Antibody-drug conjugate containing anti-GUCY2C antibody, method of preparation thereof, and use
Patent Information
- Authority / Receiving Office
- KR · KR
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2024-12-05
- Publication Date
- 2026-08-12
Smart Images

Figure PCT00161_ABST
Abstract
Description
Technology Field
[0001] The present invention relates to novel antibody-drug conjugates (ADCs) comprising an advantageous modular linker for linking a pharmaceutically active drug substance to an antibody. The present invention also relates to a method for preparing said antibody-drug conjugates, uses thereof, and pharmaceutical compositions comprising said antibody-drug conjugates. Embodiments of the present invention were developed particularly as antibody-drug conjugates for use in the treatment of guanylate cyclase 2C (GUCY2C)-positive gastrointestinal cancers, and will be described below with reference to such applications. However, the present invention is not limited to these specific applications. Background Technology
[0002] In addition to surgical resection and radiation therapy, chemotherapy remains a primary treatment option for cancer. However, it is also well established that due to its limited selectivity and specificity for cancer cells, the therapeutic range for administering high-toxicity doses of chemotherapy agents is narrow; furthermore, while it often causes severe side effects in patients through toxicity to non-cancer cells, it still exhibits only low efficacy against malignant cancer cells.
[0003] Targeted drug therapy solutions have been developed to enhance the direct and specific delivery of cytotoxic drug substances to malignant cancer cells. In particular, antibody-drug conjugates (ADCs) provide a new therapeutic option that enables the delivery of drug substances to malignant cancer cells with high specificity while having little to no effect on non-cancer cells.
[0004] Antibody-drug conjugates (ADCs) generally consist of antibodies covalently bonded to cytotoxic drug substances via synthetic linkers. (a) The antibody ensures a high level of specificity and (b) the cytotoxic drug substance ensures an effect on cancer cells after delivery, whereas (c) the linker compound used to conjugate the antibody and the drug substance plays a crucial role as it can significantly influence the therapeutic index, efficacy, and pharmacokinetics of the ADC.
[0005] In particular, the linker compound must (i) ensure high plasma stability of the circulating conjugate to prevent premature release of the drug and the resulting unwanted systemic off-target effects; (ii) maintain the properties of the antibody as well as the cytotoxic drug substance; (iii) provide a high level of solubility to the conjugate to allow delivery of hydrophobic / lipophilic drug substances and prevent aggregation of the ADC within the pharmaceutical composition; and (iv) ensure that the target cancer cells are adequately exposed to the cytotoxic drug substance to maximize the therapeutic effect.
[0006] The lipophilicity of many cytotoxic drug substances can adversely affect the properties of ADCs to the extent that the payload is not efficiently delivered to target cells. Modifying ADC properties by attaching polar groups to the linker can reduce aggregation during conjugation and enhance the physicochemical properties of the ADC, thereby leading to improved pharmacokinetics (PK) and therapeutic index (see, e.g., Nature Biotechnology, 2015, 33, 733-735). Modifying the linker to alter the polarity or charge of the end metabolite can enhance activity against multidrug-resistant (MDR) cells by allowing the payload to remain in the cell (see, e.g., Cancer Res; 70(6) Mar. 15, 2010, p2528). Chemical moiety on the linker, e.g., polyethylene glycol (PEG), sugar, or sulfate groups (see e.g. WO2014062697, US20100323973), not only affects the conjugation efficiency and ease of production of the ADC but also often remains as part of the metabolites, affecting the activity and safety of the ADC.
[0007] The therapeutic efficacy of ADCs depends not only on the appropriate release of the cytotoxic drug substance but also on effective bioconjugation to link the drug substance to the antibody, and furthermore, on the number of cytotoxic drug substance molecules successfully linked to a single antibody—namely, the drug-antibody ratio (DAR). Low DAR is known to reduce ADC efficacy, requiring the conjugation of highly toxic drug substances, whereas high DAR has been associated with potential ADC instability, leading to increased systemic effects, reduced ADC half-life, and changes in the overall pharmacokinetics of the corresponding molecule. However, considering that stochastic chemistry has generally been applied to conjugate drug substances to antibodies, even FDA-approved ADCs consist of a mixture of conjugates that are heterogeneous in terms of DAR.
[0008] Furthermore, the selection of appropriate targets and high antibody specificity significantly influence the potential for the therapeutic effectiveness of novel ADCs. In this regard, cancer-specific or cancer-associated antigens must be identified that enable the generation of antibodies capable of targeting malignant cancer cells with high specificity and exhibiting virtually no off-target binding to non-cancer or healthy cells.
[0009] Regarding gastrointestinal cancer, it is noteworthy that it accounts for approximately 26% of all cancer diagnoses and 35% of cancer deaths worldwide. In 2018, it was estimated that there were approximately 4.8 million new cases of gastrointestinal (GI) cancer and 3.4 million related deaths globally.
[0010] Gastrointestinal cancers include tumors of the esophagus, stomach, colorectal cancer, liver, and pancreas. Among these, colorectal cancer (CRC) is the most frequent, accounting for approximately 10.2% of all new cases, followed by gastric cancer (5.7%), liver cancer (4.7%), esophageal cancer (3.2%), and pancreatic cancer (2.5%). CRC accounts for approximately 9% of all cancer-related deaths, followed by gastric cancer (8.2%), liver cancer (8.2%), esophageal cancer (5.3%), and pancreatic cancer (4.5%). In 2018, there were approximately 3.4 million deaths from GI cancer worldwide (Arnold et al. (2020) Gastroenterology 159:335-349). Therefore, colorectal cancer (CRC) is the third most common cancer globally after lung and breast cancer, but it is the second leading cause of cancer death.
[0011] CRC is the second most common adult cancer in women and the third most common in men, and the fourth leading cause of cancer death.
[0012] The 5-year and 10-year survival rates are 65% and 58%, respectively, and the incidence and mortality rates are 25% higher in men than in women. From 1975 to 2013, the incidence of CRC per 100,000 Americans aged 20 to 49 increased to 10–15 cases. In parallel, CRC cases also increased by approximately 20% in developing countries such as Argentina, Brazil, and China. Furthermore, 30% of CRC patients experience metastasis, and the prognosis remains poor, with a median 5-year survival rate of only 18.5% in the United States and 27.7% in Europe.
[0013] Despite the decrease in incidence over the past 30 years due to improvements in screening and treatment paradigms, it is concerning that the incidence among individuals under 50 years of age has steadily increased, with the overall annual incidence rising by 2.2% between 2012 and 2016. The exact etiology of this paradigm shift is unknown, but it may be attributed to changes in diet and other lifestyle risk factors or to an increase in unsystematic screenings among young adults.
[0014] Ten to two percent of all CRC patients have a benign family history, and about 5 percent of all CRC cases are associated with known hereditary CRC syndromes detectable through germlines. In some cases, the increased incidence of sporadic CRC is associated with various lifestyle factors such as long-term inflammatory bowel disease, lack of physical activity, an unhealthy diet, smoking, obesity, and excessive alcohol consumption.
[0015] Differences in clinical outcomes and drug responsiveness in CRC treatment depend on the location of the cancer along the colon and rectum. Relevant contributing factors include their distinct physiological functions, gut microbiome, regionally resident immune cell types, dietary carcinogens, and the timing of disease detection. Additionally, ontogenic factors may contribute to disease severity and treatment outcomes.
[0016] The proximal (right) colon (cecum, ascending colon, and transverse colon) originates from the embryonic midgut, whereas the distal (left) colon (splenic flexure, descending colon, sigmoid colon, and rectum) originates from the embryonic hindgut. These ontogenic differences are associated with differential gene expression patterns along the proximal-distal axis. In women and African Americans, proximal sporadic colon tumors are diagnosed more frequently with an incidence of 51–62%; these tumors also exhibit higher TNM staging at initial diagnosis, high levels of genome-wide promoter hypermethylation patterns referred to as CpG island methylation phenotypes (CIMP), microsatellite instability (MSI) due to defective DNA mismatch repair mechanisms (dMMR), more frequent mutations in KRAS and BRAF, and a worse prognosis in terms of survival. Distal colorectal tumors are more likely to be accompanied by chromosomal instability (CIN) and show a more favorable prognosis.
[0017] Genomic profiling of CRC has revealed significant intratumoral and intertumoral heterogeneity resulting from the accumulation of gene mutations and chromosomal abnormalities during disease initiation and progression. In CRC, genomic instability manifests in one of two main forms: CIN and MSI. CRC lacking CIN or MSI is classified as genomically stable (GS) CRC.
[0018] In GS CRC, DNA repair genes and tumor suppressor genes are likely to be transcriptionally silenced by CIMP, but a significant portion of MSI CRC and a small population of CIN CRC are also CIMP-positive, and about 10% of CRC are negative for CIN, MSI, or CIMP.
[0019] Chromosomal Instability (CIN) is characterized by numerical (aneuclidity) and structural changes in chromosomes (alternating somatic copy number, deletions, insertions, amplifications, or loss of heterozygosity) and occurs in 65–70% of sporadic CRCs. Almost all CIN tumors exhibit activated Wnt signaling, and 80% possess mutagenic inactivation of APCs, which are negative regulators of the Wnt pathway. Mutagenic inactivation or deletion of TP53 occurs in 60% of CIN tumors, and p53 loss of function directly induces CIN and provides a permissive environment for genomic instability mechanisms.
[0020] In relation to genomic instability, complex telomere dysfunction and p53 deficiency are major CIN mechanisms, as revealed by the development of late bridging in early carcinomas of human CRC and the development of spontaneous CRC in telomerase-deficient p53 mutant mice.
[0021] Microsatellite instability (MSI) CRC is characterized by the presence of microsatellites, which are DNA sequences containing repetitive motifs that tend to accumulate a higher mutation rate than other genomic regions. MSI is the phenotype of defective mismatch repair (dMMR) resulting from the mutagenic inactivation of MMR genes, including MLH1, MSH2, MSH3, MSH6, PMS2, and Exo1 (De' Angelis et al. Acta Biomed 2018 Dec 17;89(9-S):97-101).
[0022] Another important factor contributing to the pathogenesis of CRC is somatic genetic changes that activate key signaling pathways promoting the proliferation-promoting state of CRC cancer cells. The major proliferation-promoting signaling pathways in CRC are the EGFR-RAS and WNT-β-catenin pathways.
[0023] EGFR Signaling: EGFR activation triggers downstream RAS / RAF / MEK / ERK and PI3K / AKT signaling cascades, ultimately leading to proliferation. Mutations in EGFR itself are rare in CRC, with 1% of CRC cases attributed to mutations within the EGFR (Barber et al. N Engl J Med 351: 2883), while overexpression is observed in approximately 80% of CRC cases. Enhanced EGFR activation can occur through post-translational modifications, including the methylation of R198 and R200 by protein arginine methyltransferase 1 (PRMT1), which enhances binding to EGF and resulting signal activation even in the presence of EGFR inhibitors.
[0024] Recently, it was demonstrated that hepatocyte growth factor (HGF), a ligand for the MET receptor, can completely replace EGF during the growth of single Lgr5+ mouse intestinal stem cells (ISCs) into intestinal organoids containing all differentiated intestinal cell lineages. Furthermore, while HGF and EGF were equally effective in promoting the expansion of Apc mutant mouse organoids, Met deletion in in vivo ISCs weakened stem cell compatibility and the formation of Apc-led intestinal adenomas. These results suggest that EGFR and MET signaling have overlapping and partially interchangeable functions in the mouse intestinal mucosa. Recent results also indicate that HGF / MET signaling can completely overcome EGFR inhibition in human ISCs and CRC stem cells, allowing single normal ISCs as well as APC mutant cells to expand into organoids even in the presence of EGFR inhibition (Joosten et al., Gastroenterology 2019 Oct;157(4):1153-1155).
[0025] Another factor determining the clinical efficacy of EGFR blockade is the mutational status of its downstream signaling components, particularly gain-of-function mutations in RAS, RAF, MEK, or ERK that can maintain cancer cell proliferation and survival upon EGFR inhibition. Activating mutations in KRAS, NRAS, or HRAS are present in approximately 50% of all CRC cases; these mutations involve codons 12 or 13, and less frequently codons 61, 117, or 146. Regarding the RAS pathway in CRC, mutations in the RAS effector BRAF occur at the hotspot codon 600 (V600E) in 10–15% of early-stage CRC and about 5% of stage IV CRC. Clinically, inhibition of BRAF alone showed limited activity in metastatic BRAFV600E CRC due to the reactivation of EGFR-mediated MAPK signaling, which led to the approval of combinations of EGFR inhibitors and BRAF and MEK inhibitors, which have now become the standard treatment for patients with metastatic BRAF-mutated tumors.
[0026] Colorectal cancer (CRC) screening can be performed through direct visualization methods such as colonoscopy, CT colonography, flexible sigmoidoscopy, and flexible sigmoidoscopy with fecal immunochemistry (FIT), through fecal-based tests such as GAIAC-based fecal occult blood tests, FIT, or multi-target fecal DNA tests, or through serological tests such as SEPT9 DNA tests.
[0027] Once colorectal cancer is diagnosed, staging is a crucial factor in determining the patient's treatment options. For tumor staging, the Tumor, Lymph Node, and Metastasis (TNM) system of the American Joint Committee on Cancer (AJCC) / International Union for Cancer Control (UICC) is the commonly used staging system that defines the following cancer stages.
[0028] Standard conventional treatments for CRC are surgery, chemotherapy, and radiation therapy. These treatments may be used in combination depending on the localization and progression of the disease. Treatment options include, for example, surgical resection alone for stage 1. For stage 3, the standard treatment involves adjuvant chemotherapy following surgery aimed at a cure. Total mesenteric resection (TME) via laparoscopic and transanal surgical approaches is often an option for localized cancer and is selected when the tumor location is easily accessible. However, it is often impossible to completely remove all cancer cells. Approximately 66% of patients with stage 2 colorectal cancer and 61% of stage 3 patients require additional treatment with adjuvant chemotherapy and / or radiation therapy. These treatments lack specificity and carry many side effects due to cytotoxicity against all growing and dividing cells. Despite recent improvements in diagnostic and treatment options, 54% of patients experience recurrence even after prior adjuvant therapy. Therefore, it is crucial to have more alternative and effective treatments available to treat CRC patients.
[0029] Current chemotherapy for CRC includes both monotherapy based primarily on fluoropyrimidine (5-FU) and multitherapy containing one or more drugs, including oxaliplatin (OX), irinotecan (IRI), and capecitabine (CAP or XELODA or XEL), where combination therapies such as FOLFOX (5-FU+OX), FOXFIRI (5-FU+IRI), XELOX or CAPOX (CAP+OX), and CAPIRI (CAP+OX) represent the primary approaches for first-line treatment. However, chemotherapy is associated with certain limitations, such as systemic toxicity, unsatisfactory response rates, unpredictable innate and acquired resistance, and low tumor-specific selectivity.
[0030] The primary chemotherapy agents currently used to treat these patients are based on fluoropyrimidines (intravenous or oral), either as monotherapy such as intravenous 5-fluorouracil (5-FU) and oral capecitabine (CAP), or as multitherapy including combinations of FOLFOX (5-FU and oxaliplatin), FOLFIRI (5-FU and irinotecan), XELOX / CAPOX (CAP and oxaliplatin), and CAPIRI (CAP and irinotecan). Beyond traditional chemotherapy, the EGFR-targeted agents cetuximab and panitumumab have been approved as first-line treatments for mCRC, and combinations of cetuximab with FOLFIRI or panitumumab with FOLFOX have significantly improved treatment efficacy. However, initial treatment decisions for mCRC do not consider BRAF or KRAS mutations, given the extremely poor prognosis conferred by these mutations as demonstrated in clinical trials. Although the survival rate of mCRC patients has improved in recent years, the response and prognosis of patients with the aforementioned mutations remain poor.
[0031] The current lack of effective therapies and the limitations of non-specific cytotoxicity have led researchers to shift toward the development of predictive, preventive, and personalized medicine strategies to improve the treatment of CRC and mCRC, considering the significant unmet need for promising therapies for patients with BRAF or KRAS mutations in mCRC. Even today, the 5-year overall survival rate for patients with metastatic colorectal cancer (mCRC) is <10%.
[0032] Gastric cancer is the second leading cause of death from malignant diseases worldwide, exhibiting particularly high mortality rates in East Asia, South Asia, and Central Asia; Central and Eastern Europe; and South America. Treatment options for gastric cancer vary depending on the stage of the cancer: very early-stage cancer can generally be treated surgically. Potentially resectable cancer can generally be treated surgically as a first-line treatment, with subtotal or total gastrectomy performed. Nearby lymph nodes and, if possible, parts of nearby organs may also be removed. Additionally, patients may receive chemotherapy alone or chemotherapy combined with radiation therapy (chemoradiotherapy); for example, patients may receive 5-fluorouracil (5-FU) in combination with cisplatin (CDDP) (FP therapy). Other possible treatment regimens may include epirubicin, cisplatin, and fluorouracil (ECF regimen), a regimen in which fluorouracil is replaced with capecitabine (ECX regimen), or an ECF regimen in which cisplatin is replaced with oxaliplatin (EOF regimen). Alternatively, both cisplatin and fluorouracil can be replaced with oxaliplatin and capecitabine (EOX regimen).
[0033] Treatment for metastatic gastric cancer aims to control cancer growth and may include chemotherapy alone, chemotherapy and immunotherapy, or chemotherapy combined with radiation therapy. The combination of platinum and fluoropyrimidine (5-FU) is the global standard first-line chemotherapy regimen in a non-curative setting. Following the failure of platinum and 5-FU, paclitaxel and ramucirumab were established as standard second-line treatments. However, treatment-related neuropathy, deterioration during perioperative FLOT regimens (fluorouracil, oxaliplatin, docetaxel), or subsequent rapid recurrence have increased the demand for taxane-free second-line treatments. Trifluridine / tipiracil has recently been approved for patients with metastatic gastric cancer. In addition to chemotherapy, patients may be treated with immune checkpoint inhibitors such as ipilimumab (anti-CTLA-4), nivolumab (anti-PD-1), pembrolizumab (anti-PD-1), or atezolizumab (anti-PD-L1).
[0034] Diagnostically, gastrointestinal endoscopy is essential for diagnosing gastric cancer, as is staging laparoscopy (SL), which is a minimally invasive and short procedure requiring only small incisions. The advantages of SL include providing accurate diagnoses of peritoneal dissemination and extraserotic invasion, as well as the ability to perform peritoneal lavage for cytology. In patients with advanced gastric cancer that is not diagnosed by imaging studies, peritoneal lavage cytology obtained prior to treatment can be critical for treatment planning. For the evaluation of peritoneal dissemination, peritoneal lavage cytology obtained by SL is considered useful for assessing the efficacy of neoadjuvant chemotherapy and / or immunotherapy.
[0035] Hepatocellular carcinoma (HCC) is the most frequent liver tumor among all primary liver cancers, accounting for 75–85% of all cases. HCC is typically diagnosed at an advanced stage, and effective treatment options for it remain limited. Until 2007, there were no effective treatment options for patients diagnosed with advanced disease or those who had progressed to advanced disease after failing other treatments. Sorafenib was the first systemic drug approved by the U.S. Food and Drug Administration (FDA) as a standard treatment for advanced HCC between 2007 and 2016. In recent years, other small molecule drugs, including lenvatinib, regorafenib, or cabozantinib, have been developed and are either approved or still undergoing clinical trials. These drugs are currently being tested in combination with immune checkpoint inhibitors such as nivolumab or pembrolizumab. Additionally, combinations of immune checkpoint inhibitors, such as atezolizumab and bevacizumab, with angiogenesis inhibitors are being tested.
[0036] Esophageal cancer, a form of gastrointestinal cancer, is treated according to its stage and may include chemotherapy and radiation therapy as well as endoscopic treatment. Common drugs and drug combinations used to treat esophageal cancer but not typically administered with radiation include ECF: epirubicin (Ellence), cisplatin, and 5-FU (especially for tumors at the gastroesophageal junction), DCF: docetaxel (Taxotere), cisplatin, and 5-FU, or the combination drug trifluridine and tipiracil (Lonsurf) in pill form.
[0037] For pancreatic cancer, several chemotherapy regimens have been approved, and the most widely used and well-studied agent is gemcitabine. Gemcitabine is often administered in combination with albumin-bound (Nab) paclitaxel, which has improved survival time compared to gemcitabine monotherapy. Alternative treatment options include the multi-agent regimen FOLFIRINOX (5-fluorouracil, leucovorin, irinotecan, and oxaliplatin). Additionally, for pancreatic cancer, combination therapies using immune checkpoint inhibitors such as pembrolizumab or nivolumab in combination with gemcitabine, nab-paclitaxel, or capecitabine are being clinically evaluated.
[0038] Guanylyl cyclase 2C (GUCY2C, EC: 4.6.1.2) is a member of the receptor-enzyme protein family that synthesizes guanosine 3′,5′-cyclic monophosphate (cyclic GMP; cGMP). GUCY2C is a transmembrane receptor for the endogenous hormone ligands guaniline and uroguaniline. Ligand binding to the extracellular receptor catalyzes the conversion of GTP to cyclic GMP (cGMP) and initiates downstream cGMP-related signaling pathways, which are involved in the regulation of intestinal homeostatic processes such as epithelial cell proliferation, differentiation, and apoptosis (Lisby et al. Expert Rev Precis Med Drug Dev. 2021; 6(2): 117-129.).
[0039] GUCY2C is specifically expressed by intestinal epithelial cells. GUCY2C regulates the dynamic progression of cells along the crypt-villi and crypt-surface axes, thereby coordinating homeostatic processes including epithelial-mesenchymal interactions and proliferation, DNA repair, metabolic programming, and lineage-specific cell fate that constitute these axes. Given the major role of GUCY2C in maintaining epithelial regeneration, dysregulation of the GUCY2C-cGMP axis promotes pathologies including inflammatory bowel disease and intestinal transit disorders, in addition to colorectal cancer. Importantly, silencing of the GUCY2C signaling axis is associated with colorectal tumorigenesis through the loss of ligand binding.
[0040] The GUCY2C protein can be detected almost universally (>95%) in all primary and metastatic human colorectal tumors regardless of anatomical location or grade, and can also be detected in some gastroesophageal and pancreatic tumors, but not in tumors arising outside the gastrointestinal tract. GUCY2C has also been shown to be expressed in esophageal, gastric, and pancreatic tumors (Danaee et al (2017) PLoS One. 2017; 12(12): e0189953).
