanize the selected ImmTAAI molecules. Ab002.10. 18nR and Ab002.10.21nR each comprise a VHH CD1 domain humanized to about 94%, e.g., 94 ± 1-2%. The further humanization of these molecules, such as Ab002. 10, was performed to provide a more optimal molecule for the purposes of both manufacturing and for therapeutic treatment. The re-engineeredAb002. 10. 18nR molecule demonstrated a kD at 37°C of about 1 nM (in the range of 904pM to 1.50 nM), preserving the affinity of the previous optimized variant and the advantageous features of the HLE domain while also including additional humanization to minimize potential side effects for use in treatment. The Ab002.10.18nR and Ab002.10.21.nR variants demonstrated CD la-targeting dependent inhibition using the Raji CDla Jurkat reporter assay (as described above and shown in FIG. 4 and FIG. 5A-5D), dose- and targeting -dependent inhibition of primary CD4 T cell function using the Raji A2 CDla SEB CD4 T cell IL-2 assay (as described above and shown in FIG. 7A-7D), activity in a model using human MoLCs with endogenous CDla using a primary LC-stimulated T cell activation assay (as described above and shown in FIG.9B), as well as blockade of primaryCD la TCR activity with picomolar potency (as described above and shown in FIG. 10A).Results from these assays are presented below:Table 2. Raji CDla: Jurkat Report Assay (assay schema: FIG. 4; results: FIG. 5B)Table 3. Raji A2 CDla SEB: CD4 T cell IL-2 Assay (assay schema FIG. 7A; results:FIG. 7D)Table 4. Jurkat NF AT PD-1 Report Assay (assay schema FIG. 9B; results: FIG. 9D)Table 5. K562 + / - CDla: Jurkat NFL SI CDla TCR Reporter Assay
[0220] Ab002.10.18nR and Ab00210.21.nR also exhibited minimal cross -reactivity in CDlb- d reporter assays and exhibited stable cell surface binding.
[0221] Table 6. Raji A2 CDlb-d: Jurkat NFAT PD-1 reporter assays (schema represented in FIG. 4 except that CDlb / c / d present or absent in Raji A2 cells instead of CDla; results in FIG. 5C and FIG. 5D).
[0222] Microarray screening against over 6500 membrane and secreted proteins individually overexpressed on HEK cells (Retrogenix) also confirmed very minimal cross-reactivity in a handful of instances that were subsequently de-risked using live cells, confirming a high degree of specificity for the Ab002.10.18nR molecule.Example 6. Long term effect of CDla-PD-1-ImmTAAI on CD4 T cell activation andexhaustion
[0223] As described above, the PD-1 receptor is a key inhibitory immune checkpoint that regulates T cell activation and is involved in T cell exhaustion, a state of cellular paralysis. As autoreactive T cells are often main drivers of autoimmunity and T cell exhaustion correlates with good prognosis, there is strong rationale to develop targeted PD-1 agonists, called ImmTAAIs, as new therapeutics to inhibit T cells and treat autoimmune diseases.
[0224] Previous studies indicated that PD-1 -ImmTAAIs, once bound to target cells, activate the PD-1 pathway on interacting T cells and achieve potent immune suppression. Cumock et al, JCI Insight 6(20): e!52468 (2021).
[0225] Exhaustion of CD4 T cells in the presence of a CDla-PD-1 ImmTAAI in a CD4 T cell activation model: T cell exhaustion was determined by primary CD4 T cell activation with Raji-CDIa loaded with SEB peptide for 10 days. See FIG 13A and F1G.13B. It was found that CD la-PD- 1 -ImmTAAI binding to Raji-CDIa is stable as shown in FIG. 13C and FIG. 13D. Irradiated Raji-CDIa cells died before day 4 as shown in FIG 13E and FIG. 13F. CD25 and CD69 activation marker expression were stable throughout the activation as shown in FIG. 13G. Between day 3 and 10, a decrease of proliferation (as indicated by Ki67 expression) and IL-2 secretion were demonstrated (see FIG. 13H and 131. An increase of TIM-3 and PD1 expression, indicators of CD4 T cell exhaustion were also demonstrated between day 3 and 10 (see FIG. 13 J).
[0226] Exhausted CD4 T cells were then tested to determine cytokine secretion. Comparison cytokines secretion between activated primary CD4 T cells (day O to 3) and reactivated exhausted CD4 T cells (day 10 to 13) was determined. It was found that exhausted CD4 T cells secreted significantly less IL-2, IFNy and TNFa than activated CD4 T cell (See FIG. 14A and FIG 14B).
