TREM2 antigen binding proteins and uses thereof
Patent Information
- Application Number
- NZ757795
- Authority / Receiving Office
- NZ · NZ
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2017-11-01
- Filing Date
- 2018-04-20
- Publication Date
- 2026-09-01
- Estimated Expiration
- 2038-04-20
AI Technical Summary
There is a need for therapeutic molecules that can induce or enhance TREM2-mediated functions, as deficits in TREM2 activity are linked to various neurodegenerative disorders such as Alzheimer's disease and frontotemporal dementia, and existing treatments are inadequate in activating TREM2 without cross-linking agents.
Development of antigen binding proteins, such as antibodies, that specifically bind to and activate human TREM2, increasing phosphorylated Syk levels in myeloid cells without the need for cross-linking agents, with a high affinity and specificity to the TREM2 extracellular domain.
The TREM2 agonist antigen binding proteins effectively activate TREM2/DAP12 signaling, enhancing myeloid cell functions like phagocytosis and cytokine regulation, offering potential therapeutic benefits for neurodegenerative disorders by increasing survival and proliferation of microglia and macrophages.
Smart Images

Figure 1_ABST
Abstract
Description
TREM2 ANTIGEN BINDING PROTEINS AND USES THEREOFFIELD OF THE INVENTION
[0001] The present invention relates to the field of biopharmaceuticals. In particular, the invention relates to antigen binding proteins, such as antibodies, that specifically bind to and activate human triggering receptor expressed on myeloid cells-2 (TREM2), pharmaceutical compositions comprising the antigen binding proteins, and methods of producing and using such antigen binding proteins.SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: A-2129-WO-PCT_Sequence_Listing_ST25, date created: April 18, 2018, size: 285,044 bytes).BACKGROUND OF THE INVENTION
[0003] TREM2 is a member of the Ig superfamily of receptors that is expressed on cells of myeloid lineage, including macrophages, dendritic cells, and microglia (Schmid et al,Journal of Neurochemistry, Vol. 83: 1309-1320, 2002; Colonna, Nature ReviewsImmunology, Vol. 3: 445-453, 2003; Kiialainen etai, Neurobiology of Disease, Vol. 18: 314-322, 2005). TREM2 is an orphan immune receptor with a short intracellular domain and functions by signaling through the adaptor protein DAP12, the cytoplasmic domain of which comprises an IT AM motif (Bouchon et al., The Journal of Experimental Medicine, Vol. 194: 1111-1122, 2001). Upon activation of TREM2, tyrosine residues within the ITAM motif in DAP 12 are phosphoiylated by the Src family of kinases, providing docking sites for the tyrosine kinase ζ-chain-associated protein 70 (ZAP70) and spleen tyrosine kinase (Syk) via their SH2 domains (Colonna, Nature Reviews Immunology, Vol. 3: 445-453, 2003; Ulrich and Holtzman, ACS Chem. Neurosci., Vol. 7: 420-427, 2016). The ZAP70 and Syk kinases induce activation of several downstream signaling cascades, including phosphatidylinositol 3- kinase (PI3K), protein kinase C (PKC), extracellular regulated kinase (ERK), and elevation of intracellular calcium (Colonna, Nature Reviews Immunology, Vol. 3: 445-453, 2003; Ulrich and Holtzman, ACS Chem. Neurosci., Vol. 7: 420-427, 2016).
[0004] TREM2 has been implicated in several myeloid cell processes, includingphagocytosis, proliferation, survival, and regulation of inflammatory cytokine production (Ulrich and Holtzman, ACS Chem. Neurosci., Vol. 7: 420-427, 2016). In the last few years, TREM2 has been linked to several diseases. For instance, mutations in both TREM2 and DAP 12 have been linked to the autosomal recessive disorder Nasu-Hakola Disease, which is characterized by bone cysts, muscle wasting and demyelination phenotypes (Guerreiro et al, New England Journal of Medicine, Vol. 368: 117-127, 2013). More recently, variants in the TREM2 gene have been linked to increased risk for Alzheimer's disease (AD) and other forms of dementia including frontotemporal dementia (Jonsson et al, New England Journal of Medicine, Vol. 368: 107-116, 2013; Guerreiro etai, JAMA Neurology, Vol. 70:78-84, 2013; Jay etal, Journal of Experimental Medicine, Vol. 212: 287-295, 2015). In particular, the R47H variant has been identified in genome-wide studies as being associated with increased risk for late-onset AD with an overall adjusted odds ratio (for populations of all ages) of 2.3, second only to the strong genetic association of ApoE to Alzheimer's. The R47H mutation resides on the extracellular Ig V-set domain of the TREM2 protein and has been shown to impact lipid binding and uptake of apoptotic cells and Abeta (Wang et al, Cell, Vol. 160: 1061-1071, 2015; Yeh etai, Neuron, Vol. 91: 328-340, 2016), suggestive of a loss-of-function linked to disease. Further, postmortem comparison of AD patients' brains with and without the R47H mutation are supportive of a novel loss-of-microglial barrier function for the carriers of the mutation, with the R47H carrier microglia putatively demonstrating a reduced ability to compact plaques and limit their spread (Y uan el al, Neuron, Vol. 90: 724-739, 2016). Impairment in microgliosis has been reported in animal models of prion disease, multiple sclerosis, and stroke, suggesting that TREM2 may play an important role in supporting microgliosis in response to pathology or damage in the central nervous system (Ulrich and Holtzman, ACS Chem. Neurosci., Vol. 7: 420-427, 2016).