[0041] Given its unique expression pattern in colorectal cancer (CRC) and metastatic colorectal cancer (mCRC), various approaches have been attempted to utilize GUCY2C for the treatment of these diseases, including cancer vaccines using GUCY2C, its use as a target for CAR-T cell therapy (Magee et al. Cancer Immunol Res. 6(5), 509-516 (2018)), or the use of therapeutic antibodies and antibody-drug conjugates targeting GUCY2C. WO2013 / 163633 A1 discloses anti-GUCY2C antibodies and anti-GUCY2C ADCs containing auristatin E (MMAE) and auristatin F MMAE (MMAF), which inhibit mitosis by inhibiting tubulin polymerization. Clinical trials of the anti-GUCY2C ADC TAK264 (MLN0264, 5F9vcMMAE), which used MMAE as a payload, have been concluded. WO2021 / 205325 A1 discloses an anti-CD3-GUCY2C bispecific antibody for inducing a cytolytic T cell response in GUCY2C-positive target cells and their respective uses in cancer treatment.
[0042] While these efforts indicate that GUCY2C-directed therapies can be effective, approved GUCY2C-directed therapies, particularly approved GUCY2C-directed ADCs, remain scarce. Therefore, there is a need in the technical field for improved antibody-drug conjugates (ADCs) that mediate the stable conjugation of cytotoxic drug substances and antibodies, while simultaneously allowing for easy modulation of the ADC's drug-antibody ratio (DAR) and / or solubility depending on the cytotoxicity and hydrophobicity of the drug substance to be conjugated. Furthermore, there is a need for such improved ADCs with high titers and excellent efficacy profiles in the context of treating gastrointestinal cancers. The problem to be solved
[0043] The purpose of the present disclosure is to overcome or improve one or more disadvantages of the prior art or to provide a useful alternative. In particular, the purpose of the present disclosure is to provide an improved antibody-drug conjugate (ADC) having high efficacy and excellent therapeutic effect in the treatment of gastrointestinal cancer.
[0044] The present invention aims to provide an improved ADC having a linker structure particularly suitable for providing an ADC with high potency and an excellent efficacy profile in the context of treating gastrointestinal cancer. means of solving the problem
[0045] The ADC described herein has a linker having an overall modular structure that provides a selection of beneficial linker functions for a high-titer ADC. Specifically, the modular linker used in the ADC of the present disclosure comprises two functional units: a cleavable peptide sequence and a self-sacrificial spacer, wherein a solubility enhancer and a cytotoxic drug substance are physically adjacent and bound to each of the self-sacrificial spacers. Furthermore, each functional unit is connected to a corresponding branch unit in the multimeric core of the linker through a defined chemical spacer. Given that the multimeric core of the ADC of the present disclosure comprises two branch units each connected to one cytotoxic drug substance, the linker has a defined degree of labeling (DOL) of 2.
[0046] Finally, the linker is conjugated to the antibody through an additional chemical spacer extending from the multimeric core. The conjugation of the linker carrying the drug substance and the antibody occurs through the end of the spacer extending from the multimeric core by the reaction between the terminal maleimide group of the spacer and the sulfur atom of the cysteine residue in the constant heavy chain of the antibody.
[0047] Beneficially, thiol reactions are highly efficient and generally proceed rapidly under mild conditions. This implies that thiol-reactive groups can form conjugates quickly and with high completeness. Furthermore, the thioether bonds formed between the thiol group and the thiol-reactive group are stable under physiological conditions. While they are less prone to hydrolysis or degradation compared to some other types of chemical bonds, additional stability of the conjugate can be achieved through the introduction of a basic amino group adjacent to the maleimide, for example, as described in Lyon et al. Nat. Biotechnol. 2014, 32, 1059-1062. Thus, in the ADC of the present invention, the reaction product is generally a succinimidyl thioether or a derivative thereof, which stably links the antibody with a linker carrying the drug substance.
[0048] Accordingly, in a first aspect, the present invention relates to an antibody-drug conjugate (ADC) of formula (I) or a pharmaceutically acceptable salt or solvate thereof:
[0049]
[0050] Chemical formula (I)
[0051] Here;
[0052] k is an integer from 2 to 4;
[0053] Ab is an anti-GUCY2C antibody;
[0054] D is It is a pharmaceutically active substance selected from, where:
[0055] - R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or; or
[0056] - R 1 is -H, and R 2 is -CH2N(CH3)2, and R3 is -OH, and R 4 is -H, and R 5 is -O- or; or
[0057] - R 1 is -CH2CH3, and R 2 is -H, and R 3 Is and R 4 is -H, and R 5 is -O- or; or
[0058] - R 1 is -H, and R 2 is -NO2, and R 3 is -H, and R 4 is -H, and R5 is -O- or; or
[0059] - R 1 is -CH2CH2NHCH(CH3)2, and R 2 is -H, and R 3 is -H, and R 4 is -H, and R 5 is -O- or; or
[0060] - R 1 is -CH2CH3, and R 2 is -H, and R 3 is -OH, and R 4 is -H, and R 5 is -O- and;
[0061] SE is a solubility enhancer and includes alpha-cyclodextrin, beta-cyclodextrin, gamma-cyclodextrin, polysarcosine, PEG, or polyalcohols prepared from carbohydrates.
[0062] Preferably, D is and, here:
[0063] - R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or; or
[0064] - R 1 is -H, and R 2 is -CH2N(CH3)2, and R 3 is -OH, and R 4 is -H, and R 5 is -O- or; or
[0065] - R 1 is -CH2CH3, and R 2 is -H, and R 3 Is and R 4 is -H, and R 5 is -O-.
[0066] In a preferred embodiment, D is
[0067] , ,
[0068] , or And,
[0069] Here, the wavy line indicates the attachment site of D to the linker as disclosed in this specification.
[0070] Most preferably, D is am.
[0071] In some embodiments, the antibody is a monoclonal antibody that recognizes and binds to the target sequence or epitope of guanylate cyclase 2C (GUCY2C).
[0072] A particularly preferred embodiment of the antibody-drug conjugate of formula (I) of the first embodiment is as follows:
[0073] ,
[0074] Here, k is 2, and mAb is an anti-GUCY2C antibody selected from the group consisting of mAb1, mAb8 and mAb41 as disclosed in this specification, preferably mAb8.
[0075] Another particularly preferred embodiment of the antibody-drug conjugate of formula (I) of the first embodiment is as follows:
[0076] ,
[0077] Here, k is 2, and mAb is an anti-GUCY2C antibody selected from the group consisting of mAb1, mAb8 and mAb41 as disclosed in this specification, preferably mAb8.
[0078] Another particularly preferred embodiment of the antibody-drug conjugate of formula (I) of the first embodiment is as follows:
[0079] ,
[0080] Here, k is 2, and mAb is an anti-GUCY2C antibody selected from the group consisting of mAb1, mAb8 and mAb41 as disclosed in this specification, preferably mAb8.
[0081] Another particularly preferred embodiment of the antibody-drug conjugate of formula (I) of the first embodiment is as follows:
[0082] ,
[0083] Here, k is 2, and mAb is an anti-GUCY2C antibody selected from the group consisting of mAb1, mAb8 and mAb41 as disclosed in this specification, preferably mAb8.
[0084] Another particularly preferred embodiment of the antibody-drug conjugate of formula (I) of the first embodiment is as follows:
[0085] ,
[0086] Here, k is 2, and mAb is an anti-GUCY2C antibody selected from the group consisting of mAb1, mAb8 and mAb41 as disclosed in this specification, preferably mAb8.
[0087] In a second aspect, the present invention relates to an antibody-drug conjugate of the first aspect for use as a drug, preferably for use in cancer treatment, more preferably for use in the treatment of gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer.
[0088] In a third aspect, the present invention relates to a pharmaceutical composition comprising the antibody-drug conjugate of the first aspect.
[0089] Accordingly, the second and third embodiments of the present invention also encompass a method for treating cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer, preferably a method for treating gastrointestinal cancers, said method comprising administering a therapeutically effective amount of the antibody-drug conjugate of the first embodiment or the pharmaceutical composition of the third embodiment to a patient in need thereof. Similarly, the second embodiment of the present invention also encompasses the use of the antibody-drug conjugate of the first embodiment in the manufacture of a drug for the treatment of cancer, preferably gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer.
[0090] In such embodiments, gastrointestinal cancer is generally characterized by the expression of a target sequence or epitope of the guanylate cyclase 2C (GUCY2C) antigen. Effects of the invention
[0091] The antibody-drug conjugate of the present invention can provide a modular linker structure that connects a pharmaceutically active drug substance and an antibody.
[0092] The antibody-drug conjugate of the present invention can provide a specific cytotoxic effect against GUCY2C-expressing cells.
[0093] The antibody-drug conjugate of the present invention can provide bystander killing activity against target negative cells located around target positive cells.
[0094] The antibody-drug conjugate of the present invention can provide an antitumor effect that inhibits tumor volume in an in vivo environment, such as an animal model.
[0095] The antibody-drug conjugate of the present invention can provide a pharmaceutical composition for treating GUCY2C-positive gastrointestinal cancer. Brief explanation of the drawing
[0096] Embodiments of the present invention will be described by way of example only with reference to the attached drawings, and the drawings are as follows. FIG. 1 shows the in vitro cytotoxicity of the anti-GCC ADC of the present disclosure containing the linker-payload (IV.8) in (A) HEK cells (HEK293-GUCY2C-HDP-2B3 cells) overexpressing human GUCY2C or (B) HEK293 wild-type cells, compared to the anti-GCC ADC of the present disclosure containing the linker-payload (IV.17) and (IV.19). SEC indicates purification of the ADC by size exclusion chromatography. N / A indicates that EC50 calculation was not performed. All tested ADCs are characterized by having a DAR of 4. FIG. 2 shows the in vitro cytotoxicity of the anti-GCC ADCs of the present disclosure, comprising linker-payloads (IV.9), (IV.12), and (IV.18), in (A) HEK cells overexpressing human GUCY2C (HEK293-GUCY2C-HDP-2B3 cells) or (B) HEK293 wild-type cells. The anti-GCC ADCs tested are DAR=4 conjugates. FIG. 3 shows the mean tumor volume (mm²) from day 0 to day 67 after group assignment in mice treated with a vehicle control or treated with Exatecan-TBDC IV.12 and IV.11 of the present disclosure at a single dose of 15 mg / kg per day. 3 Represents ) (n=10 animals / group, mean displayed ± SD). FIG. 4 shows the mean tumor volume (mm²) from day 0 to day 66 after group assignment in mice treated with the vehicle control, a single dose of 15 mg / kg per day, or the exatecan-TBDC IV.9 of the present disclosure at weekly doses of 10 or 15 mg / kg for 3 weeks. 3 Represents ) (n=10 animals / group, mean displayed ± SD). Figure 5 shows the mean tumor volume (mm²) from day 0 to day 66 after group assignment in mice treated as a vehicle control or treated with the mAb8-based exatecan-TBDC of the present disclosure conjugated to linker-payload IV.8 at a single dose of 15 mg / kg per day. 3 Represents ) (n=10 animals / group, mean displayed ± SD). Figure 6 shows the mean tumor volume (mm²) from day 0 to day 66 after group assignment in mice treated with a vehicle control or treated with the exatecan-TBDC IV.18 of the present disclosure at a single dose of 15 mg / kg per day. 3 Represents ) (n=10 animals / group, mean displayed ± SD). FIG. 7 shows the mean tumor volume (mm²) from day 0 to day 22 after group assignment in mice treated as a vehicle control or treated once weekly for 3 weeks with the mAb8-based exatecan-TBDC of the present disclosure conjugated to linker-payloads IV.9, IV.8, IV.12 or IV.18 or IV.20 (all DAR=4), each at a dose of 5 mg / kg. 3 ) represents (n=10 animals, mean ± SD). hD indicates high DAR (DAR10). FIG. 8 shows the mean tumor volume (mm²) from day 0 to day 22 after group assignment in mice treated as a vehicle control or treated once weekly for 3 weeks with the mAb8-based exatecan-TBDC of the present disclosure conjugated to linker-payloads IV.9, IV.8, IV.12 or IV.18 or IV.20 (all DAR=4), each at a dose of 2.5 mg / kg. 3Represents ) (n=10 animals, mean displayed ± SD). Figure 9 shows an in vitro bystander analysis. Target-negative HEKwt cells stained with CellTracer FarRed and GUCY2C-expressing HEK-GUCY2C cells stained with CFDA were co-cultured and treated with anti-GCC ADCs. After 72 hours, the bystander killing of the compounds was evaluated by analyzing apoptotic (7AAD+) target-negative HEKwt cells. All three anti-GCC ADCs induced apoptotic HEKwt cells in approximately 22.5% to 32.8% of the cells when co-cultured with GUCY2C-expressing HEK-GUCY2C cells, whereas no effect was observed in HEKwt cells without target-expressing HEK-GUCY2C cells. Figure 10 shows the average tumor volume (mm²) from 0 to 100 days after group assignment measured with a caliper. 3 Mice were treated as a vehicle control or with an mAb8-based anti-GUCY2C ADC conjugated to linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) at a dose of 5 mg / kg once weekly for 3 weeks (n=10 mice, mean indicated ± SD). Figure 11 shows the average tumor volume (mm²) from 0 to 100 days after group assignment measured with a caliper. 3 Mice were treated with mAb8-based anti-GUCY2C ADCs conjugated to a vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) at a dose of 2.5 mg / kg once weekly for 3 weeks (n=10 animals, mean indicated ± SD). Figure 12 shows the overall survival rate from 0 to 100 days after group assignment. Survival was monitored daily. Mice were treated with mAb8-based anti-GUCY2C ADCs conjugated to the vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) at a dose of 5 mg / kg once weekly for 3 weeks (n=10 mice, mean indicated ± SD). Figure 13 shows the overall survival rate from 0 to 100 days after group assignment. Survival was monitored daily. Mice were treated with mAb8-based anti-GUCY2C ADCs containing a vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) at a dose of 2.5 mg / kg once weekly for 3 weeks (n=10 mice, mean indicated ± SD). Figure 14 shows the average tumor volume (mm²) from 0 to 87 days after group assignment measured with a caliper. 3 Mice were treated with a single intravenous dose of 10 mg / kg of mAb8-based anti-GUCY2C ADCs containing a vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) (n=10 animals, mean indicated ± SD). Fig. 15 shows the average tumor volume (mm²) from 0 to 87 days after group assignment measured with a caliper. 3 Mice were treated with a single intravenous dose of 5 mg / kg of an mAb8-based anti-GUCY2C ADC conjugated to a vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) (n=10 animals, mean indicated ± SD). Figure 16 shows the overall survival rate from day 0 to day 87 after group assignment. Survival was monitored daily. Mice were treated with a single intravenous dose of 10 mg / kg of mAb8-based anti-GUCY2C ADC conjugated to the vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) (n=10 mice, mean indicated ± SD). Figure 17 shows the overall survival rate from day 0 to day 87 after group assignment. Survival was monitored daily. Mice were treated with a single intravenous dose of 5 mg / kg of an mAb8-based anti-GUCY2C ADC conjugated to the vehicle control, linker-payload IV.9, IV.8, IV.12, IV.18, or IV.22 (all DAR=4 conjugates) (n=10 mice, mean indicated ± SD). Specific details for implementing the invention
[0097] Before describing the present invention in detail below, it should be understood that the present invention is not limited to the specific methodologies, protocols, and reagents described herein and that they may vary. Furthermore, the terms used herein are merely for describing specific embodiments and are not intended to limit the scope of the invention, which is defined solely by the appended claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as generally understood by those skilled in the art.
[0098] Preferably, the terms used herein are defined as described in "A multilingual glossary of biotechnological terms: (IUPAC Recommendations)", Leuenberger, HGW, Nagel, B. and Kolbl, H. eds. (1995), Helvetica Chimica Acta, CH-4010 Basel, Switzerland). Unless otherwise specified, the definitions of chemical groups used herein are defined with the meanings provided in the "Compendium of Chemical Terminology" ("Gold Book") version 2.3.3, goldbook.iupac.org, ISBN: 0-9678550-9-8) published by the International Union of Pure and Applied Chemistry (IUPAC), the contents of which are incorporated herein by reference.
[0099] Nevertheless, the following definitions are provided to provide a clear and consistent understanding of the specification and claims, as well as the scope to be assigned to specific terms.
[0100] 정의
[0101] In the context of the present disclosure, the term “modular linker” refers to a linker comprising at least one cytotoxic drug substance (also simply referred to as a drug or payload) molecule, a structural and functional module (also referred to as a spacer or functional unit or group) comprising at least one solubility enhancer and branching unit, and a reactive group suitable for stably linking the modular linker to a target binding moiety such as an antibody.
[0102] In the context of the present disclosure, the term “solubility enhancer” refers to a module within a modular linker that offsets, or in the best case, neutralizes, the hydrophobic / lipophilic properties of at least the cytotoxic drug substance to provide a high level of solubility to the modular linker containing a specific payload. Various solubility enhancers suitable for introduction into the modular linker of the present disclosure are well known to those skilled in the art and include, without limitation, the following: (a) polar functional groups such as hydroxyl (-OH), amine (-NH2), and carboxyl (-COOH) groups; polar sulfonate (-SO3H) groups; polymer chains such as hydrophilic polyethylene glycol (PEG) chains; surfactant groups such as alkyl chains; aromatic ring structures; halogen substituents such as the addition of fluorine or chlorine; ester (-COO-) or ether (-O-) groups; and cyclodextrin / cyclic oligosaccharides.
[0103] In the context of the present disclosure, the term “self-sacrificial spacer” refers to a spacer that is stably linked to a cytotoxic drug substance but undergoes triggered self-sacrificiality, i.e., degradation, through which the link to the cytotoxic drug substance is lost and the drug substance is released without any adduct or trace of the self-sacrificial spacer itself. In some embodiments, a change in pH may trigger the self-sacrificiality of the spacer and the release of the payload. In other embodiments, the self-sacrificial spacer is also linked to an enzymatically cleavable peptide sequence, and enzymatic cleavage of the peptide triggers the self-sacrificiality of the spacer and the release of the payload. An exemplary example of an enzymatically triggered self-sacrificial spacer is a p-aminobenzyl (PAB) spacer linked to an enzymatically cleavable Val-Ala dipeptide.
[0104] In the context of the present disclosure, the term “cleavable linker” refers to a linker that is cleavable by (i) an enzyme, or (ii) in a reducing environment. Furthermore, the terms “enzymatically cleavable” or “cleavable by an enzyme” or similar terms convey that the peptide, structure, sequence, or spacer in question may be cleavable by an enzyme, particularly a lysosomal protease such as cathepsin B, resulting in the release of a pharmaceutically active drug substance / payload.
[0105] In the context of the present disclosure, the term “branching unit” refers to a structure within a modular linker that enables a compound to branch into a branched structure, wherein each branch is generally connected to at least one cytotoxic drug substance molecule via a self-sacrificial spacer. Thus, the modular linker generally contains as many drug molecules as there are branches. As such, a modular linker comprising 1 to 10, preferably 2 to 8, 2 to 6, or 2 to 4 branches generally contains 1 to 10, preferably 2 to 8, 2 to 6, or 2 to 4 cytotoxic drug substance molecules, respectively.
[0106] As used herein, the term “antibody” refers to a protein composed of one or more polypeptide chains encoded by an immunoglobulin gene or a fragment of an immunoglobulin gene or cDNA derived therefrom. The immunoglobulin gene includes light chain kappa, lambda, and heavy chain alpha, delta, epsilon, gamma, and mu constant region genes, as well as any of many different variable region genes.
[0107] The basic structural unit of an immunoglobulin (antibody) is generally a tetramer composed of two identical pairs of polypeptide chains: a light chain (L, with a molecular weight of approximately 25 kDa) and a heavy chain (H, with a molecular weight of approximately 50–70 kDa). Each heavy chain is a heavy chain variable region (VH or V HAbbreviated as ) and heavy chain invariant region (CH or C H It consists of (abbreviated as ). The heavy chain invariant region consists of three domains, namely CH1, CH2, and CH3. Each light chain is a light chain variable region (VL or V L Abbreviated as ) and light chain invariant region (CL or C L It includes (abbreviated as ). The VH and VL regions can be further subdivided into hypervariable regions, also known as complementarity determining regions (CDRs), which are interspersed with more conserved regions called framework regions (FRs). Each VH and VL region consists of three CDRs and four FRs arranged in the order FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 from amino terminus to carboxy terminus. The variable regions of the heavy and light chains form binding domains that interact with antigens. The constant region (Fc region) does not directly participate in the binding of the antibody and the antigen, but exhibits various effector functions such as participation in antibody-dependent cell-mediated cytotoxicity (ADCC), phagocytosis via binding to the Fcγ receptor, regulation of half-life / clearance via the neonatal Fc receptor (FcRn), and complement activation via the C1q component, thereby leading to complement chemotaxis, opsonization, and (in the case of potentially viable cell antigen targets) lysis. Human antibodies of the IgG1 class are the most potent for activating the complement system and are therefore a preferred isotype as a therapeutic antibody for the ADC of the present invention.
[0108] Human Fcγ receptors include FcγR(I), FcγRlla, FcγRllb, FcVRlla, and neonatal FcRn; while a common set of IgG1 residues is involved in binding to all FcγRs, FcγRII and FcγRIII have been shown to utilize distinct sites outside this common set (Shields et al. (2001) J. Biol. Chem 276: 6591-6604). One group of IgG1 residues that reduces binding to all FcγRs upon modification to alanine consists of Pro-238, Asp-265, Asp-270, Asn-297, and Pro-239 (numbered according to the EU numbering scheme, Edelman et al., Proc. Natl. Acad. Sci. USA; 63 (1969) 78-85). These are all located in the IgG CH2 domain and clustered near the hinge connecting CH1 and CH2. FcgR1 utilizes only a common set of IgG1 residues for binding, whereas FcγRII and FcγRIII interact with distinct residues in addition to the common set. Modifications of some residues reduced binding only to FcγRII (e.g., Arg-292) or FcγRIII (e.g., Glu-293). Some variants showed enhanced binding to FcγRII or FcγRIII but did not affect binding to other receptors. Neonatal FcRn receptors are believed to be involved in both antibody clearance and transcytosis across tissues (see Junghans (1997) Immunol. Res 16: 29-57; and Ghetie et al. (2000) Annu. Rev. Immunol. 18: 739-766). Human IgG1 residues determined to directly interact with human FcRn include Ile253, Ser254, Lys288, Thr307, Gln311, Asn434, and His435.