[0227] Thus, CD la-PD-1 -ImmTAAIs of the present disclosure were demonstrated to effectively inhibit CD4 T cell activation and enhance T cell exhaustion.
[0228] The long-term effect of CDla-PD-1 -ImmTAAI on CD4 cells was also determined. Primary7CD4 T cell activation was ascertained with Raji-CDIa loaded with SEB for 8 days in the presence or absence of CD la-PD-1 -ImmTAAI for the 3 first days. CDla-PD-1- ImmTAAI decreased IL-2 and TNFa secretion throughout the course of CD4 T cell activation. FIG. 15A, FIG. I5B and FIG. 15C. These experiments thus showed that CDla-PD-1 -ImmTAAI of the present disclosure can mediate inhibition of CD4 T cell activation.
[0229] To determine whether CD la-PD-1 -ImmTAAls enhance T ceil exhaustion, primary CD4 T ceils treated with or without a CD la-PD-1 -ImmTAAI and activated with CD4 after 8 days were re -stimulated, in the absence of ImmTAAI, with Raji-CDla loaded with SEB (See FIG. 16A). Comparison of cytokine levels produced during the re-activation is shown. CD4 T cells activated in the presence of CD la-PD-1 -ImmTAAI produced significantly less proinflammatory (IL-2 and TNF-a) and more anti-inflammatory (IL-10) cytokines during re-activation (See FIG. 16B and FIG. 16C). This was comparable to the levels of proinflammatory and anti-inflammatory cytokines seen when primary CD4 T cells were treated with the PD-1 agonist antibody, peresolimab (See FIG. 16D).
[0230] The T cell exhaustion experiment described above demonstrated that the effect of a target-directed ImmTAAls on CD4 T cell exhaustion can be studied in the in-vitro model established. It was found that exhausted CD4 T cells secrete significantly less IL-2, IFNy and TNFa than activated T cells.
[0231] The results of additional experiments showed that cell-bound CD la-PD-1 -ImmTAAI inhibited CD4 T cell activation and enhanced CD4 T cell exhaustion. Thus, this long-term pharmacodynamic effect resulting from the presence of CD la ImmTAAls is potentially beneficial for the treatment of autoimmune diseases, including atopic dermatitis, as it demonstrates the potential for a prolonged, disease modifying effect.Example 7: CDla / PD-1 Bispecific Molecules Function in Atopic Dermatitis (AD) Explants
[0232] The function of CDla / PD-1 bispecific molecules were evaluated in atopic dermatitis (AD) explants. Four (4) mm lesional and perilesional skin punches from AD donors were cultured ex vivo and treated for 48 or 96 hours with either a CDla / PD-1 bispecific molecule (WT Ab002-H5 HLE; SEQ ID NO: 73 and 58) or a control vehicle (each experimental arm in duplicate). After the prescribed time periods, the cultured and treated skin was frozen in optimal cutting temperature (OCT) for cryosectioning and immunofluorescence (IF). The culture media was also collected for cytokine analysis.
[0233] As shown in FIG. 17, treatment with the CDla / PD-1 bispecific molecule demonstrated a reduction of Thl, Th2, Th 17 and Th22 cytokines in lesional and perilesional skin. A reduction in proliferating T cells was also observed in the perilesionalepidermis following treatment with the CDla / PD-1 bispecific molecule (See FIG. 18). Treatment with the CDla / PD-1 bispecific molecule also demonstrated an increase in soluble PD-1 (sPD-1) levels in both lesional and perilesional skin explants, indicating that sPD-1 may serve as an indicator of target engagement (See FIG. 19).Conclusion
[0234] As described above, the CDla / PD-1 ImmTAAI molecules of the present disclosure are unique for various reasons including (i) lipid independent binding to CD la; (ii) picomolar potency in cellular assays of PD-1 -mediated T cell suppression and CDla autoreactive T cell blockade; (iii) high level of selectivity in biochemical and cellular assays; and (iv) CDla target engagement in human skin explants.
[0235] The CD la targeting arm of these molecules have been shown to demonstrate affinities with a kD of less than or about 1 nM, and the ability to block CDla autoreactive T cell activity in their bispecific formats. The PD-1 arm has been shown to demonstrate targeting -depending PD-1 agonist activity and has been optimized for efficacy. The molecules of the present disclosure also demonstrate selectivity that provides a potentially favorable therapeutic window over other CD1 targeting molecules. The molecules have also been engineered and optimized to increase their half-lives (with inclusion of an HLE domain) and reduce their immunogenicity (with further humanization) while maintaining the unique attributes set forth above.