[0005] In view of the data indicating that deficits in TREM2 activity affect macrophage and microglia function and correlate with certain neurodegenerative disorders, there is a need in the art for therapeutic molecules that can induce or enhance TREM2-mediated functions.SUMMARY OF THE INVENTION
[0006] The present invention is based, in part, on the design and generation of antigen binding proteins (e.g. antibodies) that specifically bind to and activate human TREM2 without the need for additional cross-linking. The agonist antigen binding proteins of theinvention are capable of activating TREM2 / DAP12 signaling in myeloid cells in the absence of aggregation, clustering, and / or Fc-mediated cross-linking of the antigen binding proteins. Accordingly, in certain embodiments, the present invention provides isolated agonist antigen binding proteins that specifically bind to human TREM2 and induce or activate one or more TREM2-mediated functions.
[0007] In some embodiments, the TREM2 agonist antigen binding proteins increase phosphorylated Syk (pSyk) levels in the absence of a cross-linking agent in cells expressing TREM2. The cells may be cells of the myeloid lineage, including monocytes, dendritic cells, microglial cells, and macrophages. In certain embodiments, the TREM2 agonist antigen bindings increase pSyk levels in TREM2-expressing cells with an EC50 less than 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In other embodiments, the TREM2 agonist antigen bindings increase pSyk levels in TREM2- expressing cells with an EC50 less than 300 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In yet other embodiments, the TREM2 agonist antigen bindings increase pSyk levels in TREM2-expressing cells with an EC50 from about 150 pM to about 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay.
[0008] The TREM2 agonist antigen binding proteins specifically bind to human TREM2 (SEQ ID NO: 1) or an extracellular domain (ECD) of human TREM2 (e.g. ECD set forth in SEQ ID NO: 2), for example with an equilibrium dissociation constant (KD) less than 50 nM, less than 25 nM, less than 10 nM, or less than 5 nM. In certain embodiments, the TREM2 agonist antigen binding proteins do not cross-react with other TREM proteins, such as human TREMl. Thus, in one embodiment, the TREM2 agonist antigen binding proteins do not specifically bind to human TREMl (SEQ ID NO: 4).
[0009] The TREM2 agonist antigen binding proteins of the invention can compete with any of the anti-TREM2 antibodies described herein (e.g. antibodies listed in Tables 1 A, IB, 2A, 2B, 3A and 3B) for binding to human TREM2. In one embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 and a heavy chain variable region comprising the sequence of SEQ ID NO: 124. In another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 62and a heavy chain variable region comprising the sequence of SEQ ID NO: 125. In yet another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 52 and a heavy chain variable region comprising the sequence of SEQ ID NO: 115. In still another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 56 and a heavy chain variable region comprising the sequence of SEQ ID NO: 119.
[0010] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising complementarity determining regions CDRL1, CDRL2, and CDRL3 and a heavy chain variable region comprisingcomplementarity determining regions CDRH1, CDRH2, and CDRH3. The light chain and heavy chain variable regions or CDRs may be from any of the anti-TREM2 antibodies described herein or a variant thereof. For instance, in some embodiments, the TREM2 agonist antigen binding proteins comprise a CDRL1 comprising a sequence selected f om SEQ ID NOs: 5-18 or a variant thereof having one, two, three or four amino acid substitutions; a CDRL2 comprising a sequence selected from SEQ ID NOs: 19-30 or a variant thereof having one, two, three or four amino acid substitutions; a CDRL3 comprising a sequence selected from SEQ ID NOs: 31-45 or a variant thereof having one, two, three or four amino acid substitutions; a CDRH1 comprising a sequence selected from SEQ ID NOs: 77-86 or a variant thereof having one, two, three or four amino acid substitutions; a CDRH2 comprising a sequence selected from SEQ ID NOs: 87-94 or a variant thereof having one, two, three or four amino acid substitutions; and a CDRH3 comprising a sequence selected from SEQ ID NOs: 95-109 or a variant thereof having one, two, three or four amino acid substitutions.