[0109] Terms used in this specification "CDR", "CDRL 1", "CDR L 2", "CDR L 3", "CDR H 1", "CDR H 2", "CDR H 3" follows the Kabat numbering system (Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., US Department of Health and Human Services, National Institutes of Health (1987)). However, while the Kabat numbering system for amino acid residues within variable domain sequences and full-length antibody sequences is used throughout this specification, it will be apparent to those skilled in the art that alternative numbering systems for amino acid residues within variable domain sequences and full-length antibody sequences exist. Alternative numbering systems for CDR sequences also exist, such as those presented, for example, in Chothia et al. (1989) Nature 342: 877-883. The structure and protein folding of the antibody may imply that different residues based on the numbering system used are considered part of the CDR sequence, and will be understood as such by those skilled in the art; however, functionally, these differences do not imply a change in or different antigen binding of the respective antibodies. Other numbering systems for CDR sequences available to those skilled in the art include The "AbM" (University of Bath) and "contact" (University College London) methods are included.
[0110] The CDR is most important for the binding of the antibody or its antigen-binding portion. As long as the three-dimensional structure necessary for antigen binding is maintained, the FR can be replaced by a different sequence. Structural changes in the structure mostly lead to a loss of sufficient binding to the antigen.
[0111] Antibodies are generally 10-5 M to 10 -11 It specifically binds to cognate antigens with high affinity, as reflected by a dissociation constant (KD) of less than M. Approximately 10 -4 Any K greater than M D It is also generally considered to exhibit non-specific binding.
[0112] As used herein, an antibody "specifically recognized and bound" to an antigen refers to an antibody that binds with high affinity to an antigen and substantially the same antigen, which is 10 -7 M or less, preferably 10 -8 M or less, more preferably 5×10 -9 M or less, most preferably about 10 -8 , 10 -9 M to about 10 -10 M, 10 -11 M or less, or, for example, about 10 -10 M to about 10 -11 It means having a KD of M or less, but not binding to antigens that are unrelated (e.g., structurally or sequence-unrelated) with the same affinity as the specific target.
[0113] The antibodies of the ADC of the present disclosure, which may also be referred to as immunoglobulins, may be derived from any of the generally known isotypes, including but not limited to IgA, secreted IgA, IgG, and IgM. IgG isotypes are divided into subclasses in specific species: IgG1, IgG2, IgG3, and IgG4 in humans, and IgG1, IgG2a, IgG2b, and IgG3 in mice.
[0114] As used herein, the terms “antibody fragment” or “antigen-binding fragment” refer to a fragment or analog of an antibody that retains the binding specificity of the parent anti-GUCY2C antibody disclosed herein and comprises a portion of the antigen-binding region of the parent antibody (e.g., one or more CDRs) or a variable region. An antibody fragment is, for example, a Fab, Fab’, F(ab’)2, Fv fragment, sc-Fv, unibody, diabody, linear antibody, nanobody, domain antibody, or a multispecific antibody fragment formed from an antibody fragment. The Fab fragment consists of a light chain and a CH1 and variable region of a heavy chain. The heavy chain of the Fab molecule cannot form disulfide bonds with other heavy chain molecules. The Fab’ fragment comprises a light chain and a portion of a heavy chain comprising a VH domain, a CH1 domain, and a region between the CH1 and CH2 domains. The F(ab’)2 fragment comprises two light chains and two heavy chains comprising a portion of a constant region between the CH1 and CH2 domains, thereby forming interchain disulfide bonds between the two heavy chains. The F(ab')2 fragment consists of two Fab' fragments joined together by a disulfide bond between the two heavy chains. The "Fv fragment" contains a variable region from both the heavy and light chains but lacks a constant region. The term "single-chain antibody" refers to the antibody's heavy chain variable region V through a linking peptide. H and light chain variable region V L It is a single-chain recombinant protein formed by linking. It is the smallest antibody fragment possessing a complete antigen-binding site. The term "domain antibody fragment" refers to an immunoglobulin fragment with immunological function that contains only a heavy variable region or a light variable region chain. In some cases, two or more VH regions are covalently linked to a peptide linker to form a bivalent domain antibody fragment. The two V of a bivalent domain antibody fragment H The region can target the same or different antigens.
[0115] In the context of the present disclosure, the term “reactive moiety for conjugation to an antibody” refers to a chemically reactive group within a linker that can react with a corresponding reactive group of an antibody under appropriate conditions so that the resulting reaction product covalently conjugates the remaining linker compound to the antibody.
[0116] In the context of the present disclosure, the term “reaction product of a modular linker and a corresponding reactive group of an antibody” refers to a moiety formed as a result of a reaction between a reactive moiety of a modular linker of the present disclosure and a corresponding reactive group of an antibody. For example, if the reactive moiety of a modular linker of the present disclosure is maleimide, the reaction product generated from the reaction of maleimide with a sulfur atom of a cysteine residue of a target binding moiety is succinimidyl thioether or a derivative thereof. Furthermore, if the reactive moiety of a modular linker of the present disclosure is a group that selectively reacts with a thiol group of free cysteine of a target binding moiety, i.e., if the reactive moiety of a modular linker is a “thiol-reactive moiety,” the reaction product is generally selected from the following: thiol-substituted acetamide; thiol-substituted succinimide; thiol-substituted succinic acid; Thiol-substituted heteroaryls, particularly thiol-substituted benzothiazole, thiol-substituted phenyltetrazole and thiol-substituted phenyloxadiazole; and as disulfides, wherein one sulfur atom is derived from a cysteine residue of a target bond moiety.
[0117] As used herein, a “derivative” of a compound refers to a species having a chemical structure similar to that of a compound but comprising at least one chemical group not present in the compound, or lacking at least one chemical group present in the compound. The compound to which the derivative is compared is referred to as the “parent” compound. Generally, the “derivative” may be produced from the parent compound through one or more chemical reaction steps.
[0118] In the context of the present disclosure, the term “pharmaceutically acceptable salt or solvate” comprises an acid addition salt formed from an inorganic acid such as hydrochloric acid, hydrobromide, sulfuric acid, nitric acid, phosphoric acid, etc.; or an organic acid such as glycolic acid, pyruvate, lactic acid, malonic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, 3-(4-hydroxybenzoyl)benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4-toluenesulfonic acid, camphosulfonic acid, lauryl sulfuric acid, gluconic acid, glutamic acid, salicylic acid, muconic acid, etc. This term also includes a base addition salt formed with the conjugate base of any one of the inorganic acids listed above, wherein the conjugate base is Na + , K + , Mg 2+ , Ca 2+ and NH g R' 4-g + It includes a cationic component selected from the group consisting of (where R' is C 1-3 It is an alkyl and g is a number selected from 0, 1, 2, 3 or 4), and also includes the solvent addition form (i.e., solvate) of each acid addition salt.
[0119] As used herein, “treatment,” “treating,” or “treatment” of a disease or disorder means achieving one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing the manifestation of characteristic symptoms of the disorder being treated; (c) suppressing the exacerbation of characteristic symptoms of the disorder being treated; (d) limiting or preventing the recurrence of the disorder in patients who have previously suffered from the disorder; and (e) limiting or preventing the recurrence of symptoms in patients who have previously suffered from the disorder.
[0120] As used herein, “patient” means any mammal that may benefit from treatment using the targeted binding drug conjugate described herein. Preferably, “patient” is selected from the group consisting of experimental animals (e.g., mice or rats), livestock (e.g., including guinea pigs, rabbits, chickens, pigs, sheep, goats, camels, cattle, horses, donkeys, cats, or dogs), or primates including humans. It is particularly preferred that “patient” be human.
[0121] "Therapeutically effective dose" is an amount of therapeutic agent sufficient to achieve the intended purpose. The effective dose of a given therapeutic agent will vary depending on factors such as the properties of the agent, the route of administration, the size and species of the animal receiving the agent, and the purpose of administration. The effective dose for each individual case may be determined empirically by a person skilled in the art according to methods established in the art.
[0122] In addition to the definitions above, unless clearly required otherwise by the context, throughout the detailed description and claims, words such as “include,” “including,” etc., shall be interpreted in an inclusive sense as opposed to an exclusive or inclusive sense; that is, meaning “includes but not limited thereto.”
[0123] Furthermore, references to "one embodiment," "some embodiments," or "one embodiment" throughout this specification mean that specific features, structures, or characteristics described in relation to such embodiments are included in at least one embodiment of the present invention. Accordingly, phrases such as "in one embodiment," "some embodiments," or "one embodiment" appearing in various places throughout this specification do not necessarily refer to the same embodiment, but may. Furthermore, as will be apparent to those skilled in the art from this disclosure, specific features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
[0124] When used in this specification, unless otherwise specified, ordinal adjectives such as “first,” “second,” “third,” etc. used to describe common objects merely indicate that they refer to different instances of similar objects and are not intended to imply that the objects so described must be in a given order in time, space, rank, or any other way.
[0125] As used in this specification, the term "exemplary" is used to mean providing an example rather than indicating quality. That is, an "exemplary embodiment" is an embodiment provided as an example, rather than necessarily being an embodiment of exemplary quality.
[0126] Throughout the body of this specification, various documents are cited. Each document cited in this specification (including all patents, patent applications, scientific publications, manufacturer specifications, guidelines, GenBank access number sequence submissions, etc.) is incorporated herein by reference in its entirety to the extent possible under each patent law, regardless of whether it is for the purposes of the above or below.
[0127] 항체-약물 접합체(ADC)
[0128] The inventors of the present disclosure have developed a novel antibody-drug conjugate (ADC) comprising a modular linker that includes various modules (i.e., also referred to as groups, units, elements, etc.) and is involved in the function and efficacy of the ADC. The modular structure of this linker can not only accommodate pharmaceutically active drug substances having various physicochemical properties, but also stably connect the linker carrying the drug substance to the antibody, thereby providing a robust and reliable ADC.
[0129] In addition, as will become apparent from the additional description below, the conjugation chemistry employed in the ADC can easily achieve a uniform degree of labeling (DOL) of 2 per linker molecule and a drug-antibody ratio (DAR) of 4 to 8.
[0130] Accordingly, considering the specificity of antibodies against specific cancer-associated or cancer-specific antigens, it has been found that the ADC of the present disclosure can efficiently target selected GUCY2C-positive cancer cells using the pharmaceutically active drug substance of the conjugate.
[0131] Accordingly, in a first aspect, the present invention relates to an antibody-drug conjugate (ADC) of formula (I) or a pharmaceutically acceptable salt or solvate thereof:
[0132]
[0133] Chemical formula (I)
[0134] Here;
[0135] k is an integer from 2 to 4;
[0136] Ab is an anti-GUCY2C antibody;
[0137] D is It is a pharmaceutically active substance selected from, where:
[0138] - R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or; or
[0139] - R 1 is -H, and R 2 is -CH2N(CH3)2, and R 3 is -OH, and R 4 is -H, and R 5 is -O- or; or
[0140] - R 1 is -CH2CH3, and R 2 is -H, and R 3 Is and R 4 is -H, and R 5 is -O- or; or
[0141] - R 1is -H, and R 2 is -NO2, and R 3 is -H, and R 4 is -H, and R5 is -O- or; or
[0142] - R 1 is -CH2CH2NHCH(CH3)2, and R 2 is -H, and R 3 is -H, and R 4 is -H, and R 5 is -O- or; or
[0143] - R 1 is -CH2CH3, and R 2 is -H, and R 3 is -OH, and R 4 is -H, and R 5 is -O- and;
[0144] SE is a solubility enhancer and includes alpha-cyclodextrin, beta-cyclodextrin, gamma-cyclodextrin, polysarcosine, PEG, or polyalcohols prepared from carbohydrates.
[0145] A particularly suitable pharmaceutically active drug substance D in the ADC of the present disclosure is a camptothecin class, which is a class of natural and synthetic compounds that exhibit an anticancer effect by inducing DNA damage and eventual cancer cell death by interfering with the DNA replication and repair processes of cancer cells through inhibition of topoisomerase I. In the ADC of the present invention, the pharmaceutically active drug substance D is a camptothecin compound selected from SN-38, topotecan, irinotecan, rubitecan, belotecan, SN38, and exatecan.
[0146] SN-38, a notable member of this family of compounds, is a derivative of camptothecin and is produced as an active metabolite when the chemotherapy drug irinotecan (CPT-11) is metabolized in the patient's body.
[0147] Topotecan and irinotecan are also camptothecin compounds used as chemotherapy agents in the treatment of various cancers, including ovarian cancer, small cell lung cancer, and cervical cancer. As previously mentioned above, irinotecan is a prodrug that is administered in an inactive form and then converted into an active form (SN-38) within the body. Both topotecan and irinotecan are generally administered by intravenous injection.
[0148] Rubitecan remains an investigational chemotherapy agent of the camptothecin class, similar to irinotecan and topotecan. Rubitecan has been studied for its potential use in treating various cancers, including colorectal, ovarian, and pancreatic cancers, and has been extensively researched in the field of cancer research.
[0149] Belotecan is an additional camptothecin compound that has been found to inhibit topoisomerase 1, thereby interfering with essential DNA replication and repair processes that lead to cancer cell death.
[0150] Exatecan is another camptothecin compound (also known as DX-8951f or SG2000) suitable for inclusion in the ADC of the present invention.
[0151] Considering the above, preferably D is and, here:
[0152] - R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or; or
[0153] - R 1 is -H, and R 2 is -CH2N(CH3)2, and R 3 is -OH, and R 4 is -H, and R 5 is -O- or; or
[0154] - R 1 is -CH2CH3, and R 2 is -H, and R3 Is and R 4 is -H, and R 5 is -O-.
[0155] Most preferably, D is am.
[0156] As disclosed above, both the pharmaceutically active substance D and the solubility enhancer SE are connected to the self-sacrificial spacer of the modular linker of the ADC. Specifically, D is connected at the para position to the cleavable linker sequence of the self-sacrificial portion of the aminobenzyl spacer, whereas the solubility enhancer SE is connected at the meta position to the attached cleavable linker sequence. Thus, when the aminobenzyl spacer undergoes self-sacrificial, i.e., degradation, triggered by the self-sacrificial reaction, the pharmaceutically active drug substance D is released as a metabolite of the self-sacrificial reaction without leaving any chemical moiety from the linker compound. In such an embodiment, the amino group of the para-aminobenzyl spacer acts as an electron donor in the electron cascade of the 1,6-self-sacrificial reaction that releases the cytotoxic drug substance D. Advantageously, this traceless release mechanism ensures that the cytotoxic drug substance is not modified during the process of being connected to the linker compound and subsequently released.
[0157] It was found that it is advantageous for the solubility enhancer SE to be connected to the meta position of the self-sacrificial spacer and for the cytotoxic drug substance to be connected to the adjacent para position. Although I do not want to be bound by theory, the proximity of the solubility enhancer SE and the cytotoxic drug substance D forms a so-called "host-guest" complex, which masks the lipophilic / hydrophobic properties of the drug substance, resulting in an additional increase in the solubility of the modular linker compound.
[0158] When an ADC recognizes and binds to a target sequence or target epitope of a cancer-specific antigen, it is internalized by the cancer cell and becomes a substrate for lysosomal proteases. In the ADC of the present invention, a self-sacrificial spacer is linked to a cleavable dipeptide sequence that is a target of lysosomal proteases, which is a target for cysteine proteases of the cathepsin family, including cathepsin B, C, D, H, L, S, and Z. Typically, the dipeptide sequence is a valine-alanine (Val-Ala) sequence that is cleavable by cathepsin B. When the dipeptide sequence is cleaved, an electron cascade of the self-sacrificial reaction is triggered, inducing the traceless release of a drug substance from the self-sacrificial spacer of the ADC.
[0159] In an alternative case, the peptide sequence may be a dipeptide selected from valine-citrulline (Val-Cit) or phenylalanine-lysine (Phe-Lys), or a tripeptide selected from glutamic acid-valine-alanine (Glu-Val-Ala) or glutamic acid-valine-citrulline (Glu-Val-Cit).
[0160] As already mentioned above, an advantageous feature of the modular linker of the ADC of the present disclosure is a multimer core comprising two sequential amino acid-based branching units, each branching unit being indirectly connected to a self-sacrificial spacer that carries both a dipeptide or tripeptide sequence and a pharmaceutically active drug substance D and a solubility enhancer SE.
[0161] In some embodiments, in the ADC of the first embodiment, a branch unit distal from the junction site of the drug-carrying linker carries a terminal acyl cap, wherein the acyl cap constitutes the terminal of the final branch unit within the multimeric core of the modular linker. Furthermore, each branch unit carries a C2-amide-PEG from a dipeptide or tripeptide sequence preceding a self-sacrificial spacer that carries both D and SE. n Separated by spacers. The term "C2-amide-PEG"n " refers to a linker comprising an ethylene glycol moiety covalently bonded to a propylamide group, and , where n is about 1 to about 10, e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
[0162] In addition, as mentioned above, pharmaceutically active drug substances including camptothecin generally have adversely low solubility in aqueous solutions such as physiological / systemic solutions. Therefore, to prevent unwanted aggregation of the ADC of the present invention, the modular linker must include one solubility enhancer S connected to each self-sacrificial spacer. The solubility enhancer SE may be an alpha-cyclodextrin, beta-cyclodextrin, gamma-cyclodextrin, polysarcosine, PEG, or a polyalcohol made from a carbohydrate.
[0163] Cyclodextrins are cyclic oligosaccharides composed of glucose units arranged in a toroidal (donut) shape. They possess a hydrophobic interior and a hydrophilic exterior. This unique structure enables the formation of inclusion complexes with hydrophobic or sparingly soluble molecules, and the solubility of hydrophobic or lipophilic pharmaceutical substances generally increases when they form complexes with cyclodextrins. Therefore, hydrophobic pharmaceutical active substances can improve solubility by being encapsulated within the hydrophobic pockets of cyclodextrins and protected from the surrounding aqueous environment. Nevertheless, cyclodextrins are chemically compatible with a wide range of pharmaceutical active substances and are generally non-reactive to molecules encapsulated through the formation of inclusion complexes. This allows for the simultaneous maintenance of complex stability and the integrity of the pharmaceutical active substance.
[0164] Furthermore, cyclodextrins have been widely used in the pharmaceutical, food, and cosmetic industries for many years, and their overall safety and biocompatibility profiles are established to be excellent.
[0165] Accordingly, cyclodextrin is a solubility enhancer S particularly suitable in the context of the linker compounds described herein. For example, amide-PEG 1-12 Alpha-cyclodextrin (composed of 6 glucose molecules), beta-cyclodextrin (composed of 7 glucose molecules), and gamma-cyclodextrin (composed of 8 glucose molecules) are suitable for attachment to spacers.
[0166] Accordingly, in some embodiments of the ADC of the first aspect, SE is selected from the following:
[0167] ,
[0168] Here, m is 2 to 12, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12, and preferably m is 4, 5, 6, 7 or 8;
[0169] .
[0170] Here, n is 2 to 12, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12, and preferably n is 4, 5, 6, 7 or 8;
[0171] ,
[0172] Here, p is 1 to 20, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, preferably p is 8 to 14, more preferably p is 10 to 12; or
[0173] ,
[0174] Here, q is 2 to 12, for example, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12, and preferably q is 4, 5, 6, 7 or 8.
[0175] In some embodiments,
[0176] SE is and m is 4.
[0177] Alternatively,
[0178] SE is and m is 8.
[0179] For the beta-cyclodextrin presented above, selecting a PEG spacer length of m = 4 or m = 8 is particularly advantageous when the pharmaceutical drug substance D is camptothecin.
[0180] In additional embodiments,
[0181] SE is and n is 4.
[0182] Selecting the length of the PEG spacer with n = 4 for gamma-cyclodextrin is particularly advantageous when the pharmaceutical drug substance D is camptothecin.
[0183] It is particularly advantageous to link a cyclodextrin-based solubility enhancer of the type exemplified above to a self-sacrificial spacer X via a PEG chain of the length indicated above. This PEG chain length favors a stereochemical arrangement of the linker compound that enables an inclusion complex in which the lipophilic drug substance is placed in a pocket of the cyclodextrin ring structure, thereby substantially neutralizing the hydrophobic / lipophilic properties of camptothecin.
[0184] In additional embodiments, SE is and p is 10.
[0185] In some embodiments, SE is and q is 8.
[0186] As previously indicated, the antibody of the ADC specifically recognizes and binds to the target sequence or epitope of the antigen to mediate the cancer cell specificity of the ADC. However, as described above, the antibody of the ADC of the first embodiment is preferably one of the following:
[0187] Monoclonal antibody;
[0188] - Antigen-binding fragments such as single-chain variable fragments (scFv), Fab fragments, F(ab') fragments, F(ab')2 fragments, or functional antibody fragments or antibody derivatives such as bispecific or trispecific antibody constructs;
[0189] - Diabody;
[0190] - Camel antibody;
[0191] - Domain antibody;
[0192] - Nanobody;
[0193] - A divalent homomer having two chains composed of scFv;
[0194] - Shark antibodies;
[0195] - An antibody composed of a New World primate framework sequence and a non-New World primate complementarity determining region (CDR); or
[0196] - Invariant heavy chain 3 (CH3) domain, variable light chain (V L ) and variable heavy chain (V H A dimeric structure containing ).
[0197] The diabody disclosed above refers to an antibody-like molecule in which a variable region (VH) of the heavy chain and a variable region (VL) of the light chain derived from the same parent antibody form a heterodimer through non-covalent bonding. Diabodies and their production are disclosed, for example, in Holliger, et al., Proc. Natl. Acad. Sci. USA 90, 6444-6448, 1993. The diabody may be a cysteine-engineered diabody to facilitate conjugation to the linker-payload disclosed herein, for example.
[0198] term "nanobody" ®"(Nb) refers to a single variable domain (VHHs) of camel heavy chain antibodies (hcAbs). The anti-GUCY2C nanobody may be conjugated to the linker-payload of the present disclosure, for example, by introducing a cysteine-containing linker to which the linker-payload of the present disclosure can be conjugated. Given the short plasma half-life of the nanobody, it is advantageous to fuse the anti-GUCY2C nanobody to a second nanobody that binds to human serum albumin (HSA) via the linker. A corresponding method is disclosed, for example, in J Nanobiotechnol 21, 410 (2023).