Claims
CLAIMSWhat is claimed is:
1. A multi-domain molecule comprising: (i) a first binding domain that binds to PD-1, (ii) a second binding domain that binds to CD la, wherein the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, andCDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein, wherein the C-terminus of the first binding domain is linked to the N-terminus of the second binding domain.
2. A multi-domain molecule comprising: (i) a first binding domain that binds to PD-1, (ii) a second binding domain that binds to CD la, wherein:(a) the first binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, andCDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein;(b) the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein, CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, andCDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY(SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein, wherein the C-terminus of the first binding domain is linked to the N-terminus of the second binding domain.
3. The multi-domain molecule of claim 1 or 2, wherein the first binding domain is an antibody or antigen-binding fragment thereof.
4. The multi-domain molecule of any one claims 1 to 3, wherein the first binding domain is a VHH or scFv.
5. The multi-domain molecule of any one of claims 1 to 4, wherein the first binding domain is a VHH.
6. The multi-domain molecule of any one of claims 1 to 5, wherein the first binding domain comprises a KD in the range of about 1 nM to about 500 nM or in the range of about 50 nM to about 70 nM.
7. The multi-domain molecule of any one of claims 1 to 6, wherein the first binding domain binds to an epitope in PD-1 comprising one or more or all of the following amino acids: E38, F59, P60, E61, T75, Q76, L77, P78, N79 and G80, numbered according to SEQ ID NO: 13.
8. The multi-domain molecule of any one of claims 1 to 7, wherein the first binding domain comprises FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, wherein FR is a framework region, and wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - AVQLVESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 14), with zero, one, two or three mutations therein,FR2 - MTWVRQAPGKGPEWVSA (SEQ ID NO: 15), with zero, one, two or three mutations therein,FR3 -SYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYY (SEQ ID NO: 16), with zero, one, two or three mutations therein, andFR4 - YLTYDRYGQGTLVTVSS (SEQ ID NO: 17), with zero, one, two or three mutations therein.
9. The multi-domain molecule of any one of claims 1 to 8, wherein the first binding domain comprises the amino acid sequence provided in SEQ ID NO: 18 or a humanized versionthereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 18.
10. The multi-domain molecule of any one of claims 1 to 9, wherein the first binding domain comprises the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 20.
11. The multi-domain molecule of any one of claims 1 to 10, wherein the second binding domain is a VHH or scFv.
12. The multi-domain molecule of any one of claims 1 to 11, wherein the second binding domain is a VHH.
13. The multi-domain molecule of any one of claims 1 to 12, wherein the second binding domain is a humanized anti-CDla VHH.
14. The multi-domain molecule of any one of claims 1 to 13, wherein the second binding domain is a humanized llama anti-CDla VHH.
15. The multi-domain molecule of claim 14, wherein the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: P24, F38, E45, R46, F48, A50, Y73, R75, V78, and G97, numbered according to SEQ ID NO: 21.
16. The multi-domain molecule of claim 14, wherein the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: P24, F38, F48, Y73, R75, and V78, numbered according to SEQ ID NO: 25.
17. The multi-domain molecule of claim 14, wherein the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, P87 and V97, numbered according to SEQ ID NO: 28.
18. The multi-domain molecule of claim 14, wherein the humanized llama anti-CDla VHH comprises one or more or all of the following amino acids: F38, E45, R46, F48, A50, Y73, K75, V78, and G97, numbered according to SEQ ID NO: 29.
19. The multi-domain molecule of any one of claims 14 to 18, wherein the humanized llama anti-CDla VHH is characterized by a reduced hook effect as compared to wild-type llama anti-CDla VHH .
20. The multi-domain molecule of any one of claims 1 to 19, wherein the second binding domain is humanized to human IGHV3-23*01 and human IGHJ*04.
21. The multi-domain molecule of any one of claims 1 to 20, wherein the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), with zero, one, two or three mutations therein, andCDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), with zero, one, two or three mutations therein.