[0199] The term “shark antibody” refers to an IgNAR representing an essential antibody of the shark’s adaptive immune system. The IgNAR comprises a heavy-chain homomer that does not bind to the light chain. Antigen binding of the IgNAR requires two independent and highly soluble VNARs (variable domains of the IgNAR) having a molecular weight of about 12 kDa. The shark VNAR is the smallest naturally occurring antibody-like molecule. The IgNAR directed toward GUCY2C may be recombinantly engineered to include one or more cysteine residues to facilitate, for example, conjugation to the linker-payload of the present disclosure, or modified to include a cysteine-containing linker to which the linker-payload disclosed herein can be conjugated. As with nanobodies, the IgNAR may be fused to an anti-HAS IgNAR to improve pharmacokinetic properties; see, for example, mAbs 4:6, 673-685; November / December 2012. Preferably, the shark antibody is a deimmunized antibody.
[0200] Each of the aforementioned antibody formats must ensure highly specific recognition and binding of the target sequence or target epitope of the cancer-specific antigen to avoid undesirable off-target effects.
[0201] In the context of the present invention, when a patient with gastrointestinal cancer, such as a patient with colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer, wishes to benefit from the ADC of the first embodiment, the antibody is generally a monoclonal antibody that recognizes and binds to a target sequence or epitope of guanylate cyclase 2C (GUCY2C), preferably human or crab-eating monkey guanylate cyclase 2C, more preferably human guanylate cyclase 2C.
[0202] A highly specific anti-GUCY2C is described in PCT / EP2023 / 080350 (published as WO2024 / 094688 A1), which is incorporated herein by reference in its entirety.
[0203] Accordingly, in one embodiment of the first aspect, the antibody of the ADC is a monoclonal anti-GUCY2C antibody mAb1, which comprises an antigen-binding region comprising the following:
[0204] - CDR of Sequence No. 1 L 1, CDR of Sequence No. 2 L CDR of 2 and Sequence No. 3 L The variable region of the mAb1 light chain (mAb1 V) of 3 L ) Complementarity-Decision Region (CDR L ) sequence; and
[0205] - CDR of Sequence No. 4 H 1, CDR of Sequence No. 5 H CDR of 2 and Sequence No. 6 H 3 mAb1 heavy chain variable region (mAb1 V H ).
[0206] More specifically, the mAb1 antibody includes an antigen-binding region comprising the following:
[0207] - Framework region 1 of sequence number 14 (FR L 1), CDR of Sequence No. 1 L 1, FR of Sequence No. 15 L 2, CDR of Sequence No. 2 L 2, FR of Sequence No. 16L 3, CDR of Sequence No. 3 L FR of 3 and Sequence No. 17 L The above mAb1 V including 4 L ; and
[0208] - Framework region 1 of sequence number 18 (FR H 1), CDR of Sequence No. 4 H 1, FR of Sequence No. 19 H 2, CDR of sequence number 5 H 2, FR of Sequence No. 20 H 3, CDR of sequence number 6 H FR of 3 and Sequence No. 21 H The above mAb1 V including 4 H .
[0209] Furthermore, the mAb1 antibody includes an antigen-binding region comprising the following:
[0210] - The above mAb1 V of Sequence No. 32 L ; and
[0211] - The above mAb1 V of Sequence No. 33 H .
[0212] In another embodiment of the first aspect, the antibody of the ADC is a monoclonal anti-GUCY2C antibody mAb8, which comprises an antigen-binding region comprising the following:
[0213] - CDR of Sequence No. 1 L 1, CDR of Sequence No. 2 L CDR of 2 and Sequence No. 7 L The variable region of the mAb8 light chain (mAb8 V) of 3 L ) Complementarity-Decision Region (CDR L ) sequence; and
[0214] - CDR of Sequence No. 4 H 1, CDR of Sequence No. 5 H CDR of 2 and Sequence No. 6 H 3 mAb8 heavy chain variable region (mAb8 V H ).
[0215] More specifically, the mAb8 antibody includes an antigen-binding region comprising the following:
[0216] - Framework region 1 of sequence number 22 (FR L 1), CDR of Sequence No. 1 L 1, FR of Sequence No. 15 L 2, CDR of Sequence No. 2 L 2, FR of Sequence No. 23 L 3, CDR of Sequence No. 7 L FR of 3 and Sequence No. 24 L The above mAb8 V including 4 L ; and
[0217] - Framework region 1 of sequence number 18 (FR H 1), CDR of Sequence No. 4 H 1, FR of Sequence No. 19 H 2, CDR of sequence number 5 H 2, FR of Sequence No. 20 H 3, CDR of sequence number 6 H FR of 3 and Sequence No. 21 H The above mAb8 V including 4 H .
[0218] Furthermore, the mAb8 antibody includes an antigen-binding region comprising the following:
[0219] - The above mAb8 V of Sequence No. 34 L ; and
[0220] - The above mAb8 V of Sequence No. 35 H .
[0221] In another embodiment of the first aspect, the antibody of the ADC is a monoclonal anti-GUCY2C antibody mAb41, which comprises an antigen-binding region comprising the following:
[0222] - CDR of Sequence No. 8 L 1, CDR of Sequence No. 9 L CDR of 2 and Sequence No. 10 L 3 mAb41 light chain variable region (mAb41 V L) Complementarity-Decision Region (CDR L ) sequence; and
[0223] - CDR of Sequence No. 11 H 1, CDR of Sequence No. 12 H CDR of 2 and Sequence No. 13 H 3 mAb41 heavy chain variable region (mAb41 V H ).
[0224] More specifically, the mAb41 antibody includes an antigen-binding region comprising the following:
[0225] - Framework region 1 of sequence number 25 (FR L 1), CDR of Sequence No. 8 L 1, FR of Sequence No. 26 L 2, CDR of sequence number 9 L 2, FR of Sequence No. 27 L 3, CDR of Sequence No. 10 L FR of 3 and Sequence No. 28 L The above mAb41 V including 4 L ; and
[0226] - Framework region 1 of sequence number 29 (FR H 1), CDR of Sequence No. 11 H 1, FR of Sequence No. 30 H 2, CDR of Sequence No. 12 H 2, FR of Sequence No. 31 H 3, CDR of Sequence No. 13 H FR of 3 and Sequence No. 21 H The above mAb41 V including 4 H .
[0227] Furthermore, the mAb41 antibody includes an antigen-binding region comprising the following:
[0228] - The above mAb41 V of Sequence No. 36 L ; and
[0229] - The above mAb41 VH of Sequence No. 37.
[0230] In some embodiments of the antibody-drug conjugate according to the first embodiment, the antibody is: (a) a humanized or human antibody; and / or (b) an IgG-type antibody, preferably an IgG1 antibody; and / or (c) a recombinant antibody.
[0231] According to one embodiment, the anti-GUCY2C antibody of the ADC is a recombinant antibody or its antigen-binding fragment. As used herein, the terms “recombinant” or “recombinantly produced” refer to proteins such as the anti-GUCY2C antibody or antigen-binding fragment of the present disclosure disclosed herein being expressed in heterologous cells. For example, the anti-GUCY2C antibody or antigen-binding fragment of the present disclosure may be expressed in prokaryotic or eukaryotic cells. Prokaryotic cells for expressing the antibody of the ADC of the present disclosure include, for example, Gram-negative bacteria such as Escherichia coli, or Gram-positive bacteria such as Bacillus subtilis. The use of a heterologous prokaryotic expression system may be particularly useful for the expression of the antigen-binding fragment of the anti-GUCY2C antibody of the ADC of the present disclosure, which is, for example, for Fab fragment expression Kwong and Rader, Curr. Protoc. Protein Sci. It can be performed in accordance with established protocols known in the industry, such as 55:6.10.1-6.10.14.
[0232] However, due to the glycosylation of heterologously expressed antibodies, the use of eukaryotic cells is preferred for the expression of the antibody or antigen-binding fragment of the present disclosure. It is more preferable to use mammalian cells for the expression of the antibody or antigen-binding fragment of the present disclosure. For example, Chinese hamster ovary (CHO) cells, or any of their genetically distinct progeny such as K1-, DukX B11-, or DG44- cell lines, may be used for the expression of the antibody of the present disclosure. Other mammalian cell lines that may be used to produce the antibody or antigen-binding fragment of the present disclosure include, for example, NS0 cells, embryonic kidney (HEK) 293 cells, PER.C6 cells, and MCF7 cells. Cells may be transfected, for example, with an expression vector containing a coding sequence for the anti-GUCY2C antibody or antigen-binding fragment according to the present disclosure. The expression vector or recombinant plasmid is produced by placing the coding antibody sequence under the control of an appropriate regulatory gene containing a promoter and enhancer sequence, such as a CMV promoter. The heavy chain and light chain sequences may be expressed, for example, from individual expression vectors that are co-transfected, or from dual expression vectors. The transfection may be transient transfection or stable transfection. The transfected cells are subsequently cultured to produce transfected antibody constructs. When stable transfection is performed, stable clones secreting antibodies having appropriately combined heavy and light chains are screened and selected using appropriate assays such as ELISA, subcloned, and amplified for future production. Corresponding methods are disclosed, for example, in WO03 / 018771.
[0233] According to one embodiment, the anti-GUCY2C antibody of the ADC of the present disclosure comprises an Fc region comprising the amino acid sequence according to SEQ ID NO. 38. The antibody of the present disclosure comprising the Fc region comprising the amino acid sequence according to SEQ ID NO. 38 may induce antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell phagocytosis (ADCP), or complement-dependent cytotoxicity (CDC). However, to prevent, for example, target cell death, unwanted cytokine secretion, or death of cells expressing Fcγ receptors such as macrophages, it may be desirable to reduce or eliminate the effector function of the antibody of the ADC of the present disclosure as disclosed herein.
[0234] Accordingly, the anti-GUCY2C antibody of the ADC of the present disclosure described herein may include modifications and / or mutations that alter the properties of the antibody and / or fragment that reduce ADCC, ADCP, or complement-dependent cytotoxicity (CDC) as known in the art. Preferably, ADCC, ADCP, and CDC are reduced by at least 90%, more preferably at least 95%, more preferably at least 97.5%, and even more preferably at least 98% and 99% compared to an antibody containing a wild-type Fc region comprising, for example, the amino acid sequence according to SEQ ID NO. 38.
[0235] The binding of IgG1 to activating and inhibitory Fcγ receptors (FcγRs) or the first component of complement (C1q) depends on residues located in the hinge region and the CH2 domain. Two regions of the CH2 domain are important for the binding of FcγRs and complement C1q and possess unique sequences. Substitution of human IgG1 and IgG2 residues at positions 233–236 and IgG4 residues at positions 327, 330, and 331 significantly reduced ADCC and CDC (Armour, et al., Eur. J. Immunol. 29(8) (1999) 2613–2624; Shields, et al., J. Biol. Chem. 276(9) (2001) 6591–6604, WO 2021 / 234402 A2).
[0236] Accordingly, in one embodiment, the anti-GUCY2C antibody of the ADC of the present disclosure comprises a variant Fc region, wherein the variant Fc region comprises at least one amino acid modification relative to the wild-type Fc region (e.g., comprising the amino acid sequence according to SEQ ID NO. 38) such that the molecule has reduced affinity for the IgG1 Fc receptors FcγRI, FcγRII, and FcγRIII as well as for the complement component C1q.
[0237] Affinity for the Fc region, such as the binding of IgG1 to FcγRs, can be determined using various techniques known in the art, for example, equilibrium methods (e.g., enzyme-linked immunosorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or surface plasmon resonance assays as disclosed in Wilkinson et al. PLoS One. 2021; 16(12): e0260954 or other kinetic-based assay mechanisms (e.g., BIACORE™ assay or Octet™ assay (forteBIO)), and other methods such as indirect binding assays, competitive binding assays, fluorescence resonance energy transfer (FRET), gel electrophoresis, and chromatography (e.g., gel filtration), but are not limited thereto.
[0238] Accordingly, in some embodiments, the anti-GUCY2C antibody of the ADC of the present disclosure has been genetically engineered to include a variant Fc region comprising a modification of at least one amino acid residue in direct contact with FcγRs based on structural and crystallographic analysis. As used herein, the terms “genetically engineered” or “genetically engineered” relate to modification in the sense of nucleotide and / or amino acid substitution, insertion, deletion, or reversal, or any combination thereof, of the amino acid sequence of a given or natural polypeptide or protein (e.g., the Fc region of an antibody) or a part thereof, by site-directed mutagenesis, etc., as described in Carter, Biochem. J. (1986) Vol. 237: 1-7 or J Biol Chem. (2015) Vol. 290(5): 2577-2592. As used herein, the terms “amino acid substitution” or “mutation” relate to a modification of the amino acid sequence of a protein, wherein one or more amino acids are replaced by an equal number of different amino acids to produce a protein having an amino acid sequence different from that of the original protein. Conservative amino acid substitutions are understood to relate to substitutions that do not significantly alter the structure and function of a protein due to similar size, charge, polarity, and / or stereochemistry. In this sense, conservative amino acid groups refer, for example, the nonpolar amino acids Gly, Ala, Val, Ile, and Leu; the aromatic amino acids Phe, Trp, and Tyr; the positively charged amino acids Lys, Arg, and His; and the negatively charged amino acids Asp and Glu.
[0239] Importantly, the Fc region of the antibody ADC of the present disclosure is genetically engineered to include at least one cysteine amino acid substitution in a region within the Fc region so that the designed cysteine is available for conjugation but does not interfere with immunoglobulin folding and assembly. Corresponding cysteine-substituted or cysteine-designed antibodies are disclosed in WO2016040856A2, or Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729; US 7521541; US 7723485; WO2009 / 052249 and WO2016 / 142049. A preferred cysteine substitution in the Fc region of the antibody of the present invention disclosed herein is D265C disclosed in WO2016142049A1 (according to the EU numbering system).
[0240] Preferably, the antibody comprises a heavy chain constant (Fc) region containing the amino acid substitution D265C. More specifically, the mAb1 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 39, the mAb8 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 40, and the mAb41 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 41. More preferably, the heavy chain constant (Fc) region comprises the amino acid substitutions L234A, L235A, and D265C according to the EU numbering system (Edelman et al., 1969, Proc Natl Acad Sci USA 63:78-85). The EU numbering system may also be referred to as the "EU index in Kabat" and refers to the numbering of human IgG1 EU antibodies, which refers to the numbering of EU antibodies in Edelman et al., 1969, Proc Natl Acad Sci USA 63:78-85. Specifically, in an embodiment in which all three substitutions L234A, L235A, and D265C are present in the Fc region of the antibody of the ADC of the present invention, the mAb1 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 42, the mAb8 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 43, and the mAb41 antibody comprises the heavy chain constant (Fc) region of SEQ ID NO. 44. More preferably, the antibody comprises (a) the mAb1-L234A-L235A-D265C heavy chain of SEQ ID NO. 42; or (b) the mAb8-L234A-L235A-D265C heavy chain of SEQ ID NO. 43; or (c) the mAb41-L234A-L235A-D265C of SEQ ID NO. 44. The use of the Fc region comprising the substitutions L234A, L235A, and D265C in the anti-GUCY2C antibody of the ADC of the first embodiment results in at least 95%, 97% interaction of the corresponding Fc region (i.e., containing the mutation) with FcγRs compared to the wild-type Fc region.It is particularly advantageous for providing attachment sites for drug delivery linkers to antibodies via site-specific thiol-based conjugation while simultaneously reducing by 5% and 99%. Corresponding uses for linker-payload conjugation of antibodies containing such cysteine-substituted Fc regions and such mutations are disclosed, for example, in WO2016142049A1.
[0241] In a preferred embodiment, the mAb1 antibody comprises a light chain amino acid sequence according to SEQ ID NO. 45 and a heavy chain amino acid sequence according to SEQ ID NO. 42.
[0242] In a preferred embodiment, the mAb8 antibody comprises a light chain amino acid sequence according to SEQ ID NO. 46 and a heavy chain amino acid sequence according to SEQ ID NO. 43.
[0243] In a preferred embodiment, the mAb41 antibody comprises a light chain according to SEQ ID NO. 47 and a heavy chain according to SEQ ID NO. 44.
[0244] In some embodiments, the present invention relates to the use of a cysteine-engineered anti-GUCY2C antibody as disclosed above, comprising at least the amino acid substitution D265C (according to the EU numbering system), in the manufacture of the antibody-drug conjugate of the present invention, preferably said cysteine-engineered anti-GUCY2C antibody comprises the amino acid substitutions L234A, L235A, and D265C (according to the EU numbering system). For example, the present disclosure relates to the use of the anti-GUCY2C antibodies mAb1, mAb8, and mAb41 disclosed herein in the manufacture of the antibody-drug conjugate disclosed herein. For example, in some embodiments, the present disclosure relates to the use of mAb1 disclosed herein in the manufacture of an antibody-drug conjugate by conjugating mAb1 to one of linker-payloads IV.9, IV.8, IV.12, IV.18, IV.20, or IV.22. In some embodiments, the present disclosure relates to the use of mAb8 disclosed herein in preparing antibody-drug conjugates by conjugating mAb8 to one of linker-payloads IV.9, IV.8, IV.12, IV.18, IV.20, or IV.22. In some embodiments, the present disclosure relates to the use of mAb41 disclosed herein in preparing antibody-drug conjugates by conjugating mAb41 to one of linker-payloads IV.9, IV.8, IV.12, IV.18, IV.20, or IV.22. The conjugation in the above embodiments may be performed, for example, as described in the present disclosure.
[0245] In one specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0246] In one specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0247] In one specific embodiment of the first aspect, the antibody-drug conjugate
[0248] and, where k is 2.
[0249] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0250] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0251] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0252] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0253] In another specific embodiment of the first aspect, the antibody-drug conjugate
[0254] and, where k is 2.
[0255] In another specific embodiment of the first aspect, the antibody-drug conjugate
[0256] and, where k is 2.
[0257] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0258] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0259] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0260] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0261] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0262] In another specific embodiment of the first aspect, the antibody-drug conjugate and, where k is 2.
[0263] As indicated above, in a second aspect, the present disclosure also relates to an ADC of a first aspect for use as a pharmaceutical agent.
[0264] As previously explained, the above ADC is particularly suitable for use in cancer treatment, more preferably for the treatment of gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer, wherein the gastrointestinal cancer may be characterized by the expression of a target sequence or epitope of the guanylate cyclase 2C (GUCY2C) antigen.
[0265] Furthermore, in a third aspect, the present disclosure relates to a pharmaceutical composition comprising the antibody-drug conjugate of the first aspect.
[0266] In certain embodiments, the pharmaceutical composition is used in the form of a systemically administered drug. This includes parenteral agents comprising injectables and infusions. Injectables are formulated in the form of ampoules or so-called ready-to-use injectables, such as in syringes for immediate use or single-use syringes, or are contained in perforable flasks for multiple administrations. Administration of injectables may be performed in the form of subcutaneous (sc), intramuscular (im), intravenous (iv), or intradermal (i.e.) application. In particular, it is possible to prepare injectable formulations suitable for each as colloidal dispersion systems, such as crystalline suspensions, solutions, nanoparticles, or hydrosols.
[0267] Injectable formulations can be prepared in the form of concentrates that can be further dissolved or dispersed with aqueous isotonic diluents. Infusions can also be prepared in the form of isotonic solutions, lipid emulsions, liposomal formulations, and microemulsions. Similar to injectables, infusion formulations can also be prepared in the form of dilution concentrates. Injectable formulations can also be administered as permanent infusions in both inpatient and outpatient care using devices such as mini-pumps.
[0268] Parenteral drug formulations may be supplemented with, for example, albumin, plasma, volume expanders, surfactants, organic diluents, pH-influencing substances, complex-forming substances, or polymeric substances, and these may be supplemented, in particular, as substances that affect the adsorption of the TBDC of the present disclosure to proteins or polymers, or for the purpose of reducing the adsorption of the TBDC of the present disclosure to injection devices or packaging materials such as plastic or glass.
[0269] The adjuvants and carriers added during the production of the pharmaceutical composition of the present disclosure formulated as a parenteral are preferably pH-influencing substances such as sterile water, organic or inorganic acids or bases and salts thereof, buffering substances for pH adjustment, isotonic agents such as sodium chloride, sodium bicarbonate, glucose and fructose, tensides and surfactants, and emulsifiers such as fatty acid moiety esters of polyoxyethylene sorbitan (e.g., polyethylene glycol sorbitan monolaurate, generally referred to as Tween®) or fatty acid esters of polyoxyethylene (e.g., polyoxyethylated castor oil surfactants, generally referred to as Cremophor®), fatty oils such as peanut oil, soybean oil or castor oil, synthetic esters of fatty acids such as ethyl oleate, isopropyl myristate and neutral oils (e.g., mixtures of Miglyol® or medium-chain triglycerides), and polymer adjuvants such as gelatin, dextran, and polyvinylpyrrolidone, propylene glycol, Additives that increase the solubility of organic solvents such as ethanol and N,N-dimethylacetamide, or complex-forming substances such as citric acid and urea, preservatives such as benzoic acid hydroxypropyl ester and methyl ester, antioxidants such as benzyl alcohol and sodium sulfite, and stabilizers such as EDTA.
[0270] When the pharmaceutical composition of the present disclosure is formulated as a suspension, in preferred embodiments, a thickener to prevent precipitation of the TBDC of the present disclosure, or a tenside and polyelectrolyte to ensure resuspension of the precipitate, and / or a complexing agent such as EDTA are added. It is also possible to form a complex of the active ingredient with various polymers. Examples of such polymers include polyethylene glycol, polystyrene, carboxymethyl cellulose, Pluronics®, or polyethylene glycol sorbitol fatty acid esters. The TBDC of the present disclosure may also be included in the liquid formulation in the form of a containing compound such as cyclodextrin. In certain embodiments, a dispersant may be added as an additional aid. For the production of lyophilized products, a scaffolding agent such as mannitol, dextran, saccharose, human albumin, lactose, PVP, or a gelatin type may be used.