22. The multi-domain molecule of any one of claims 1 to 20, wherein the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRAFRPHNVMA (SEQ ID NO: 5), with zero, one, two or three mutations therein,CDR2 - AARWSGIYYAESVKG (8), with zero, one, two or three mutations therein, and CDR3 - STAQDMTLALMSDYDY (SEQ ID NO: 11), with zero, one, two or three mutations therein.
23. The multi-domain molecule of any one of claims 1 to 20, wherein the second binding domain comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, andCDR3 - GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
24. The multi-domain molecule of any one of claims 1 to 23, wherein the second binding domain comprises FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, wherein FR is a framework region, and wherein FR1, FR2, FR3 and FR4 comprise the following sequences:FR1 - EVQLLESGGGLVQPGGSLRLSCAAS (SEQ ID NO: 30), with zero, one, two or three mutations therein,FR2 - WVRQAPGKGLEWVS (SEQ ID NO: 31), with zero, one, two or three mutations therein,FR3 - RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAK (SEQ ID NO: 32), with zero, one, two or three mutations therein, andFR4 - WGQGTLVTVSS (SEQ ID NO: 33), with zero, one, two or three mutations therein.
25. The multi-domain molecule of claim 24, wherein the mutation(s) in the second binding domain framework regions are selected from A24P, V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 21.
26. The multi-domain molecule of claim 24, wherein the mutation(s) in the second binding domain framework regions are selected from A24P, V38F, W48F, N73Y, K75R, and L78V numbered according to SEQ ID NO: 25.
27. The multi-domain molecule of claim 24, wherein the mutation(s) in the second binding domain framework regions are selected from V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V, A87P and A97V numbered according to SEQ ID NO: 28.
28. The multi-domain molecule of claim 24, wherein the mutation(s) in the second binding domain framework regions are selected from V38F, G45E, L46R, W48F, S50A, N73Y, K75R, L78V and A97G numbered according to SEQ ID NO: 29.
29. The multi-domain molecule of any one of claims 1 to 28, wherein the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 34 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 21.
30. The multi-domain molecule of any one of claims 1 to 29, wherein the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 35 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 28.
31. The multi-domain molecule of any one of claims 1 to 29, wherein the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 36 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 29.
32. The multi-domain molecule of any one of claims 1 to 29, wherein the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 27.
33. The multi-domain molecule of any one of claims 1 to 29, wherein the second binding domain comprises the amino acid sequence provided in SEQ ID NO: 25, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 25.
34. The multi-domain molecule of any of claims 1 to 33, further comprising (iii) a half-life extending domain, wherein the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain, and wherein the C-terminus of the second binding domain is linked to the N-terminus of FC 1.
35. The multi-domain molecule of claim 34, wherein the half-life extending domain comprises:(a) one or more amino acid substitutions which facilitate dimerisation of FC1 and FC2; and / or(b) one or more amino acid substitutions which prevent or reduce binding to FcyR; and / or(c) one or more amino acid substitutions which promote binding to FcRn.
36. The multi-domain molecule of claim 34 or 35, wherein:(i) one of the FC 1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, T394S, F405A, Y407A, Y407T and Y407V according to SEQ ID NO: 37; and(ii) the other of the FC1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366W, T366Y, T366W, T394W and F405W according to SEQ ID NO: 37.
37. The multi-domain molecule of any one of claims 34 to 36, wherein:(i) one of the FC 1 and the FC2 comprises one or more amino acid substitutions selected from the group consisting of T366S, L368A, and Y407V according to SEQ ID NO: 37; and(ii) the other of the FC1 and the FC2 comprises a T366W amino acid substitution according to SEQ ID NO: 37.
38. The multi-domain molecule of any one of claims 34 to 37, wherein the half-life extending domain comprises one or more amino acid substitutions which attenuate an effector function of the Fc domain.
39. The multi-domain molecule of any one of claims 34 to 38, wherein the half-life extending domain comprises one or more amino acid substitutions selected from the group consisting of S228P, E233P, L234A, L235A, L235E, L235P, G236R, G237A, P238S, F241A, V264A, D265A, H268A, D270A, N297A, N297G, N297Q, E318A, K322A, L328R, P329G, P329A, A330S, A330L, P331A and P331S according to SEQ ID NO: 37.
40. The multi-domain molecule of any one of claims 34 to 39, wherein the FC1 and / or the FC2 comprise a N297G amino acid substitution according to SEQ ID NO: 37.
41. The multi-domain molecule of any one of claims 34 to 40, wherein:(a) either FC1 or FC2 comprises the amino acid sequence provided in SEQ ID NO: 38 or 39, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 38 or 39, and(b) the other of FC1 and FC2 comprises the amino acid sequence provided in SEQ ID NO: 40 or 41, or an amino acid sequence that has at least 90%, at least 95%, or at least 98% identity to the amino acid sequence provided in SEQ ID NO: 40 or 41.
42. The multi-domain molecule of any one of claims 1 to 41, wherein, the first binding domain is linked to the N-terminus of the second binding domain by a linker and / or IgG hinge sequence.
43. The multi-domain molecule of claim 42, wherein the linker comprises the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein.
44. The multi-domain molecule of any one of claims 34 to 43, wherein the C-terminus of the second binding domain is linked to the N-terminus of FC1 via an IgG hinge sequence.
45. The multi-domain molecule of any one of claims 34 to 44, wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
46. The multi-domain molecule of claim 44 or 45, wherein the IgG hinge comprises the amino acid sequence of SEQ ID NO: 42 or 43.
47. The multi-domain molecule of any one of claims 1 to 46, wherein the multidomain molecule comprises the amino acid sequence of: (i) SEQ ID NO: 57; and (ii) SEQ ID NO: 58.
48. The multi-domain molecule of any one of claims 1 to 46, wherein the multidomain molecule comprises the amino acid sequence of: (i) SEQ ID NO: 59; and (ii) SEQ ID NO: 58.
49. The multi-domain molecule of any one of claims 1 to 46 , wherein the multidomain molecule comprises the amino acid sequence of: (i) SEQ ID NO: 63; and (ii) SEQ ID NO: 58.
50. A single domain antibody that binds to CD la, comprising a CDR1, CDR2 and CDR3, comprising the following amino acid sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein,CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
51. The single domain antibody of claim 50, wherein(a) the single domain antibody is isolated; and / or(b) the single domain antibody is a VHH; and / or(c) the single domain antibody is an anti-CDla antibody; and / or(d) the single domain antibody binds to CD la with a KD in the range of about 100 pM to about 5000 pM or in the range of about 600 pM to about 3000 pM; and / or(e) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 34 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 21; and / or(f) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 35 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 28; and / or(g) the single domain antibody comprises the amino acid sequence provided in SEQ ID NO: 36 or a humanized version thereof, or an amino acid sequence having at least 90%, at least 95% or at least 98% identity to SEQ ID NO: 29.
52. The single domain antibody of claim 50 or 51 that is linked to a binding domain that binds an immune checkpoint receptor.
53. The single domain antibody of claim 52, wherein the immune checkpoint receptor is a PD-1.
54. The single domain antibody of claim 50, wherein the binding domain is the second binding domain of any one of claims 11 to 33.
55. A nucleic acid encoding(a) the multi-domain molecule of any one of claims 1 to 49, wherein the first and second binding domains are encoded within a single open reading frame, or within two distinct open reading frames;(b) the multi-domain molecule of any one of claims 1 to 49, wherein the first binding domain, second binding domain and half-life extending domain are encoded within a single open reading frame, or within distinct open reading frames; and / or(c) the single domain antibody of any one of claims 50 to 54.
56. An expression vector comprising the nucleic acid of claim 55.
57. A cell harbouring:(a) the expression vector of claim 56;(b) a first expression vector comprising a nucleic acid encoding a first binding domain of any one of claims 1 to 49 and a second expression vector comprising a nucleic acid encoding a second binding domain of any one of claims 1 to 49; or(c) a first expression vector comprising a nucleic acid encoding the first binding domain of the multi-domain molecule of any one of claims 1 to 49, a second expression vector comprising a nucleic acid encoding the second binding domain of the multi-domain molecule of any one of claims 1 to 49, and a third expression vector comprising a nucleic acid encoding the half-life extending domain of the multi-domain molecule of any one of claims 34 to 49.
58. A non-naturally occurring and / or purified and / or engineered cell, preferably a T-cell, presenting the multi-domain molecule of any one of claims 1 to 49, or the single domain antibody of any one of claims 50 to 54.
59. A pharmaceutical composition comprising the multi-domain molecule of any one of claims 1 to 49, the single domain antibody of any one of claims 50 to 54, the nucleic acid of claim 55, the expression vector of claim 56, and / or the cell of claim 57 or 58, together with one or more pharmaceutically acceptable carriers or excipients.