[0271] In light of the foregoing, it will be understood that the second and third embodiments also encompass a method for treating cancer, preferably a method for treating gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer, wherein the method comprises administering a therapeutically effective amount of the antibody-drug conjugate of the first embodiment or the pharmaceutical composition of the third embodiment to a patient in need thereof. Similarly, the second embodiment of the present disclosure also encompasses the use of the antibody-drug conjugate of the first embodiment in the manufacture of a drug for the treatment of cancer, preferably gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer.
[0272] Again, in such embodiments, gastrointestinal cancer is generally characterized by the expression of a target sequence or epitope of the guanylate cyclase 2C (GUCY2C) antigen.
[0273] 서열
[0274] 본 개시의 아미노산 서열 서열번호 서열 설명 1 RASQSISSYLN mAb1 CDR L 1 2 AASSLQS mAb1 CDR L 2 3 QQSYSTPWT mAb1 CDR L 3 4 SSAMH mAb1 CDR H 1 5 LINPGNGNTKYSQKFQG mAb1 CDR H 2 6 AYFRGLGFDI mAb1 CDR H 3 7 QQSYSTPLT mAb8 CDR L 3 8 TGTSSDVGSYNLVS mAb41 CDR L 1 9 EGSKRPS mAb41 CDR L 2 10 SYVPRSSLV mAb41 CDR L 3 11 TYTIN mAb41 CDR H 1 12 RIIPVLGIANYAQKFQG mAb41 CDR H 2 13 DTPRLRSSYYMDV mAb41 CDR H 3 14 DIQMTQSPSSLSASAGDRVTITC mAb1 FR L 1 15 WYQQKPGKAPKLLIY mAb1 FR L 2 16 GVPSRFSGSGSGTDFTLAISSLQPEDFATYYC mAb1 FR L 3 17 FGQGTKVDIK mAb1 FR L 4 18 QVQLVQSGAEVKKPGASVKVSCKASGYIFI mAb1 FR H 1 19 WVRQAPGQRLEWMG mAb1 FR H 2 20 RVTITRDTSASTAYMELSSLRSEDTAVYYCAR mAb1 FR H 3 21 WGQGTLVTVSS mAb1 FR H 4 22 DIRMTQSPSSLSASAGDRVTITC mAb8 FR L 1 23 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC mAb8 FR L 3 24 FGGGTKLEIK mAb8 FR L 4 25 QSALTQPASVSGSPGQSITISC mAb41 FR L 1 26 WYQQHPGKAPKLMIY mAb41 FR L 2 27 GVSNRFSASKSGNTASLTISGLQTEDEADYYC mAb41 FR L 3 28 FGGGTKLTVL mAb41 FR L 4 29 QVQLVQSGAEVKKPGSSVKVSCKASGGTFS mAb41 FR H 1 30 WVRQAPGQGLEWMG mAb41 FR H 2 31 RVTITADKSTSTAYMELSSLRSEDTAVYYCAR mAb41 FR H 3 32 DIQMTQSPSSLSASAGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTD FTLAISSLQP EDFATYYCQQ SYSTPWTFGQ GTKVDIK mAb1 V L 33 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSS mAb1 V H 34 DIRMTQSPSSLSASAGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKLEIK mAb8 V L 35 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSS mAb8 V H 36 QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGKAPKLMIYEGSKRPSGVSNRFSASKSGNTASLTISGLQTEDEADYYCSSYVPRSSLVFGGGTKLTVL mAb41 V L 37 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSTYTINWVRQAPGQGLEWMGRIIPVLGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARDTPRLRSSYYMDVWGQGTLVTVSS mAb41 V H 38 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP LL GGPSVFLFPPKPKDTLMISRTPEVTCVVV D VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN H YTQKSLSLSPGK HC (wild type) 39 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mAb1 heavy chain (HC) containing the D265C mutation (according to the EU numbering scheme) 40 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPPAPE LL GGPSVFLFPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mAb8 heavy chain (HC) containing the D265C mutation (according to the EU numbering scheme) 41 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSTYTINWVRQAPGQGLEWMGRIIPVLGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYCARDTPRLRSSYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVPSSSLGTQTYICNVNHKPSNTKVDKKVEKPKSCDKTHTCPPCPAPE LL GGPSVFLFPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mAb41 heavy chain (HC) containing the D265C mutation (according to the EU numbering scheme) 42 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPPAPE AA GGPSVFLFPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mAb1 heavy chain (HC) containing L234A, L235A, and D265C mutations (according to the EU numbering scheme) 43 QVQLVQSGAEVKKPGASVKVSCKASGYIFISSAMHWVRQAPGQRLEWMGLINPGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCARAYFRGLGFDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPPAPE AA GGPSVFLFPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mAb8 heavy chain (HC) containing L234A, L235A, and D265C mutations (according to the EU numbering scheme) 44 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSTYTINWVRQAPGQGLEWMGRIIPVLGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYCARDTPRLRSSYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVPSSSLGTQTYICNVNHKPSNTKVDKKVEKPKSCDKTHTCPPCPAPE AA GGPSVFLFPPKPKDTLMISRTPEVTCVVV C VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKMABLALADC mAb41 heavy chain (HC) containing L234A, L235A, and D265C mutations (according to the EU numbering scheme) 45 QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGKAPKLMIYEGSKRPSGVSNRFSASKSGNTASLTISGLQTEDEADYYCSSYVPRSSLVFGGGTKLT VLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS mAb41 light chain (LC) 46 DIRMTQSPSSLSASAGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKLEIK RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC mAb8 light chain (LC) 47 DIQMTQSPSSLSASAGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLAISSLQPEDFATYYCQQSYSTPWTFGQGTKVDIK RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC mAb1 light chain (LC)
[0275] Examples
[0276] The present invention is further explained by the following non-limiting embodiments.
[0277] General Information
[0278] Although the present invention has been illustrated and described in detail in the drawings and the foregoing description, such illustrations and descriptions should be considered illustrative and not restrictive; the present invention is not limited to the disclosed embodiments.
[0279] All amino acid sequences disclosed in this specification are indicated from the N-terminus to the C-terminus; and all nucleic acid sequences disclosed in this specification are indicated from 5' to 3'.
[0280] Chemicals and solvents were obtained from commercial suppliers such as ABCR, Fisher Scientific, Merck Chemicals, Carl Roth, Sigma-Aldrich, VWR International, Biozol Diagnostika, TCI Deutschland, IRIS Biotech, AnalytiChem, Hycultec, Holzel Diagnostika, Bachem, Thermo Fisher, Activate Scientific, AxisPharm, Biosynth, or BLD Pharmatech and were used without further purification. Water used for reaction, post-treatment, and purification was purified using an ELGA Purelab flex 2 pure water system. TLC was performed on silica gel 60-coated polyester sheets (Macherey-Nagel), and spots were visualized by irradiation (λ = 254 nm) or with ninhydrin, molybdate, or KMnO4 staining solutions.
[0281] General experimental methods
[0282] Analytical HPLC
[0283] Analytical RP-HPLC was performed on a VWR-Hitachi Chromaster system equipped with a diode array detector 5430, an autosampler 5260, a four-way pump 5160, and a column oven 6310, using Luna® C18 (2) 5 μm 100 Å 250 x 4.6 mm, Kinetex® EVO-C18 5 μm 100 Å 250 x 4.6 mm, and ACE C18-PFP 5 μm 100 Å 250 x 4.6 mm columns at 25 °C with linear gradient elution of acetonitrile in water at flow rates between 1 and 1.4 mL / min. Specified parameters are listed below.
[0284] Method A
[0285]
[0286] Method B
[0287]
[0288] Method C
[0289]
[0290] Method D
[0291]
[0292] Method E
[0293]
[0294] Method F
[0295]
[0296] Method G
[0297]
[0298] Method H
[0299]
[0300] Method I
[0301]
[0302] Method J
[0303]
[0304] Method K
[0305]
[0306] Method L
[0307]
[0308] Method M
[0309]
[0310] Method N
[0311]
[0312] Method O
[0313]
[0314] NMR spectroscopy
[0315] 1 H and spectra were recorded at 500 MHz at room temperature and were referenced to trimethylsilane (TMS). Chemical shift (δ) is reported in parts per million (ppm) from low to high magnetic fields. Coupling constants (J) are reported in Hertz (Hz), and abbreviations for multiplicity are used as follows: s for single, d for double, t for triple, dd for double, and m for multiple.
[0316] Mass Spectrometry (MS)
[0317] MS measurements were performed on an Advion expression® CMS. Samples were submitted via direct injection using a syringe. An electron spray ionization source (ESI) or an atmospheric pressure ionization source (APCI) was used for ionization. Analysis was performed in cation mode. For ESI, the capillary temperature was set to 250°C. The source gas temperatures were set to 250°C and 300°C, respectively, and the flow rates were 4 and 5 L / min, respectively. The nebulizing gas flow rate was set to 0.5 L / min. The electron spray voltage was set to 3.5 kV. For APCI, the capillary temperature was set to 250°C and the source gas temperature to 350°C, and an APCI corona discharge of 5 μA was used.
[0318] Preparative RP-HPLC Purification
[0319] Preparative RP-HPLC purification was performed on an Agilent 1260 Infinity II system equipped with a dual pump, multisampler, VWD, fraction collector, and column organizer. As columns, Phenomenex Luna® C18 (2) 10 μm 100 Å 250 x 21.2 mm, Kinetex® EVO-C18 5 μm 100 Å 250 x 21.2 mm, and ACE C18-PFP 5 μm 100 Å 250 x 21.2 mm were used, and linear gradient elution of acetonitrile (+0.05% TFA) in water was performed at a flow rate of 24 to 30 ml / min.
[0320] Flash chromatography
[0321] Purification by flash chromatography on silica was performed using a Teledyne ISCO CombiFlash NextGen 300+ equipped with UV and ELSD detectors and a RediSep® disposable normal silica column with mesh sizes of 230 to 400.
[0322] General Procedure 1 (GP1): CuAAC Click Reaction for Solubility Enhancer Attachment
[0323] To a stirred solution of azide (0.9-1.5 equivalents) and alkyne (1 equivalent) in DMF, a DMF:water (5:1 or 10:1) mixture containing tris[(1-benzyl-1H-1,2,3-triazole-4-yl)methyl]amine (TBTA, 0.125-0.625 equivalents) or tris(3-hydroxypropyltriazolylmethyl)amine (THPTA, 0.125-2 equivalents), copper(II) sulfate pentahydrate (0.1-1 equivalent), and Na-ascorbate (0.25-3.0 equivalents) was added. The resulting reaction mixture was allowed to be stirred at room temperature until completion. After completion, the reaction mixture was purified directly by preparative HPLC without any pretreatment, and the product was obtained by freeze-drying.
[0324] General Procedure 2 (GP2): CuAAC Click Reaction on Polyazide Scaffold
[0325] Water containing tris(3-hydroxypropyltriazolylmethyl)amine (THPTA, 0.63-1.35 equivalents per azide moiety), copper(II) sulfate pentahydrate (0.525-0.65 equivalents per azide moiety), and Na-ascorbate (1-2.15 equivalents per azide moiety) was added to a stirred solution of polyazide (1 equivalent) and alkyne (1.05-1.25 equivalents per azide moiety) in DMF. The resulting DMF / water ratio was 5:1 or 10:1. The resulting reaction mixture was left to be stirred at room temperature until completion. After completion, the reaction mixture was directly purified by preparative HPLC without any pretreatment, and after freeze-drying, a multimeric linker-payload was obtained.
[0326] General Procedure 3 (GP3): Attachment of Intermediate 3.1 or 3.2
[0327] The Fmoc-protected linker-payload was treated with diethylamine (Et2N, 20-24 equivalents) in DMF at room temperature, and the reaction proceeded by RP-HPLC. The solvent was removed under vacuum, and the residue was co-evaporated once with DMF. Subsequently, the residue was dissolved in DMF under argon, and a solution of intermediate 3.1 or 3.2 (1.1-1.5 equivalents) in DMF was added, followed by the addition of N-ethyldiisopropylamine (DIPEA, 1.4-3 equivalents). The solution was stirred at room temperature, and the reaction proceeded by RP-HPLC. After completion, the solvent was evaporated, and the crude product was purified by RP-HPLC.
[0328] General Procedure 4 (GP4): Maleimide Attachment
[0329] Mal-PEG(4)-NHS ester (1-4 equivalents) and DIPEA (1-4 equivalents) were added to a stirred solution of a multimer linker-payload in dry DMF. The reaction mixture was stirred at room temperature for 30 minutes. After completion, the reaction mixture was directly purified by preparative HPLC without any pretreatment, and the final compound was obtained after freeze-drying.
[0330] General Procedure 5 (GP5): Attachment of PEG-azide to mono-6-amino-6-deoxy-cyclodextrin
[0331] Azido-PEG-NHS ester (1 equivalent) was dissolved in water or DMF, and a solution of mono-6-amino-6-deoxy-cyclodextrin (1 equivalent) in water or DMF was added. When DMF was used as the solvent, DIPEA (1.5-2 equivalents) was added if necessary. The resulting reaction mixture was left to be stirred at room temperature until completion and monitored by RP-HPLC. If necessary, mono-6-amino-6-deoxy-cyclodextrin (0.2 equivalents) was additionally added. Upon completion, when water was used as the solvent, the reaction mixture was freeze-dried and used as the crude material without further purification. When DMF was used as the solvent, the product was separated from MTBE by precipitation. When mono-6-amino-6-deoxy-beta-cyclodextrin was used, commercially available mono-6-amino-6-deoxy-beta-cyclodextrin was used. When using mono-6-amino-6-deoxy-gamma-cyclodextrin, the material was synthesized from gamma-cyclodextrin according to Tang, W., Ng, S.-C. Nat. Protoc. 2008, 3, 691-697.
[0332] ADC Generation - Conjugation to the antibody of the linker payload
[0333] Antibodies were conjugated to drug-retaining linker conjugates using the so-called Thiomab technique. As shown in the following reaction scheme, in this approach, conjugation occurs by coupling a terminal thiol-reactive moiety, such as the maleimide residue of the drug-retaining linker, to the free SH group of a genetically engineered cysteine residue in the Fc region of the antibody:
[0334]
[0335] The principle of this bonding method is disclosed in Junutula et al. Nat Biotechnol. 2008 Aug;26(8):925-32, the contents of which are incorporated herein by reference.
[0336] The anti-GUCY2C antibody used in this experiment provides cysteine residues with free SH groups, including D265C substitutions in both Fc domains. Such technology is disclosed in WO2016 / 142049 A1, the contents of which are incorporated herein by reference.
[0337] Example 1 - Synthesis of Modular Linker Compounds
[0338] Example 1.1 - Synthesis of Linker Intermediates
[0339] Step 1: Synthesis of 4-nitro-2-((prop-2-phosphorus-1-yloxy)methyl)benzoic acid
[0340]
[0341] Prop-2-in-ol (2.16 ml, 36.5 mmol, 5 equivalents) and Cs2CO3 (5.96 g, 18.3 mmol, 2.5 equivalents) were added at room temperature to a solution of methyl-2-(bromomethyl)-4-nitrobenzoate (CAS-Nr. 133446-99-8, 2 g, 7.30 mmol, 1 equivalent) dissolved in 10 mL of acetonitrile. The mixture was stirred at 80 °C for 3 hours, and the progress was monitored by RP-HPLC. The reaction mixture was filtered. The filtrate was diluted with ethyl acetate (20 mL), washed with water (10 mL), and extracted with NaHCO3 (2 x 10 mL). For precipitation, the combined aqueous layer was acidified to pH 2 using 2 M HCl (50 mL). After filtration, the obtained solid was taken in 1,4-dioxane and freeze-dried overnight to obtain 4-nitro-2-((prop-2-phosphor-1-yloxy)methyl)benzoic acid as a pale red solid (1.44 g, 83%). 1 H NMR (500 MHz, DMSO) δ 8.36 (d, J = 2.4 Hz, 1H), 8.22 (dd, J = 8.6, 2.5 Hz, 1H), 8.09 (d, J = 8.5 Hz, 1H), 4.94 (s, 2H), 4.36 (d, J = 2.4 Hz, 2H), 3.53 (t,J = 2.4 Hz, 1H). HPLC (Method A): t R = 11.3 minutes.
[0342] Step 2: Synthesis of methyl-4-nitro-2-((prop-2-in-1-yloxy)methyl)benzoate
[0343]
[0344] SOCl2 (3.56 mL, 49 mmol, 8 equivalents) was added at 0°C to a solution of 4-nitro-2-((prop-2-phosphorus-1-yloxy)methyl)benzoic acid (1.44 g, 6.12 mmol, 1 equivalent) dissolved in 30 ml of anhydrous methanol. The mixture was stirred at 70°C for 3.5 hours, and the process was monitored by RP-HPLC. Upon completion, the solvent and volatile substances were removed under reduced pressure. The resulting residue was placed in 1,4-dioxane and freeze-dried overnight to obtain methyl-4-nitro-2-((prop-2-phosphorus-1-yloxy)methyl)benzoate (1.52 g, 99%) as a light brown solid. 1 H NMR (500 MHz, DMSO) δ 8.37 (dd, J = 2.3, 1.1 Hz, 1H), 8.28 - 8.22 (m, 1H), 8.08 (d, J = 8.5 Hz, 1H), 4.92 (d, J = 0.8 Hz, 2H), 4.34 (d, J = 2.4 Hz, 2H), 3.90 (s, 3H), 3.49 (t, J = 2.4 Hz, 1H). HPLC (Method A): t R = 13.1 min.
[0345] Step 3: Synthesis of methyl 4-amino-2-((prop-2-phosphorus-1-yloxy)methyl)benzoate
[0346]
[0347] Iron powder (2.73 g, 48.8 mmol, 8 equivalents) and NH4Cl (2.61 g, 48.8 mmol, 8 equivalents) were added at room temperature to a stirred suspension of methyl-4-nitro-2-((prop-2-phosphor-1-yloxy)methyl)benzoate (1.52 g, 6.1 mmol, 1 equivalent) dissolved in a mixture of EtOH (15 ml) and water (7.5 ml). The resulting mixture was stirred at 80 °C for 4 hours, and the progress was monitored by RP-HPLC. After the starting materials were completely consumed, the reaction mixture was cooled to room temperature, filtered through Celite, and washed with ethyl acetate (15 mL). The filtrate was washed with saturated sodium bicarbonate solution, water, and brine (15 mL each). The aqueous layer was extracted with ethyl acetate (15 mL). The combined organic layer was dried over MgSO4. After filtration, the solvent was removed under reduced pressure, and after vacuum drying, 4-amino-2-((prop-2-in-1-yloxy)methyl)benzoate was obtained as a red solid (1.29 g, 96%). 1 H NMR (500 MHz, CDCl3) δ 7.87 (d, J = 8.5 Hz, 1H), 6.99 (dt, J = 2.2, 1.0 Hz, 1H), 6.59 (dd, J = 8.5, 2.5 Hz, 1H), 5.00 (s, 2H), 4.31 (d, J = 2.4 Hz, 2H), 3.84 (s, 3H), 2.48 (t, J = 2.4 Hz, 1H). HPLC (Method A): t R = 10.5 minutes.
[0348] Step 4: Synthesis of (4-amino-2-((prop-2-phosph-1-yloxy)methyl)phenyl)methanol
[0349]
[0350] LiAlH4 (1 M in THF, 12.01 mmol, 12.01 ml, 2.5 equivalents) was slowly added to a cooled (0°C) anhydrous THF (13 mL) solution. A solution of 4-amino-2-((prop-2-phosph-1-yloxy)methyl)benzoate (1.06 g, 4.8 mmol, 1 equivalent) in anhydrous THF (10 mL) was added dropwise at 0°C. After complete addition, the resulting mixture was left to be stirred overnight at room temperature. The progress of the reaction was monitored by RP-HPLC. The reaction mixture was poured into a vigorously stirred 1 M potassium sodium tartrate solution (120 mL) and stirred for another 30 minutes at room temperature. The reaction mixture was extracted with ethyl acetate (3 x 30 mL). The combined organic layer was washed with water and brine (30 mL each). The organic layer was dried over MgSO4. The solvent was removed under reduced pressure to obtain the crude product. (4-amino-2-((prop-2-phosphorus-1-yloxy)methyl)phenyl)methanol (0.65 g, 71%) was obtained by purification by ISCO SiO2 flash chromatography (0-100% ethyl acetate in hexane). 1 H NMR (500 MHz, DMSO) δ 6.99 (d, J = 8.1 Hz, 1H), 6.58 (d, J = 2.4 Hz, 1H), 6.45 (dd, J = 8.0, 2.4 Hz, 1H), 4.93 (s, 2H), 4.62 - 4.53 (m, 1H), 4.47 (s, 2H), 4.35 (d, J = 5.4 Hz, 2H), 4.15 (d, J = 2.4 Hz, 2H), 3.42 (t, J = 2.4 Hz, 1H). HPLC (Method A): t R = 4.8 min. MS (ESI): found m / z = 174.2 [M-H2O+H] + , calcd. m / z = 174.1
[0351] Step 5: Synthesis of Fmoc-Val-Ala-OH
[0352] The synthesis of Fmoc-Val-Ala-OH was carried out as disclosed in WO 2017 / 149077.