60. The multi-domain molecule of any one of claims 1 to 49, the single domain antibody of any one of claims 50 to 54, the nucleic acid of claim 55, the expression vector of claim 56, and / or the cell of claim 57 or 58, for use in medicine, preferably in a human subject.
61. The multi-domain molecule of any one of claims 1 to 49, the single domain antibody of any one of claims 50 to 54, the nucleic acid of claim 55, the expression vector of claim 56, and / or the cell of claim 57 or 58, for use in a method of treating atopic dermatitis, preferably in a human subject.
62. A method of producing the multi-domain molecule of any one of claims 1 to 49, or the single domain antibody of any one of claims 50 to 54, the method comprising a) maintaining the cell according to claim 57 or 58 under optimal conditions for expression of the multidomain molecule or single domain antibody and b) isolating the multi-domain molecule or single domain antibody.
63. A multi-domain molecule comprising: (i) a PD-1 agonist VHH, (ii) a humanized CDla- binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero or one mutation therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero or one mutation therein, and CDR3 - CARGGYLTYDRYGQ (SEQ ID NO: 3), with zero or one mutations therein;(b) the humanized CD la-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), with zero or one mutation therein, CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), with zero or one mutation therein, andCDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), with zero or one mutation therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain; wherein the C-terminus of the PD-1 agonist VHH is linked to the N-terminus of the humanized CD la-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; andwherein the C-terminus of the humanized CD la-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
64. A multi-domain molecule comprising: (i) a PD-1 agonist VHH, (ii) a humanized CDla- binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, andCDR3 - CARGGYLTYDRYGQ (SEQ ID NO: 3), with zero, one, two or three mutations therein;(b) the humanized CD la-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 -GRAFRPHNVMA (SEQ ID NO: 5), with zero, one, two or three mutations therein,CDR2 -AARWSGIYYAESVKG (8), with zero, one, two or three mutations therein, andCDR3 -STAQDMTLALMSDYDY (SEQ ID NO: 11), with zero, one, two or three mutations therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain; wherein the C-terminus of the PD-1 agonist VHH is linked to the N-terminus of the humanized CD la-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; and wherein the C-terminus of the humanized CD la-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
65. A multi-domain molecule comprising: (i) a PD-1 agonist VHH, (ii) a humanized CDla- binding VHH, and (iii) a half-life extending domain, wherein:(a) the PD-1 agonist VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein,CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, andCDR3 - CARGGYLTYDRYGQ (SEQ ID NO: 3), with zero, one, two or three mutations therein;(b) the humanized CD la-binding VHH comprises a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein,CDR2 - AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, andCDR3 - GSSTFSANYRDYEY (SEQ ID NO: 12) with zero, one, two or three mutations therein; and(c) the half-life extending domain comprises a first IgG Fc chain (FC1) and a second IgG Fc chain (FC2), wherein the FC1 chain and FC2 chain dimerise to form an Fc domain; wherein the C-terminus of the PD-1 agonist VHH is linked to the N-terminus of the humanized CD la-binding VHH by a linker comprising the following sequence: GGGGS (SEQ ID NO: 44), with zero, one, two or three mutations therein; and wherein the C-terminus of the humanized CD la-binding VHH is linked to the N-terminus of FC1 via an IgG hinge sequence, and / or wherein the Fc domain comprises an IgG hinge sequence at the N-terminus of FC2.
66. The multi-domain molecule of any one of claims 63 to 65, wherein the IgG hinge comprises the amino acid sequence of SEQ ID NO: 42 or 43.
67. A method for treating an autoimmune disease in a subject, the method comprising administering the multi-domain molecule of any one of claims 1 to 49, the single domain antibody of any one of claims 50 to 54, the nucleic acid of claim 55, the expression vector of claim 56, and / or the cell of claim 57 or 58.
68. The method of claim 67, wherein the autoimmune disease is atopic dermatitis, psoriasis, or a lichenoid skin disease.
69. A bispecific molecule that binds to PD-1 and CD la, wherein the bispecific molecule comprises a means for binding PD-1 and a means for binding CD la.
70. The bispecific molecule of claim 69, wherein the means for binding PD-1 comprises a first binding domain that corresponds to a PD-1 agonist, a PD-1 agonist ligand, or a fragment or modification thereof.
71. The bispecific molecule of claim 69 or 70, wherein the means for binding CD la comprises a second binding domain that corresponds to a soluble TCR, an antigen-binding fragment, or a fragment or modification thereof.
72. The bispecific molecule of any one of claims 69 to 71, wherein the means for binding PD-1 comprises a first binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein.
73. The bispecific molecule of any one of claims 69 to 72, wherein the means for binding CD la comprises a second binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein, CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, CDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
74. A method for treating an autoimmune disease in a subject, the method comprising: administering to the subject a means for binding PD-1 and CD la.
75. The method of claim 74, wherein the means for binding PD-1 comprises a first binding domain that corresponds to a PD-1 agonist, a PD-1 agonist ligand, or a fragment or modification thereof.
76. The method of claim 74 or 75, wherein the means for binding CDla comprises a second binding domain that corresponds to a soluble TCR, an antigen-binding fragment, or a fragment or modification thereof.
77. The method of any one of claims 74 to 76, wherein the means for binding PD-1 comprises a first binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GFTFSSYA (SEQ ID NO: 1), with zero, one, two or three mutations therein, CDR2 - IASDGAST (SEQ ID NO: 2), with zero, one, two or three mutations therein, CDR3 - CARGGYLTYDRY (SEQ ID NO: 3), with zero, one, two or three mutations therein.
78. The method of any one of claims 74 to 77, wherein the means for binding CDla comprises a second binding domain comprising a CDR1, a CDR2 and a CDR3 comprising the following sequences:CDR1 - GRTFNPGDLMG (SEQ ID NO: 4), GRAFRPHNVMA (SEQ ID NO: 5), or GRTFSPSDLMG (SEQ ID NO: 6), with zero, one, two or three mutations therein, CDR2 - AIKWGPTYYADSVKG (SEQ ID NO: 7), AARWSGIYYAESVKG (8), or AIKWGPTYYSDSVKG (SEQ ID NO: 9), with zero, one, two or three mutations therein, andCDR3 - GSGTFSSNYRDFEY (SEQ ID NO: 10), STAQDMTLALMSDYDY (SEQ ID NO: 11), or GSSTFSANYRDYEY (SEQ ID NO: 12), with zero, one, two or three mutations therein.
79. The method of any one of claim 74 to 78, wherein the autoimmune disease is atopic dermatitis, psoriasis, or a lichenoid skin disease.
80. The method of claim 79, wherein the autoimmune disease is atopic dermatitis.
81. The method of any one of claims 74 to 80, further comprising measuring levels of soluble PD-1 (sPDl) from a sample in the subject.
82. The method of any one of claims 74 to 81, wherein increased levels of soluble PD-1 (sPDl) indicate PD-1 binding.
83. The method of any one of claims 74 to 82, wherein increased levels of soluble PD-1 (sPDl) indicate CDla binding.
84. The method of any one of claims 74 to 83, wherein increased levels of soluble PD-1 (sPDl) indicate simultaneous CDla and PD-1 binding.
85. A method of measuring engagement, or efficacy of engagement, of the multi-domain molecule of any one of claims 1 to 49 or 63 to 66, the single domain antibody of any one of claims 50 to 54, or the bispecific molecule of any one of claims 69 to 73 with a target PD-1 marker and / or a CDl-a marker in a subject, wherein the method comprises:(i) administering to the subject the multi-domain molecule, single domain antibody, or bispecific molecule; and(ii) measuring a level of soluble PD-1 (sPD-1) in a biological sample obtained from the subject, wherein a relative increase in the measured level of sPD-1 compared to a control sample indicates engagement of the multi-domain molecule, single domain antibody, or bispecific molecule with the target PD-1 marker and / or CD la marker.
86. A method of treating an autoimmune disease in a subject, the method comprising:(i) determining a baseline level of soluble PD-1 (sPD-1) in a biological sample obtained from the subject (TO),(ii) administering to the subject a first dosage amount of a multi-domain molecule binding to PD-1 and CD la, and(iii) determining a level of sPD-1 after (ii) in a biological sample obtained from the subject (Tl), wherein if Tl is greater than or equal to TO, then a second dosage amount of the multidomain molecule is administered, wherein the second dosage amount is the same or less than the first dosage amount , or wherein if the Tl is less than TO, then the second dosage amount of the multi-domain molecule is greater than the first dosage amount and / or further comprises a second autoimmune disease treatment.
87. A method of enhancing T cell exhaustion comprising administering a multi-domain molecule simultaneously targeting PD-1 and CD la.
88. The method of claim 87, wherein the multi-domain molecule is selected from any one of claims 1 to 49 or 63 to 66.