[0353] Example 1.2 - Synthesis of Linker-Payload Intermediate
[0354] Step 6: Synthesis of Intermediate 1.1
[0355]
[0356] N-ethoxycarbonyl-2-ethoxy-1,2-dihydroquinoline (EEDQ, 1.05 g, 4.1 mmol, 1.2 equivalents) was added at room temperature to a stirred solution prepared by dissolving Fmoc-Val-Ala-OH (1.43 g, 3.41 mmol, 1 equivalent) and (4-amino-2-((prop-2-phosph-1-yloxy)methyl)phenyl)methanol (0.65 g, 3.41 mmol, 1 equivalent) in anhydrous THF (20 ml). The resulting mixture was stirred at room temperature for 5 days under light-blocking conditions. The solvent was removed under reduced pressure. The resulting crude intermediate was purified by silica flash chromatography (0-5% MeOH gradient in DCM) to obtain intermediate 1.1 as a colorless solid (1.25 g, 63%). HPLC (Method A): t R = 12.9 min. MS (ESI): found m / z = 601.2 [M+NH4] + , calcd. m / z = 601.3
[0357] Step 7: Synthesis of Intermediate 1.2
[0358]
[0359] Bis-4-nitrophenyl-carbonate (0.75 g, 2.48 mmol, 2 equivalents) and N-ethyldiisopropylamine (DIPEA, 3.1 mmol, 0.53 ml, 2.5 equivalents) were added under an argon atmosphere to a stirred solution in which intermediate 1.1 (0.72 g, 1.24 mmol) was dissolved in anhydrous DMF (15 ml). The reaction mixture was stirred at room temperature for 4 hours. After completion, the solvent was removed under reduced pressure. The crude intermediate was purified by silica flash chromatography (0-100% ethyl acetate gradient in n-hexane) and freeze-dried in 1,4-dioxane:water (4:1) to obtain intermediate 1.2 (0.75 g, 81%) as a pale yellow solid. HPLC (Method C): t R = 13.4 min. MS (ESI): found m / z = 771.2 [M+Na] + , calcd. m / z = 771.3
[0360] Step 8: Synthesis of Intermediate 1.3
[0361]
[0362] A fresh solution of intermediate 1.2 (0.82 g, 1.1 mmol, 1 equivalent) and 1-hydroxybenzotriazole (HOBt, 0.042 g, 0.275 mmol, 0.25 equivalents) dissolved in anhydrous DMF (20 ml) was added to a stirred suspension of exatecan mesylate (0.58 g, 1.1 mmol, 1 equivalent) dissolved in anhydrous DMF (20 ml). DIPEA (0.28 g, 2.16 mmol, 0.37 ml, 2 equivalents) and 2,6-rutidine (141 mmol, 16.3 ml, 129 equivalents) were added to the resulting mixture. The reaction mixture was stirred overnight at room temperature, and the progress was monitored by RP-HPLC. The reaction mixture was concentrated under reduced pressure. Purified by silica flash chromatography (0–5% MeOH gradient in DCM) and freeze-dried in 1,4-dioxane:water (4:1) to obtain 1.3 g (1.08 g, 95%) of intermediate as a gray solid. HPLC (Method D): t R = 13.0 min. MS (ESI): found m / z = 1045.3 [M+H] + , calcd. m / z = 1045.4
[0363] Example 1.3 - Synthesis of Intermediate 2.1
[0364]
[0365] 2-chlorotrityl resin (4 g) was swollen in anhydrous DCM (20 mL) for 10 minutes. The suspension was filtered, and a solution of Fmoc-Lys(N3)-OH (1.578 g, 4 mmol, 1 equivalent) and DIPEA (3.48 mL, 20 mmol, 5 equivalents) dissolved in anhydrous DCM (20 mL) was added, followed by shaking at room temperature for 2 hours. The suspension was filtered, the resin was washed with DMF (3 x 1 min), a capping solution (20 mL, MeOH / DIPEA / DCM 1 / 1 / 8) was added, and the mixture was shaken at room temperature for 10 minutes. The suspension was filtered, and the capping procedure was repeated once. The resin was washed with DMF (3 x 1 min) and DCM (3 x 1 min) and dried under vacuum. The loading of the resin was J. Pept. Sci. It was determined as described in 2017, 23, 757-762.
[0366] For the next step, the resin was swollen in DMF for 10 minutes. The suspension was filtered, and a Fmoc-deprotected solution of 20% piperidine in DMF was added to the resin. The suspension was incubated for 20 minutes, filtered, and the deprotection procedure was repeated once. Then, the resin was washed with DMF (3 x 1 min) and DCM (3 x 1 min). The resin was swollen in DMF for 10 minutes, filtered, and a solution of Fmoc-Lys(N3)-OH (3 equivalents), TBTU (3 equivalents), and DIPEA (6 equivalents) dissolved in anhydrous DMF was added. The suspension was shaken at room temperature for 2 hours. The resin was washed with DMF (3 x 1 min) and DCM (3 x 1 min), and the Fmoc- groups were removed with 20% piperidine as described above. For acetylation, the resin was swollen in DMF for 10 minutes, the suspension was filtered, and a solution of acetic anhydride (3 equivalents) and pyridine (3 equivalents) dissolved in DMF was added. The suspension was incubated at room temperature for 2 hours, filtered, the resin was washed with DMF (3 x 1 min) and DCM (3 x 1 min), and dried under vacuum.
[0367] For cleavage, the resin was treated with a solution of hexafluoroisopropanol (1:4, 20 mL) in DCM for 15 minutes. The solution was collected, and the resin was treated again with hexafluoroisopropanol (1:4, 20 mL) in DCM. The resin was washed with hexafluoroisopropanol (1:4) in DCM, and the combined filtrate was concentrated under vacuum. The resulting crude peptide was purified by RP-HPLC to obtain Ac-Lys(N3) - Lys(N3)-OH (731 mg, 50%) was obtained as a colorless freeze-dried product.
[0368]
[0369] Ac-Lys(N3)-Lys(N3)-OH (731 mg, 1.98 mmol, 1 equivalent) and HOBt (910 mg, 5.94 mmol, 3 equivalents) were dissolved in DMF (8 mL). DIC (920 μL, 5.9 mmol, 3 equivalents) was added, and the solution was stirred at room temperature for 5 minutes. Then, a solution of Boc-amino-PEG(3)-amine (CAS-Nr. 101187-40-0, 868 mg, 2.97 mmol, 1.5 equivalents) dissolved in DMF (4 mL) was added, followed by the addition of DIPEA (1.04 mL, 5.98 mmol, 3 equivalents). The reaction mixture was stirred at room temperature and tracked by RP-HPLC. After 20 hours, the solution was concentrated, and the residue was dissolved in ethyl acetate. The organic layer was washed with 0.2 M citric acid (1 x 50 mL), sodium bicarbonate solution (3 x 50 mL), and brine. The organic layer was dried over magnesium sulfate and concentrated under vacuum to obtain 1.428 g of crude product. After purification by RP-HPLC, the product was freeze-dried twice in the presence of HCl (1 equivalent) to obtain intermediate 2.1 (705 mg, 66%) as an HCl salt. HPLC (Method H): t R = 11.2 min. MS (ESI): found m / z = 543.3 [M+H] + , calcd. m / z = 543.3 [M+H] + .
[0370] Example 1.4 - Synthesis of Intermediate 3.1
[0371]
[0372] EDC x HCl (485.8 mg, 2.53 mmol, 1.3 equivalents) and DIPEA (1.09 mL, 6.24 mmol, 3.2 equivalents) were added to a solution of Propargyl-PEG(5)-acid (CAS-Nr. 1245823-51-1, 593.1 mg, 1.94 mmol, 1 equivalent) in anhydrous THF (8.9 mL). A solution of N-hydroxyphthalimide (413.4 mg, 2.53 mmol, 1.3 equivalents) dissolved in anhydrous THF (8.9 mL) was added dropwise over 10 minutes. The reaction mixture was stirred at room temperature and monitored by TLC and RP-HPLC. After 21 hours, the solution was diluted with ethyl acetate (60 mL), and the organic layer was washed with 1N HCl (30 mL), sodium bicarbonate solution (30 mL), and brine (30 mL). The organic layer was dried over magnesium sulfate and concentrated under vacuum. The resulting crude product (724.7 mg) was purified by silica-phase flash chromatography using a gradient from n-hexane to ethyl acetate. Intermediate 3.1 (457.3 mg, 52%) was obtained as a yellow oil. C 22 H 27 NO9. 1 H NMR (500 MHz, CDCl3): δ (ppm) = 7.89 (dd, J = 5.5, 3.1 Hz, 2H), 7.80 (dd, J = 5.5, 3.1 Hz, 2H), 4.21 (d, J = 2.3 Hz, 2H), 3.89 (t, J = 6.4 Hz, 2H), 3.73 - 3.63 (m, 17H), 2.97 (t, J = 6.4 Hz, 2H), 2.44 (t, J = 2.4 Hz, 1H).13 C NMR (126 MHz, CDCl3): δ (ppm) = 167.65, 161.73, 134.73, 128.82, 123.92, 79.61, 74.48, 70.69, 70.58, 70.54, 70.53, 70.49, 70.46, 70.33, 69.04, 65.76, 58.33, 32.14. HPLC (Method I): t R = 11.7 min. MS (ESI): found m / z = 472.2 [M+Na] + , calcd. m / z = 472.2 [M+Na] + .
[0373] Example 1.5 - Synthesis of Intermediate 3.2
[0374]
[0375] HATU (11.64 g, 30.6 mmol, 1.6 equivalents) and DIPEA (10.7 mL, 61.2 mmol) were added to a solution of pent-4-inosane (2 g, 20.4 mmol, 1.05 equivalents) dissolved in DMF (40 mL) at 5 °C, and the resulting solution was stirred at 5 °C for 10 minutes. Then, tert A solution of β-butyl 1-amino-3,6,9,12-tetraoxapentadecane-15-oate (6.24 g, 19.4 mmol, 1 equivalent) dissolved in DMF (10 mL) was added dropwise, and the resulting solution was heated to room temperature. After 2 hours, the solution was vacuum concentrated, and the residue was dissolved in ethyl acetate (300 mL). The organic layer was washed with 0.2 M citric acid (150 mL), saturated sodium bicarbonate solution (150 mL), and brine (150 mL). The organic layer was dried over magnesium sulfate and concentrated under vacuum. Purified by silica-phase flash chromatography using a gradient from hexane to acetone tert -Butyl 1-(pent-4-inamido)-3,6,9,12-tetraoxapentadecane-15-oate (8.20 g, quantitative) was obtained. C 20 H35 NO7. HPLC (Method A): t R = 10.6 min. MS (ESI): found m / z = 424.4 [M+Na] + , calcd. m / z = 424.2 [M+Na] + .
[0376]
[0377] tert -Butyl 1-(pent-4-inamido)-3,6,9,12-tetraoxapentadecane-15-oate (8.20 g, max. 19.4 mmol, 1 equivalent) was dissolved in TFA (15.6 mL) and stirred at 300 mbar for 1 hour. The TFA was removed under vacuum, and the residue was co-evaporated twice with toluene. The obtained residue was dissolved in THF (anhydrous, 50 mL), and N-ethyl-N′-carbodiimide hydrochloride (4.66 g, 24.3 mmol, 1.25 equivalents) as well as DIPEA (11 mL, 63 mmol, 3.25 mmol) were added. Then, N A solution of hydroxyphthalimide (3.96 g, 24.3 mmol, 1.25 equivalents) dissolved in anhydrous THF (50 mL) was added dropwise, and the resulting red solution was stirred overnight at room temperature. Ethyl acetate (400 mL) was added, and the organic layer was washed with 2N HCl (100 mL), saturated sodium bicarbonate solution (100 mL), and brine (100 mL). The organic layer was dried over magnesium sulfate and concentrated under vacuum. Purification was performed by silica-phase flash chromatography using a dichloromethane to acetone gradient to obtain intermediate 3.2 (4.96 g, 52%) as a yellow oil. C 24 H 30 N2O9. 1 H NMR (500 MHz, DMSO-d6): δ (ppm) = 8.01 - 7.89 (m, 4H), 7.87 (s, 1H), 3.77 (t, J= 6.0 Hz, 2H), 3.63 - 3.46 (m, 12H), 3.40 (t, J = 5.9 Hz, 2H), 3.20 (q, J = 5.8 Hz, 2H), 3.01 (t, J = 6.0 Hz, 2H), 2.70 (t, J = 2.6 Hz, 1H), 2.39 - 2.31 (m, 2H), 2.31 - 2.23 (m, 2H). 13 C NMR (126 MHz, DMSO-d6): δ (ppm) = 170.18, 168.21, 161.61, 135.39, 128.10, 123.85, 83.65, 71.00, 69.73, 69.68, 69.62, 69.60, 69.50, 69.01, 65.18, 38.50, 34.02, 31.55, 14.09. HPLC (Method A): t R = 10.5 min. MS (ESI): found m / z = 491.4 [M+H] + , calcd. m / z = 491.2 [M+H] + .
[0378] Example 1.6 - Intermediate 4.x (N 3 -PEG n Synthesis of -Beta / Gamma-CD)
[0379]
[0380] Intermediate 4.1 was synthesized according to GP5 using azido-PEG(2)-NHS ester and 6-amino-6-deoxy-beta-cyclodextrin. The resulting crude product was used without further purification.
[0381]
[0382] Intermediate 4.2 was synthesized according to GP5 using azido-PEG(4)-NHS ester and 6-amino-6-deoxy-beta-cyclodextrin. The resulting crude product was used without further purification.
[0383]
[0384] Intermediate 4.3 was synthesized according to GP5 using azido-PEG(8)-NHS ester and 6-amino-6-deoxy-beta-cyclodextrin. The resulting crude product was used without further purification.
[0385]
[0386] Intermediate 4.4 was synthesized according to GP5 using azido-PEG(24)-NHS ester and 6-amino-6-deoxy-beta-cyclodextrin. The resulting crude product was used without further purification.
[0387]
[0388] Intermediate 4.5 was synthesized according to GP5 using azido-PEG(2)-NHS ester and 6-amino-6-deoxy-gamma-cyclodextrin. The resulting crude product was used without further purification.
[0389]
[0390] Intermediate 4.6 was synthesized according to GP5 using azido-PEG(4)-NHS ester and 6-amino-6-deoxy-gamma-cyclodextrin. The resulting crude product was used without further purification.
[0391]
[0392] Intermediate 4.7 was synthesized according to GP5 using azido-PEG(8)-NHS ester and 6-amino-6-deoxy-gamma-cyclodextrin. The resulting crude product was used without further purification.
[0393]
[0394] Beta-cyclodextrin (2.000 g, 1.762 mmol) was co-evaporated twice with 30 mL of anhydrous DMSO and redissolved in 30 mL of DMSO. Lithium hydride (21 mg, 2.643 mmol, 1.5 equivalents) was added, and the suspension was stirred for 15 hours under an argon atmosphere. Subsequently, 1-azido-2-{2-[2-(2-bromoethoxy)ethoxy]ethoxy}ethane (497 mg, 1.762 mmol, 1.0 equivalent) dissolved in 2 mL of anhydrous DMSO was added, followed by the addition of lithium iodide (24 mg, 176 μmol, 0.1 equivalents), and the mixture was stirred at 55 °C for 7.5 hours, followed by stirring at room temperature. After TLC (acetonitrile / water / concentrated ammonia 6:3:1) indicated no further conversion, the mixture was concentrated to approximately 6 mL under vacuum, and the remainder was added dropwise to 160 mL of ice-cold acetone. The resulting precipitate was separated by centrifugation, resuspended in 120 mL of cold acetone by sonication, and centrifuged again. After drying under vacuum, the solid was taken in 5 mL of water, insoluble beta-cyclodextrin was removed by filtration, and the filtrate was freeze-dried. The crude product (2.263 g) was acidified to pH 2 with trifluoroacetic acid and purified by preparative RP-HPLC to obtain 532 mg (23%) of pure intermediate 4.8 as a colorless freeze-dried product. MS (ESI): found m / z = 1336.8 [M+H] + , calcd. m / z = : 1336.5 [M+H] + .
[0395]
[0396] Intermediate 4.9 was synthesized using gamma-cyclodextrin according to the same method as intermediate 4.8. The target product was obtained as a colorless lyophilized product in 22% yield. MS (ESI): found m / z = 1498.9 [M+H] + , calcd. m / z= 1498.5 [M+H] + .
[0397] Example 1.7 - Synthesis of Intermediate 5.x
[0398]
[0399] Intermediate 5.1 was synthesized according to WO2019081455 and WO2022207699 using Wang resin loaded with Fmoc-Sar, Fmoc-Sar-Sar-OH, and Fmoc-Sar-OH, and azidoacetic acid for N-terminal capping. Fmoc-deprotection was performed twice for 15 minutes in 20% piperidine in DMF. Amino acid coupling was performed using amino acids (3 equivalents), HATU (2.9 equivalents), and DIPEA (6 equivalents) in DMF. Cleavage from the resin was performed using pure TFA (10 mL per 1 g of resin), followed by ice-cold methyl tert Precipitation from butyl ether and purification by RP-HPLC were performed. Intermediate 5.1 (166.7 mg, 41%) was obtained as a colorless solid. C 32 H 53 N 13 O 12 . HPLC (Method H): t R = 7.4 min. MS (ESI): found m / z = 834.2 [M+Na] + , calcd. m / z = 834.4 [M+Na] + .
[0400]
[0401] Intermediate 5.2 was synthesized according to WO2019081455 and WO2022207699 using NovaGel Rink-Amide resins loaded with Fmoc-Sar, Fmoc-Sar-Sar-OH, and Fmoc-Sar-OH, and azidoacetic acid for N-terminal capping. Fmoc deprotection was performed twice for 15 minutes in 20% piperidine in DMF. Amino acid coupling was performed using amino acids (3 equivalents), HATU (2.9 equivalents), and DIPEA (6 equivalents) in DMF. Cleavage from the resin was performed using TFA / TIS 95 / 5 (10 mL per 1 g of resin), followed by ice-cold methyl tert Precipitation from butyl ether and purification by RP-HPLC were performed. 5.2% (83.6 mg, 54%) of the intermediate was obtained as a colorless solid. C 32 H 54 N 14 O 11 . HPLC (Method K): t R = 7.1 min. MS (ESI): found m / z = 811.5 [M+H] + , calcd. m / z = 811.4 [M+H] + .
[0402] Example 1.8 - Synthesis of Intermediate 6.x
[0403] Synthesis of Intermediate 6.1
[0404]
[0405] TBTU (2.467 g, 7.8 mmol, 1.2 equivalents) and DIPEA (1.33 mL, 7.8 mmol, 1.2 equivalents) were added to a solution of Fmoc-Lys(Boc)-OH (3.056 g, 6.5 mmol, 1 equivalent) in DMF (30 mL), and the resulting solution was mixed for 1 minute. Then, the pre-activated amino acid solution was added to a solution of 14-azido-3,6,9,12-tetraoxatetradecane-1-amine (1.680 g, 6.5 mmol, 1 equivalent) in DMF (10 mL), and the resulting solution was stirred at room temperature for 2 hours. Water (5 mL) was added, and the solution was evaporated under vacuum. The residue was dissolved in ethyl acetate (100 mL), and the organic layer was washed with an aqueous 0.2 M citric acid solution (50 mL), an aqueous saturated sodium bicarbonate solution (50 mL), and brine (50 mL). The organic layer was dried over magnesium sulfate and evaporated under vacuum. Purification was performed by silica-phase flash chromatography using a gradient from MTBE to acetone to obtain Fmoc-Lys(Boc)-NH-PEG4-N3 (3.545 g, 76%) as a colorless viscous solid. C 36 H 52 N6O9. 1 H NMR (500 MHz, DMSO-d6): δ (ppm) = 7.88 (dt, J = 7.7, 0.9 Hz, 2H), 7.82 (t, J = 5.7 Hz, 1H), 7.76 - 7.68 (m, 2H), 7.42 (td, J = 7.5, 1.0 Hz, 2H), 7.33 (tt, J = 7.4, 1.2 Hz, 3H), 6.68 (s, 1H), 4.30 - 4.18 (m, 3H), 3.93 (td, J = 8.6, 5.2 Hz, 1H), 3.62 - 3.56 (m, 2H), 3.55 - 3.48 (m, 12H), 3.41 (t, J = 6.0 Hz, 2H), 3.37 (dd, J= 5.6, 4.4 Hz, 2H), 3.21 (ddt, J = 19.6, 13.6, 7.6 Hz, 2H), 2.89 (q, J = 10.3, 8.3 Hz, 2H), 1.69 - 1.43(m,2H), 1.37(s,9H), 1.24(s,4H). 13 C NMR (126 MHz, DMSO-d6): δ(ppm) = 171.86, 155.78, 155.45, 143.79, 143.70, 140.60, 127.49, 126.92, 125.17, 119.95, 77.21. 69.71, 69.69, 69.67, 69.63; 22.69. HPLC (Figure A): t R = 14.3 degrees. MS (ESI): found m / z = 735.4 [M+Na] + , calcd. m / z = 735.4 [M+Na] + . . . .
[0406]
[0407] Diethylamine (5.00 mL, 56.1 mmol, 17 equivalents) was added to a solution of Fmoc-Lys(Boc)-NH-PEG4-N3 (2.00 g, 2.8 mmol, 1 equivalent) in DMF (20 mL), and the resulting solution was stirred at 600 mbar for 30 minutes at room temperature. The solvent was removed under vacuum, and the solution was purified by silica-phase flash chromatography using a gradient from dichloromethane to dichloromethane / MeOH / concentrated ammonia (9:1:0.1) to obtain Fmoc-deprotected intermediate H-Lys(Boc)-NH-PEG4-N3 (1.182 g, 86%) as a colorless oil. As the next step, 1M HCl (11.85 mL, 11.8 mmol, 5 equivalents) was added to a solution of H-Lys(Boc)-NH-PEG4-N3 (1.163 g, 2.4 mmol, 1 equivalent) in 1,4-dioxane (20 mL), and the mixture was stirred at 600 mbar for 10 minutes at room temperature. The solvent was removed under vacuum, the residue was dissolved in 1M HCl (11.85 mL, 11.8 mmol, 5 equivalents), and the mixture was stirred at 600 mbar for 10 minutes at room temperature. The solvent was removed under vacuum, and additionally, 1,4-dioxanes-NH-PEG4-N3 (1.119 g, quantitative) was obtained as a highly viscous, colorless oil. C 16 H 34 N6O5. 1 H NMR (500 MHz, DMSO-d6): δ (ppm) = 8.67 (t, J = 5.6 Hz, 1H), 8.32 (s, 3H), 8.11 (s, 3H), 3.78 - 3.72 (m, 1H), 3.61 - 3.58 (m, 2H), 3.59 - 3.47 (m, 12H), 3.45 (t, J = 5.9 Hz, 2H), 3.38 (dd, J = 5.5, 4.4 Hz, 2H), 3.28 (d, J = 5.9 Hz, 1H), 3.23 (dq, J = 13.7, 5.8 Hz, 1H), 2.73 (d, J= 8.7 Hz, 2H), 1.73 (q, J = 7.3 Hz, 2H), 1.59 (qd, J = 8.5, 7.8, 6.0 Hz, 2H), 1.42 - 1.33 (m, 2H). 13 13C NMR (126 MHz, DMSO-d6): δ (ppm) = 168.43, 69.74, 69.70, 69.66, 69.62, 69.49, 69.13, 68.63, 51.78, 49.97, 38.66, 38.11, 30.18, 26.08, 20.97. HPLC (Method H): t R = 6.9 min. MS (ESI): found m / z = 391.3 [M+H] + , calcd. m / z = 391.3 [M+H] + .
[0408]
[0409] d-glucono-1,5-lactone (481 mg, 2.7 mmol, 2.5 equivalents) and DIPEA (917 μL, 5.4 mmol, 5.0 equivalents) were added to a solution of Lys-NH-PEG4-N3 (500 mg, 1.1 mmol, 1 equivalent) in DMF (10 mL), and the resulting solution was stirred at room temperature for 15 hours, followed by stirring at 80 °C for 1 hour. After a total reaction time of 16.5 hours, d-glucono-1,5-lactone (481 mg, 2.7 mmol, 2.5 equivalents) and DIPEA (917 μL, 5.4 mmol, 5.0 equivalents). After a total reaction time of 21 hours, the solvent was removed under vacuum, and the residue was co-evaporated with a mixture of methanol (10 mL) and DIPEA (917 μL), followed by co-evaporation with methanol (10 mL). The crude product was precipitated from ice-cold MTBE. Intermediate 6.1 (294 mg, 36%) was obtained as a colorless, glassy solid by purification by preparative HPLC. C 28 H 54 N6O 17 .1 H NMR (500 MHz, DMSO-d6): δ (ppm) = 7.90 (t, J = 5.7 Hz, 1H), 7.61 (d, J = 8.4 Hz, 1H), 7.53 (t, J = 5.9 Hz, 1H), 4.41 (s, 10H), 4.22 (td, J = 8.4, 5.0 Hz, 2H), 4.06 (d, J = 3.5 Hz, 1H), 3.97 (d, J = 3.7 Hz, 1H), 3.93 - 3.86 (m, 3H), 3.62 - 3.56 (m, 4H), 3.56 - 3.43 (m, 14H), 3.43 - 3.35 (m, 4H), 3.20 (qd, J = 6.0, 3.5 Hz, 4H), 3.05 (dp, J = 13.9, 6.9 Hz, 2H), 1.73 - 1.64 (m, 1H), 1.56 (tdd, J = 13.5, 9.4, 5.3 Hz, 1H), 1.45 - 1.33 (m, 2H), 1.23 (s, 2H). 13 C NMR (126 MHz, DMSO-d6): δ (ppm) = 172.28, 172.17, 171.28, 73.50, 73.32, 72.36, 72.16, 71.46, 70.42, 70.10, 69.72, 69.64, 69.50, 69.14, 68.75, 63.29, 63.24, 51.99, 49.97, 38.52, 38.08, 31.75, 28.77, 22.46. HPLC (방법 M): t R = 13.5 분. MS (ESI): found m / z = 747.4 [M+H] + , calcd. m / z = 747.4 [M+H] + .
[0410] Synthesis of Intermediate 6.2
[0411]
[0412] 14-azido-3,6,9,12-tetraoxatetradecane-1-amine (262 mg, 1.0 mmol, 1 equivalent) was dissolved in DMF (2 mL). d-glucono-1,5-lactone (214 mg, 1.2 mmol, 1.2 equivalents) was added as a solid, followed by the addition of DIPEA (348 μL, 2.0 mmol, 2 equivalents), and the resulting solution was stirred at 110 °C for 2 hours. After cooling to room temperature, the solvent was evaporated under vacuum. The solution was purified by silica-phase flash chromatography using a gradient from dichloromethane to dichloromethane / methanol / water (5:1:0.1) to obtain intermediate 6.1 (318 mg, 72%). C 16 H 32 N4O 10 . HPLC (Method M): t R = 13.7 min. MS (ESI): found m / z = 441.3 [M+H] + , calcd. m / z = 441.2 [M+H] + .
[0413] Synthesis of Intermediate 6.3
[0414]
[0415] N-hydroxy-succinimide (2.32 g, 20.2 mmol, 2.3 equivalents) was added to a solution of ZL-Glu-OH (2.50 g, 8.9 mmol, 1 equivalent) in THF (anhydrous, 50 mL), and the solution was cooled to 0 °C. Then, N,N'-dicyclohexylcarbodiimide (3.85 g, 18.7 mmol, 2.1 equivalents) was added, and the resulting suspension was stirred at 0 °C for 2 hours, followed by stirring overnight at room temperature. For post-treatment, the formed urea was removed by filtration, and the oily residue was dissolved in ethyl acetate (75 mL). The organic layer was washed with a saturated aqueous sodium bicarbonate solution, brine, and water, dried over magnesium sulfate, and the solvent was removed under vacuum. After treatment with diethyl ether, Zl-Glu(OSu)-OSu (3.68 g, 87%) was obtained as an intermediate and used without further purification.
[0416] Next, d-glucarmine (762.23 mg, 4.2 mmol, 2 equivalents) was added to a solution of Zl-Glu(OSu)-OSu (1.00 g, 2.1 mmol, 1 equivalent) in DMF (anhydrous, 40 mL), and the resulting suspension was stirred at 65 °C for 3 hours. As the reaction proceeded, the initial suspension became a solution. The solution was removed under vacuum, and Zl-Glu(NHDG)-NHDG (933.9 mg, 73%) was obtained by purification via RP-HPLC. C 25 H 41 N3O 14 . HPLC (Method H): t R = 8.0 min. MS (ESI): found m / z = 630.3 [M+Na] + , calcd. m / z = 630.2 [M+Na] + .
[0417]
[0418] Pd / C (10%, 161 mg) was added to a solution of ZL-Glu(NHDG)-NHDG (924.9 mg, 1.5 mmol) in methanol (180 mL) under argon. The atmosphere was changed from argon to hydrogen, and the resulting suspension was stirred at room temperature for 3.5 hours. The catalyst was removed by filtration through Celite, and the solvent of the resulting filtrate was removed under vacuum to obtain HL-Glu(NHDG)-NHDG (728.7 mg, 1.5 mmol, quantitative). Next, HL-Glu(NHDG)-NHDG (100.0 mg, 211.2 μmol, 1.5 equivalents) was dissolved in DMF (anhydrous, 2 mL) and added to a solution of azido-PEG4-NHS ester (CAS-Nr. 944251-24-5, 54.68 mg, 140.8 μmol, 1 equivalent) under an argon atmosphere. DIPEA (73.57 μL, 422.4 μmol, 3 equivalents) was added, and the resulting solution was stirred at room temperature for 1.5 hours. The solvent was removed under vacuum, and intermediate 6.3 (82.74 mg, 79%) was obtained by purification via RP-HPLC. C 28 H 54 N6O 17 . HPLC (Method A): t R = 5.9 min. MS (ESI): found m / z = 747.2 [M+H] + , calcd. m / z = 747.4 [M+H] + .
[0419] Synthesis of Intermediate 6.4
[0420]
[0421] Intermediate 6.4 (91.9 mg, 71%) was synthesized as described for intermediate 6.3, except that azido-PEG8-NHS ester (CAS-Nr. 1204834-00-3) was used instead of azido-PEG4-NHS ester. C 36 H 70 N6O 21. HPLC (Method A): t R = 6.7 min. MS (ESI): found m / z = 923.6 [M+H] + , calcd. m / z = 923.5 [M+H] + .
[0422] Example 2 - Synthesis of Polymeric Linker Exatecan
[0423]
[0424]
[0425]
[0426] Example 3 - Synthesis of Compound IV.1
[0427] I.1 Synthesis
[0428]
[0429] Intermediate I.1 was synthesized according to GP1 using m-PEG(4)-azide (40.4 mg, 173 μmol, 1.2 equivalents), intermediate 1.3 (150 mg, 144 μmol, 1.0 equivalents), copper(II) sulfate pentahydrate (3.6 mg, 14.4 μmol, 0.1 equivalents), tris(benzyltriazolylmethyl)amine (9.6 mg, 18 μmol, 0.125 equivalents), and sodium ascorbate (7.1 mg, 36 μmol, 0.25 equivalents) in DMF / water (1.65 mL, 10:1). Intermediate I.1 (137 mg, 74%) was obtained as a yellow solid by purification by RP-HPLC. HPLC (Method D): t R = 11.8 min. MS (ESI): found m / z = 1278.5 [M+H] + , calcd. m / z = 1278.5 [M+H] + .
[0430] II.1 Synthesis
[0431]
[0432] Intermediate II.1 was synthesized according to GP3 using 222 μL of diethylamine (2.14 mmol, 20 equivalents) in 1.37 mL of DMF for Fmoc-deprotection, and for the coupling reaction using Intermediate I.1 (137 mg, 107 μmol, 1 equivalent), Intermediate 3.1 (53.0 mg, 118 μmol, 1.1 equivalents), and diisopropylethylamine (56 μL, 321 μmol, 3 equivalents) in 1 mL of DMF. Intermediate II.1 (101 mg, 70%) was obtained as a yellow solid by purification by RP-HPLC. HPLC (Method A): t R = 11.1 min. MS (ESI): found m / z = 1342.5 [M+H] + , calcd. m / z = 1342.6 [M+H] + .
[0433] III.1 Synthesis
[0434]
[0435] Intermediate III.1 was synthesized according to GP2 using Intermediate 2.1 (3.3 mg, 5.0 μmol, 1 equivalent), Intermediate II.1 (17.3 mg, 12.9 μmol, 2.5 equivalents), copper(II) sulfate pentahydrate (1.6 mg, 6.5 μmol, 1.25 equivalents), tris(3-hydroxypropyltriazolylmethyl)amine (5.6 mg, 12.9 μmol, 2.5 equivalents), and sodium ascorbate (4.2 mg, 21.4 μmol, 4.3 equivalents) in DMF / water (0.55 mL, 10:1). Intermediate III.1 (22.4 mg, quantitative) was obtained as a yellow solid by purification by RP-HPLC. HPLC (Method J): t R = 15.0 min. MS (ESI): found m / z = 1614.17 [M+2H] 2+ , calcd. m / z = 1613.8 [M+2H]2+ .
[0436] IV.1 Synthesis
[0437]
[0438] Compound IV.1 was synthesized according to GP4 using the TFA salt of intermediate III.1 (16.3 mg, 4.9 μmol, 1 equivalent), N-[15-[(2,5-dioxo-1-pyrrolidinyl)oxy]-15-oxo-3,6,9,12-tetraoxapentadec-1-yl]-2,5-dihydro-2,5-dioxo-1H-pyrrole-1-propanamide = Mal-PEG4-NHS-ester (10.8 mg, 21.0 μmol, 4.3 equivalents), and DIPEA (3.3 μL, 19.0 μmol, 3.9 equivalents) in DMF (652 μL). Compound IV.1 (7.4 mg, 42%) was obtained as a yellow solid by purification by RP-HPLC. C 174 H 244 F2N 30 O 52 . HPLC (Method J): t R = 16.7 min. MS (ESI): found m / z = 1209.6 [M+3H] 3+ , calcd. m / z = 1208.9 [M+3H] 3+ .
[0439] Example 4 - Synthesis of Compound IV.2
[0440]
[0441] Compound IV.2 was synthesized as described for Compound IV.1, but using intermediate 3.2. Compound IV.2 (30.76 mg) was obtained as a yellow solid. C 178 H 250 F2N 32 O 52 . HPLC (Method J): t R = 16.4 min. MS (ESI): found m / z = 1236.8 [M+3H] 3+, calcd. m / z = 1236.3 [M+3H] 3+ .
[0442] Example 5 - Synthesis of Compound IV.3
[0443]
[0444] Compound IV.3 was synthesized as described for Compound IV.1, except that m-PEG(12)-azide was used instead of m-PEG(4)-azide and intermediate 3.2 was used instead of intermediate 3.1. Compound IV.3 (5.07 mg) was obtained as a yellow solid. C 210 H 314 F2N 32 O 68 . HPLC (Method J): t R = 16.4 min. MS (ESI): found m / z = 1471.7 [M+3H] 3+ , calcd. m / z = 1471.1 [M+3H] 3+ .
[0445] Example 6 - Synthesis of Compound IV.4
[0446] Synthesis of I.4
[0447]
[0448] Intermediate I.4 was synthesized according to GP1 using intermediate 4.1 (22.4 μmol, 1 equivalent), intermediate 1.3 (26.16 mg, 25.0 μmol, 1.1 equivalents), copper(II) sulfate pentahydrate (1.23 mg, 4.9 μmol, 0.2 equivalents), tris(benzyltriazolylmethyl)amine (3.17 mg, 6.0 μmol, 0.26 equivalents), and sodium ascorbate (4.33 mg, 11.9 μmol, 0.5 equivalents) in DMF / water (0.28 mL, 10:1). Intermediate I.4 (31.51 mg, 60%) was obtained as a yellow solid by purification by RP-HPLC. C 108 H 139 FN 10 O 48. HPLC (Method D): t R = 10.7 min. MS (ESI): found m / z = 1182.5 [M+2H] 2+ , calcd. m / z = 1182.4 [M+2H] 2+ .
[0449] II.4 Synthesis
[0450]
[0451] Intermediate II.4 was synthesized according to GP3 using Intermediate I.4 (31.51 mg, 13.3 μmol, 1 equivalent) and 33 μL diethylamine (319.9 μmol, 24 equivalents) in 1.6 mL DMF for Fmoc-deprotection, and Intermediate 3.1 (8.98 mg, 20.0 μmol, 1.5 equivalents) and diisopropylethylamine (6.8 μL, 40.0 μmol, 3 equivalents) in 2.1 mL DMF for the coupling reaction. Intermediate II.4 (15.51 mg, 50%) was obtained as a yellow solid by purification by RP-HPLC. C 107 H 151 FN 10 O 52 . HPLC (Method D): t R = 9.1 min. MS (ESI): found m / z = 1214.5 [M+2H] 2+ , calcd. m / z = 1214.5 [M+2H] 2+ .
[0452] III.4 Synthesis
[0453]
[0454] Intermediate III.4 was synthesized according to GP2 using intermediate 2.1 (1.54 mg, 2.6 μmol, 1 equivalent), intermediate II.4 (15.51 mg, 6.4 μmol, 2.5 equivalents), copper(II) sulfate pentahydrate (0.87 mg, 3.5 μmol, 1.3 equivalents), tris(3-hydroxypropyltriazolylmethyl)amine (2.83 mg, 6.5 μmol, 2.5 equivalents), and sodium ascorbate (1.97 mg, 9.9 μmol, 3.8 equivalents) in DMF / water (0.12 mL, 5:1). Intermediate III.4 (9.61 mg, 70%) was obtained as a yellow solid by purification by RP-HPLC. C 236 H 344 F2N 30 O 110 . HPLC (Method E): t R = 9.2 min. MS (ESI): found m / z = 1800.6 [M+3H] 3+ , calcd. m / z = 1799.7 [M+3H] 3+ .
[0455] IV.4 Synthesis
[0456]
[0457] Compound IV.4 was synthesized according to GP4 using the TFA salt of intermediate III.4 (9.61 mg, 1.74 μmol, 1 equivalent), N-[15-[(2,5-dioxo-1-pyrrolidinyl)oxy]-15-oxo-3,6,9,12-tetraoxapentadec-1-yl]-2,5-dihydro-2,5-dioxo-1H-pyrrole-1-propanamide = Mal-PEG4-NHS-ester (1.89 mg, 3.68 μmol, 2.1 equivalents), and DIPEA (0.59 μL, 3.48 μmol, 2 equivalents) in DMF (0.4 mL). Compound IV.4 (6.95 mg, 69%) was obtained as a yellow solid by purification by RP-HPLC. C 254 H 370 F2N 32 O118 . HPLC (Method J): t R = 12.9 min. MS (ESI): found m / z = 1455.1 [M+3H+Na] 4+ , calcd. m / z = 1455.7 [M+3H+Na] 4+ .
[0458] Example 7 - Synthesis of Compound IV.5
[0459]
[0460] Compound IV.5 was synthesized as described for Compound IV.4, but using intermediate 4.2. Compound IV.5 (25.55 mg, 68%) was obtained as a yellow solid. C 262 H 386 F2N 32 O 122 . HPLC (Method J): t R = 13.1 min. MS (ESI): found m / z = 1494.3 [M+4H] 4+ , calcd. m / z = 1493.6 [M+xH] x+ .
[0461] Example 8 - Synthesis of Compound IV.6
[0462]
[0463] Compound IV.6 was synthesized as described for Compound IV.4, but using intermediate 4.3. Compound IV.6 (6.70 mg, 83%) was obtained as a yellow solid. C 278 H 418 F2N 32 O 130 . HPLC (Method J): t R = 13.3 min. MS (ESI): found m / z = 1582.3 [M+4H] 4+ , calcd. m / z = 1581.7 [M+4H] 4+ .
[0464] Example 9 - Synthesis of Compound IV.7
[0465]
[0466] Compound IV.7 was synthesized as described for Compound IV.4, but using intermediate 4.4. Compound IV.7 (10.41 mg, 51%) was obtained as a yellow solid. C 342 H 546 F2N 32 O 162 . HPLC (Method J): t R = 14.0 min. MS (ESI): found m / z = 1934.3 [M+4H] 4+ , calcd. m / z = 1933.9 [M+4H] 4+ .
[0467] Example 10 - Synthesis of Compound IV.8
[0468]
[0469] Compound IV.8 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.2. Compound IV.8 (19.3 mg, 35%) was obtained as a yellow solid. C 266 H 392 F2N 34 O 122 . HPLC (Method J): t R = 12.9 min. MS (ESI): found m / z = 1514.6 [M+4H] 4+ , calcd. m / z = 1514.1 [M+4H] 4+ .
[0470] Example 11 - Synthesis of Compound IV.9
[0471]
[0472] Compound IV.9 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.3. Compound IV.9 (8.87 mg, 49%) was obtained as a yellow solid. C 282 H 424 F2N 34 O 130 . HPLC (Method J): t R = 13.2 min. MS (ESI): found m / z = 1602.7 [M+4H] 4+ , calcd. m / z = 1602.2 [M+4H] 4+ .
[0473] Example 12 - Synthesis of Compound IV.10
[0474]
[0475] Compound IV.10 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.4. Compound IV.10 (12.26 mg, 49%) was obtained as a yellow solid. C 346 H 552 F2N 34 O 162 . HPLC (Method J): t R = 13.9 min. MS (ESI): found m / z = 1304.3 [M+6H] 6+ , calcd. m / z = 1303.3 [M+6H] 6+ .
[0476] Example 13 - Synthesis of Compound IV.11
[0477]
[0478] Compound IV.11 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.5. Compound IV.11 (5.69 mg, 56%) was obtained as a yellow solid. C 270 H 396 F2N 34 O 128 . HPLC (Method J):t R = 12.6 min. MS (ESI): found m / z = 1551.8 [M+4H] 4+ , calcd. m / z = 1551.1 [M+4H] 4+ .
[0479] Example 14 - Synthesis of Compound IV.12
[0480]
[0481] Compound IV.12 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.6. Compound IV.12 (43.17 mg, 59%) was obtained as a yellow solid. C 278 H 412 F2N 34 O 132 . HPLC (Method J): t R = 12.4 min. MS (ESI): found m / z = 1596.8 [M+4H] 4+ , calcd. m / z = 1595.67 [M+4H] 4+ .
[0482] Example 15 - Synthesis of Compound IV.13
[0483]
[0484] Compound IV.13 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.7. Compound IV.13 (29.51 mg, 59%) was obtained as a yellow solid. C 294 H 444 F2N 34 O 140 . HPLC (Method J): t R = 12.7 min. MS (ESI): found m / z = 1684.5 [M+4H] 4+ , calcd. m / z = 1683.2 [M+4H] 4+ .
[0485] Example 16 - Synthesis of Compound IV.14
[0486]
[0487] Compound IV.14 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.8. Compound IV.14 (61.21 mg, 81%) was obtained as a yellow solid. C 260 H 382 F2N 32 O 120 . HPLC (Method J): t R = 12.7 min. MS (ESI): found m / z = 1479.8 [M+4H] 4+ , calcd. m / z = 1478.6 [M+4H] 4+ .
[0488] Example 17 - Synthesis of Compound IV.15
[0489]
[0490] Compound IV.15 was synthesized as described for Compound IV.4, but using intermediates 3.2 and 4.9. Compound IV.15 (29.68 mg, 68%) was obtained as a yellow solid. C 272 H 402 F2N 32 O 130 . HPLC (Method J): t R = 12.5 min. MS (ESI): found m / z = 1560.1 [M+4H] 4+ , calcd. m / z = 1559.7 [M+4H] 4+ .
[0491] Example 18 - Synthesis of Compound IV.16
[0492] Synthesis of I.16
[0493]
[0494] Intermediate I.16 was synthesized according to GP1 using intermediate 5.1 (30 mg, 37.0 μmol, 1 equivalent), intermediate 1.3 (42.5 mg, 40.7 μmol, 1.1 equivalents), copper(II) sulfate pentahydrate (1.85 mg, 7.4 μmol, 0.2 equivalents), tris(benzyltriazolylmethyl)amine (4.91 mg, 9.25 μmol, 0.25 equivalents), and sodium ascorbate (3.66 mg, 18.5 μmol, 0.5 equivalents) in DMF / water (0.33 mL, 10:1). Intermediate I.16 (51.7 mg, 74%) was obtained as a yellow solid by purification by RP-HPLC. C 91 H 110 FN 19 O 23 . HPLC (Method A): t R = 11.1 min. MS (ESI): found m / z = 1855.1 [MH] - , calcd. m / z = 1854.8 [MH] - .
[0495] II.16 Synthesis
[0496]
[0497] Intermediate II.16 was synthesized according to GP3 using intermediate I.16 (51.7 mg, 27.8 μmol, 1 equivalent) and diethylamine (68.7 μL, 667.0 μmol, 24 equivalents) in 2.5 mL DMF for Fmoc-deprotection, and intermediate 3.1 (18.7 mg, 41.7 μmol, 1.5 equivalents) and diisopropylethylamine (14.2 μL, 83.4 μmol, 3 equivalents) in 3.44 mL DMF for the coupling reaction. Intermediate II.16 (43.8 mg, 82%) was obtained as a yellow solid by purification by RP-HPLC. C 90 H 122 FN 19 O 27 . HPLC (Method A): t R= 9.4 min. MS (ESI): found m / z = 961.6 [M+2H] 2+ , calcd. m / z = 960.9 [M+2H] 2+ .
[0498] III.16 Synthesis
[0499]
[0500] Intermediate III.16 was synthesized according to GP2 using intermediate 2.1 (2.67 mg, 4.6 μmol, 1 equivalent), intermediate II.16 (20.4 mg, 10.6 μmol, 2.3 equivalents), copper(II) sulfate pentahydrate (1.44 mg, 5.8 μmol, 1.25 equivalents), tris(3-hydroxypropyltriazolylmethyl)amine (5.02 mg, 11.6 μmol, 2.5 equivalents), and sodium ascorbate (3.43 mg, 17.3 μmol, 3.8 equivalents) in DMF / water (0.44 mL, 10:1). Intermediate III.16 (9.2 mg, 46%) was obtained as a yellow solid by purification by RP-HPLC. C 202 H 286 F2N 48 O 60 . HPLC (Method L): t R = 16.8 min. MS (ESI): found m / z = 1462.5 [M+3H] 3+ , calcd. m / z = 1461.7 [M+3H] 3+ .
[0501] IV.16 Synthesis
[0502]
[0503] Compound IV.16 was synthesized according to GP4 using the TFA salt of intermediate III.16 (7.4 mg, 1.26 μmol, 1 equivalent), N-[15-[(2,5-dioxo-1-pyrrolidinyl)oxy]-15-oxo-3,6,9,12-tetraoxapentadec-1-yl]-2,5-dihydro-2,5-dioxo-1H-pyrrole-1-propanamide = Mal-PEG4-NHS-ester (0.72 mg, 1.39 μmol, 1.1 equivalents), and DIPEA (0.22 μL, 1.26 μmol, 1 equivalent) in DMF (0.3 mL). Compound IV.16 (3.85 mg, 61%) was obtained as a yellow solid by purification by RP-HPLC. C 220 H 312 F2N 50 O 68 . HPLC (Method J): t R = 14.1 min. MS (ESI): found m / z = 1595.3 [M+3H] 3+ , calcd. m / z = 1594.4 [M+3H] 3+ .
[0504] Example 19 - Synthesis of Compound IV.17
[0505]
[0506] Compound IV.17 was synthesized as described for Compound IV.16, but using intermediate 5.2. Compound IV.17 (23.5 mg, 75%) was obtained as a yellow solid. C 220 H 314 F2N 52 O 66 . HPLC (Method J): t R = 13.8 min. MS (ESI): found m / z = 1594.2 [M+3H] 3+ , calcd. m / z = 1593.8 [M+3H] 3+ .
[0507] Example 20 - Synthesis of Compound IV.18
[0508]
[0509] Compound IV.18 was synthesized as described for Compound IV.16, but using intermediates 3.2 and 5.2. Compound IV.18 (15.9 mg, 57%) was obtained as a yellow solid. C 224 H 320 F2N 54 O 66 . HPLC (Method J): t R = 12.9 min. MS (ESI): found m / z = 1621.8 [M+3H] 3+ , calcd. m / z = 1621.1 [M+3H] 3+ .
[0510] Example 21 - Synthesis of Compound IV.19
[0511] Synthesis of I.19
[0512]
[0513] Intermediate I.19 was synthesized according to GP1 using intermediate 6.1 (64.31 mg, 86.11 μmol, 1 equivalent), intermediate 1.3 (60.0 mg, 57.4 μmol, 1.0 equivalent), copper(II) sulfate pentahydrate (14.3 mg, 57.4 μmol, 1 equivalent), THPTA (50.08 mg, 115.2 μmol, 2 equivalents), and sodium ascorbate (34.38 mg, 173.5 μmol, 3 equivalents) in DMF / water (1.72 mL, 2:1). Intermediate I.17 (76.18 mg, 74%) was obtained as a yellow solid by purification by RP-HPLC. C 87 H 111 FN 12 O 28 . HPLC (Method B): t R = 16.8 min. MS (ESI): found m / z = 896.7 [M+2H] 2+ , calcd. m / z = 896.4 [M+2H]2+ .
[0514] II.19 Synthesis
[0515]
[0516] Intermediate II.19 was synthesized according to GP3 using intermediate I.19 (76.18 mg, 42.51 μmol, 1 equivalent) and diethylamine (105 μL, 1020 μmol, 24 equivalents) in 5 mL of anhydrous DMF for Fmoc-deprotection, and intermediate 3.2 (31.28 mg, 63.8 μmol, 1.5 equivalents) and diisopropylethylamine (21.7 μL, 127.5 μmol, 3 equivalents) in 1 mL of DMF for the coupling reaction. Intermediate II.19 (38.97 mg, 48%) was obtained as a yellow solid by purification by RP-HPLC. C 88 H 126 FN 13 O 32 . HPLC (Method N): t R = 16.1 min. MS (ESI): found m / z = 949.6 [M+2H] 2+ , calcd. m / z = 948.9 [M+2H] 2+ .
[0517] III.19 Synthesis
[0518]
[0519] Intermediate III.19 was synthesized according to GP2 using intermediate 2.1 (4.96 mg, 8.6 μmol, 1 equivalent), intermediate II.19 (38.97 mg, 20.5 μmol, 2.4 equivalents), copper(II) sulfate pentahydrate (2.57 mg, 10.3 μmol, 1.2 equivalents), tris(3-hydroxypropyltriazolylmethyl)amine (8.95 mg, 20.6 μmol, 2.4 equivalents), and sodium ascorbate (6.10 mg, 30.8 μmol, 3.6 equivalents) in DMF / water (1.13 mL, 10:1). After 3 hours, the same amount of catalyst was added again, and the solution was stirred at room temperature for another 40 minutes. Intermediate III.19 (29.03 mg, 76%) was obtained as a yellow solid by purification by RP-HPLC. C 198 H 294 F2N 36 O 70 . HPLC (Method O): t R = 12.3 min. MS (ESI): found m / z = 1446.6 [M+3H] 3+ , calcd. m / z = 1245.7 [M+3H] 3+ .
[0520] IV.19 Synthesis
[0521]
[0522] Compound IV.19 was synthesized according to GP4 using the TFA salt of intermediate III.19 (29.03 mg, 6.5 μmol, 1 equivalent), N-[15-[(2,5-dioxo-1-pyrrolidinyl)oxy]-15-oxo-3,6,9,12-tetraoxapentadec-1-yl]-2,5-dihydro-2,5-dioxo-1H-pyrrole-1-propanamide = Mal-PEG4-NHS-ester (13.40 mg, 26.1 μmol, 4 equivalents) and DIPEA (4.43 μL, 26.1 μmol, 4 equivalents) in DMF (0.78 mL). Upon completion after 1.5 hours, the product was precipitated in ice-cold MTBE acidified with TFA (6 equivalents), and compound IV.17 (21.48 mg, 70%) was obtained as a yellow solid by purification by RP-HPLC. C 216 H 320 F2N 38 O 78 . HPLC (Method J): t R = 13.3 min. MS (ESI): found m / z = 1578.7 [M+3H] 3+ , calcd. m / z = 1578.4 [M+3H] 3+ .
[0523] Example 22 - Synthesis of Compound IV.20
[0524]
[0525] Compound IV.20 was synthesized as described for Compound IV.19, using intermediate 6.2. Compound IV.20 (14.34 mg, 31%) was obtained as a yellow solid. C 192 H 276 F2N 34 O 64 . HPLC (Method J): t R = 13.5 min. MS (ESI): found m / z = 1374.9 [M+3H] 3+ , calcd. m / z = 1374.3 [M+3H]3+ .
[0526] Example 23 - Synthesis of Compound IV.21
[0527]
[0528] Compound IV.21 was synthesized as described for Compound IV.19, using intermediate 6.3. Compound IV.21 (17.83 mg, 64%) was obtained as a yellow solid. C 216 H 320 F2N 38 O 78 . HPLC (Method J): t R = 13.1 min. MS (ESI): found m / z = 1579.1 [M+3H] 3+ , calcd. m / z = 1578.4 [M+3H] 3+ .
[0529] Example 24 - Synthesis of Compound IV.22
[0530]
[0531] Compound IV.22 was synthesized as described for Compound IV.19, but using intermediate 6.4. Compound IV.22 (27.9 mg, 55%) was obtained as a yellow solid. C 232 H 352 F2N 38 O 86 . HPLC (Method J): t R = 13.4 min. MS (ESI): found m / z = 1697.0 [M+3H] 3+ , calcd. m / z = 1695.8 [M+3H] 3+ .
[0532] Example 25 - In vitro cytotoxicity analysis using 2D and 3D cell cultures
[0533] The cytotoxicity of the anti-GUCY2C ADC containing the modular linker compound of the present invention was evaluated using an in vitro cytotoxicity assay based on 2D and 3D cell cultures using target-positive HEK293-GUCY2C and target-negative HEKwt cells.
[0534] At the start of the 2D cytotoxicity assay, 2 x 10 per well of a 96-well plate 3 Canine target-positive or target-negative cells were seeded and cultured at 37°C and 5% CO2. After 24 hours, 1 x 10⁶ of the indicated ADC were added. -6 1.28x10 in M -12 Adherent cells were added at various concentrations ranging from M, and the plates were further incubated at 37°C and 5% CO2 for 4 days. Cytotoxicity was evaluated using Roche’s cell proliferation ELISA, BrdU (colorimetric).
[0535] At the start of the 3D cytotoxicity assay, 2 x 10 per well of an ultra-low adhesion (ULA) 96-well plate 3 Canine target-positive or target-negative cells were seeded and cultured at 37°C and 5% CO2. After 48 hours, 1 x 10⁶ spheroids were produced. -6 1.28x10 in M -12 After treatment with various concentrations of the indicated ADCs ranging from M, the plates were incubated for an additional 5 days at 37°C and 5% CO2. Cytotoxicity was evaluated using Promega’s CellTiter-Glo® 2.0 cell viability assay.
[0536] The anti-GCC ADC used as a control included linker-payloads (IV.11), (IV.17), and (IV.19), which do not constitute part of the present invention.
[0537] Example 26 - Study design in an in vivo animal model
[0538] 5 x 10⁶ in 200 μL of RPMI medium containing 50% Matrigel without phenol red per mouse on the right side of female NOD SCID mice 6 Canine GCC-overexpressing human embryonic kidney HEK293-GUCY2C-(HDP)-2B3 cells were subcutaneously inoculated. The average tumor volume was approximately 150 mm³. 3 Upon reaching [date], animals were assigned to either the control or treatment group based on tumor size. On the same day (Day 0) or the following day (Day 1), animals were treated by administering the vehicle control or the anti-GCC ADC conjugated to each modular linker compound of the present invention once intravenously, or by administering it once a week for 3 weeks. Tumor volume was measured twice a week using calipers, and body weight was measured concurrently. Clinical signs and survival rates were monitored daily. Animals were sacrificed and necropsy performed upon the occurrence of one or more termination criteria or at the end of the study. The indicated dose of each ADC corresponds to the total ADC dose in mg / kg as indicated in each case.
[0539] Those skilled in the art to which the present invention pertains will readily conceive of many variations and other embodiments of the present invention as described herein by taking into account the teachings presented in the foregoing description and the accompanying drawings. Accordingly, it should be understood that the present invention is not limited to the specific embodiments disclosed, and that variations and other embodiments are intended to be included within the scope of the appended claims. Although specific terms have been used in this specification, they are used only in a comprehensive and descriptive sense and are not intended to be limiting.
[0540] Example 27 - In vitro bystander analysis
[0541] In an in vitro bystander assay, target-negative HEKwt cells stained with CellTracer FarRed and GUCY2C-expressing HEK-GUCY2C cells stained with CFDA were co-cultured and treated with an anti-GCC ADC. After 72 hours, the bystander apoptotic activity of the compound was evaluated by analyzing apoptotic (7AAD+) target-negative HEKwt cells.
[0542] All three anti-GCC ADCs showed potent bystander apoptosis activity, whereas no effect was observed in HEKwt cells without target-expressing HEK-GUCY2C cells (see Fig. 9).
Claims
Claim 1 Antibody-drug conjugate (ADC) of formula (I) or pharmaceutically acceptable salt or solvate thereof: Chemical formula (I) where; k is an integer from 2 to 4; Ab is an anti-GUCY2C antibody; and D is It is a pharmaceutically active substance selected from, where:- R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or - R 1 is -H, and R 2 is -CH2N(CH3)2, and R 3 is -OH, and R 4 is -H, and R 5 is -O- or; or- R 1 is -CH2CH3, and R 2 is -H, and R 3 Is and R 4 is -H, and R 5 is -O- or; or- R 1 is -H, and R 2 is -NO2, and R 3 is -H, and R 4 is -H, and R 5 is -O- or; or- R 1 is -CH2CH2NHCH(CH3)2, and R 2 is -H, and R 3 is -H, and R 4 is -H, and R 5 is -O- or; or- R 1 is -CH2CH3, and R 2 is -H, and R 3 is -OH, and R 4 is -H, and R 5 is -O- and;SE is a solubility enhancer and includes alpha-cyclodextrin, beta-cyclodextrin, gamma-cyclodextrin, polysarcosine, PEG, or a polyalcohol prepared from a carbohydrate. Claim 2 In claim 1, D is and, here:- R 2 and R 1 Together Forms, and R 3 is -CH3, and R 4 is -F, and R 5 is -OH or - R 1 is -H, and R 2 is -CH2N(CH3)2, and R 3 is -OH, and R 4 is -H, and R 5 is -O- or; or- R 1 is -CH2CH3, and R 2 is -H, and R 3 Is and R 4 is -H, and R 5 is an antibody-drug conjugate with -O- phosphorus. Claim 3 In claim 1 or 2, D is Phosphorus, antibody-drug conjugate. Claim 4 An antibody-drug conjugate according to any one of claims 1 to 3, wherein SE is selected from the group consisting of: , , and or ,where m is 2 to 12; n is 2 to 12; p is 1 to 20; and q is 2 to 12. Claim 5 In claim 4, SE is An antibody-drug conjugate, where m is 4 or 8. Claim 6 In claim 4, SE is and n is 4, antibody-drug conjugate. Claim 7 In claim 4, SE is and p is 10, antibody-drug conjugate. Claim 8 In claim 4, SE is and q is an antibody-drug conjugate of 8. Claim 9 In any one of claims 1 to 8, the antibody specifically recognizes and binds to a target sequence or epitope of an antigen, and preferably, the antibody is an antibody-drug conjugate that is one of the following: - a monoclonal antibody; - an antigen-binding fragment such as a single-chain variable fragment (scFv), Fab fragment, F(ab') fragment, F(ab')2 fragment, or a functional antibody fragment or antibody derivative such as a bispecific or trispecific antibody construct; - a diabody; - a camel antibody; - a domain antibody; - a nanobody; - a divalent homodimer having two chains composed of scFv; - a shark antibody; - an antibody composed of a New World primate framework sequence and a non-New World primate complementarity determining region (CDR); or - a constant heavy chain 3 (CH3) domain, a variable light chain (VL) and a variable heavy chain (V H A dimeric structure containing ). Claim 10 An antibody-drug conjugate according to any one of claims 1 to 9, wherein the antibody is a monoclonal antibody that recognizes and binds to a target sequence or epitope of guanylate cyclase 2C (GUCY2C), preferably human or cynomolgus guanylate cyclase 2C, more preferably human guanylate cyclase 2C. Claim 11 An antibody-drug conjugate according to any one of claims 1 to 10, wherein the antibody comprises an antigen-binding region comprising the following: - CDR of SEQ ID NO. 1 L 1, CDR of Sequence No. 2 L CDR of 2 and Sequence No. 3 L The variable region of the mAb1 light chain (mAb1 V) of 3 L ) Complementarity-Decision Region (CDR L ) sequence; and- CDR of Sequence No. 4 H 1, CDR of Sequence No. 5 H CDR of 2 and Sequence No. 6 H 3 mAb1 heavy chain variable region (mAb1 V H ). Claim 12 An antibody-drug conjugate according to any one of claims 1 to 9, wherein the antibody comprises an antigen-binding region comprising the following: - CDR of SEQ ID NO. 1 L 1, CDR of Sequence No. 2 L CDR of 2 and Sequence No. 7 L The variable region of the mAb8 light chain (mAb8 V) of 3 L ) Complementarity-Decision Region (CDR L ) sequence; and- CDR of Sequence No. 4 H 1, CDR of Sequence No. 5 H CDR of 2 and Sequence No. 6 H 3 mAb8 heavy chain variable region (mAb8 V H ). Claim 13 An antibody-drug conjugate according to any one of claims 1 to 10, wherein the antibody comprises an antigen-binding region comprising the following: - CDR of SEQ ID NO. 8 L 1, CDR of Sequence No. 9 L CDR of 2 and Sequence No. 10 L 3 mAb41 light chain variable region (mAb41 V L ) Complementarity-Decision Region (CDR L ) sequence; and- CDR of Sequence No. 11 H 1, CDR of Sequence No. 12 H CDR of 2 and Sequence No. 13 H 3 mAb41 heavy chain variable region (mAb41 V H ). Claim 14 The antibody-drug conjugate of claim 11, wherein the antibody comprises an antigen-binding region comprising the following: - Framework region 1 (FR) of SEQ ID NO. 14 L 1), CDR of Sequence No. 1 L 1, FR of Sequence No. 15 L 2, CDR of Sequence No. 2 L 2, FR of Sequence No. 16 L 3, CDR of Sequence No. 3 L FR of 3 and Sequence No. 17 L The above mAb1 V including 4 L ; and- Framework region 1 of SEQ ID NO 18 (FR H 1), CDR of Sequence No. 4 H 1, FR of Sequence No. 19 H 2, CDR of sequence number 5 H 2, FR of Sequence No. 20 H 3, CDR of sequence number 6 H FR of 3 and Sequence No. 21 H The above mAb1 V including 4 H . Claim 15 The antibody-drug conjugate of claim 12, wherein the antibody comprises an antigen-binding region comprising the following: - Framework region 1 (FR) of SEQ ID NO. 22 L 1), CDR of Sequence No. 1 L 1, FR of Sequence No. 15 L 2, CDR of Sequence No. 2 L 2, FR of Sequence No. 23 L 3, CDR of Sequence No. 7 L FR of 3 and Sequence No. 24 L The above mAb8 V including 4 L ; and- Framework region 1 of SEQ ID NO 18 (FR H 1), CDR of Sequence No. 4 H 1, FR of Sequence No. 19 H 2, CDR of sequence number 5 H 2, FR of Sequence No. 20 H 3, CDR of sequence number 6 H FR of 3 and Sequence No. 21 H The above mAb8 V including 4 H . Claim 16 The antibody-drug conjugate of claim 13, wherein the antibody comprises an antigen-binding region comprising the following: - Framework region 1 (FR) of SEQ ID NO. 25 L 1), CDR of Sequence No. 8 L 1, FR of Sequence No. 26 L 2, CDR of sequence number 9 L 2, FR of Sequence No. 27 L 3, CDR of Sequence No. 10 L FR of 3 and Sequence No. 28 L The above mAb41 V including 4 L ; and- Framework region 1 of SEQ ID NO 29 (FR H 1), CDR of Sequence No. 11 H 1, FR of Sequence No. 30 H 2, CDR of Sequence No. 12 H 2, FR of Sequence No. 31 H 3, CDR of Sequence No. 13 H FR of 3 and Sequence No. 21 H The above mAb41 V including 4 H . Claim 17 An antibody-drug conjugate of claim 14, wherein the antibody comprises an antigen-binding region comprising the following: - mAb1 V of SEQ ID NO. 32 L ; and- the above mAb1 V of SEQ ID NO. 33 H . Claim 18 An antibody-drug conjugate of claim 15, wherein the antibody comprises an antigen-binding region comprising the following: - mAb8 V of SEQ ID NO. 34 L ; and- the mAb8 V of SEQ ID NO. 35 H . Claim 19 An antibody-drug conjugate of claim 16, wherein the antibody comprises an antigen-binding region comprising the following: - mAb41 V of SEQ ID NO. 36 L ; and- the above mAb41 VH of SEQ ID NO.
37. Claim 20 An antibody-drug conjugate according to any one of claims 1 to 19, wherein the antibody is (a) a humanized or human antibody; and / or (b) an IgG-type antibody, preferably an IgG1 antibody; and / or (c) a recombinant antibody. Claim 21 An antibody-drug conjugate according to claim 20, wherein the antibody comprises a heavy chain constant (Fc) region comprising an amino acid substitution D265C, preferably wherein the heavy chain constant (Fc) region comprises amino acid substitutions L234A, L235A, and D265C (according to the EU numbering scheme). Claim 22 The antibody-drug conjugate of claim 21, wherein the antibody comprises: - the mAb1-D265C heavy chain of SEQ ID NO. 39; or - the mAb8-D265C heavy chain of SEQ ID NO. 40; or - the mAb41-D265C of SEQ ID NO.
41. Claim 23 The antibody-drug conjugate of claim 21, wherein the antibody comprises: - the heavy chain of mAb1-L234A-L235A-D265C of SEQ ID NO. 42; or - the heavy chain of mAb8-L234A-L235A-D265C of SEQ ID NO. 43; or - the heavy chain of mAb41-L234A-L235A-D265C of SEQ ID NO.
44. Claim 24 An antibody-drug conjugate according to any one of claims 1 to 23, wherein the antibody-drug conjugate is any one of the following chemical formulas: Here, k is 2; or Here, k is 2; or Here, k is 2; or Here, k is 2; or Here, k is 2. Claim 25 An antibody-drug conjugate according to any one of claims 1 to 24 for use as a pharmaceutical agent, preferably for the treatment of cancer, more preferably for the treatment of gastrointestinal cancers such as colorectal cancer (CRC), metastatic colorectal cancer (mCRC), or pancreatic cancer. Claim 26 A pharmaceutical composition comprising an antibody-drug conjugate according to any one of claims 1 to 24 or a pharmaceutically acceptable salt thereof. Claim 27 A method for treating cancer, wherein the method comprises administering an antibody-drug conjugate according to any one of claims 1 to 24 or a pharmaceutically acceptable salt thereof to a subject in need thereof. Claim 28 A method according to claim 27, wherein the cancer is gastrointestinal cancer. Claim 29 A method according to claim 28, wherein the cancer is selected from the group consisting of colorectal cancer (CRC), metastatic colorectal cancer (mCRC), and pancreatic cancer. Claim 30 A method according to any one of claims 26 to 29, wherein the method further comprises administering ipilimumab (anti-CTLA-4), nivolumab (anti-PD-1), pembrolizumab (anti-PD-1) and / or atezolizumab (anti-PD-L1) to a subject.