[0011] In some embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising a sequence selected from SEQ ID NOs: 46-63 and a heavy chain variable region comprising a sequence selected from SEQ ID NOs: 110-126. In one embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 54 and a heavy chain variable region comprising the sequence of SEQ ID NO: 117. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 55 and a heavy chain variable region comprising the sequence of SEQ ID NO:118. In another embodiment, the TREM2 agonist antigen binding protein comprises alight chain variable region comprising the sequence of SEQ ID NO: 60 and a heavy chain variable region comprising the sequence of SEQ ID NO: 123. In still another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 and a heavy chain variable region comprising the sequence of SEQ ID NO: 124. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 62 and a heavy chain variable region comprising the sequence of SEQ ID NO: 125. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 52 and a heavy chain variable region comprising the sequence of SEQ ID NO: 115.
[0012] In some embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region that is derived from a light chain variable region from any of the anti- TREM2 antibodies described herein. Thus, in some embodiments, the light chain variable region of the TREM2 agonist antigen binding proteins comprises a sequence that is at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, or at least 95% identical to a sequence selected from SEQ ID NOs: 46-63. For instance, the TREM2 agonist antigen binding proteins can comprise a light chain variable region from any of the engineered anti-TREM2 antibody variants set forth in Tables 13-18. In one embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 54 with a mutation at one or more amino acid positions 64, 79, 80, 85, 94, and / or 100. In some such embodiments, the mutation is V64G, V64A, Q79E, Q79D, S80P, S80A, F85V, F85L, F85A, F85D, F85I, F85L, F85M, F85T, W94F, W94Y, W94S, W94T, W94A, W94H, W94I, W94Q, P100R, P100Q, P100G, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 55 with a mutation at one or more amino acid positions 64, 79, 80, 94, and / or 100. Such mutations can include V64G, V64A, Q79E, Q79D, S80P, S80A, W94F, W94Y, W94S, W94T, W94A, W94H, W94I, W94Q, P100R, P100Q, P100G, or combinations thereof. In certain embodiments, the mutation is V64G, V64A, Q79E, S80P, S80A, W94Y, W94S, P100R, P100Q, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 60 with a mutation at one or more amino acid positions 60, 92, and / or 93. The mutation in suchembodiments can be selected from L60S, L60P, L60D, L60A, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 with a mutation at one or more amino acid positions 56, 57, 92, and / or 93. In such embodiments, the mutation can be N56S, N56T, N56Q, N56E, G57A, G57V, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof. In certain embodiments, the mutation is N56S, N56Q, G57A, D92E, D92Q, S93A, or combinations thereof. In still another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 62 with a mutation at amino acid position 36, 46, 61 and / or 100. Such mutations can include F36Y, S46L, S46R, S46V, S46F, K61R, P100Q, P100G, P100R or combinations thereof. In particular embodiments, the mutation is F36Y, K61R, P100Q, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 52 with a mutation at amino acid position 91, which can be selected from F91V, F91I, F91T, F91L, or F91D. In one embodiment, the mutation is F91V.
[0013] In certain embodiments, the TREM2 agonist antigen binding proteins comprise a heavy chain variable region that is derived from a heavy chain variable region from any of the anti-TREM2 antibodies described herein. Thus, in some embodiments, the heavy chain variable region of the TREM2 agonist antigen binding proteins comprises a sequence that is at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, or at least 95% identical to a sequence selected from SEQ ID NOs: 110- 126. For instance, the TREM2 agonist antigen binding proteins can comprise a heavy chain variable region from any of the engineered anti-TREM2 antibody variants set forth in Tables 13-18. In one embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 117 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104. In some such embodiments, the mutation is M19K, M19R, M19T, M19E, M19N, M19Q, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y, W104T, W104S, W104A, W104H, W1041, W104Q, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 118 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104. Such mutations can include M19K, M19R, M19T, M19E, M19N, M19Q,D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y, W104T, W104S, W104A, W104H, W104I, W104Q, or combinations thereof. In certain embodiments, the mutation is M19K, D55E, S56A, D57E, T58A, W104Y, W104T, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 123 with a mutation at one or more amino acid positions 27, 55, 56, 57, 58, 105, and / or 106. In some embodiments, the mutation is selected from H27Y, H27D, H27F, H27N, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, S106V, S106T, or combinations thereof. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 124 with a mutation at one or more amino acid positions 55, 56, 57, 58, 105, and / or 106. The mutation in such embodiments can be selected from D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, S106V, S106T, or combinations thereof. In certain embodiments, the mutation is D55E, D55Q, S56A, D57E, T58A, D105E, D105N, SI 06 A, or combinations thereof. In still another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 125 with a mutation at one or more amino acid positions 43, 76, 85, 99, 100, and / or 116. Such mutations can include L43Q, L43K, L43H, I76T, R85S, R85G, R85N, R85D, D99E, D99Q, D99S, D99T, G100A, G100Y, G100V, T116L, T116M, T116P, Tl 16R, or combinations thereof. In certain embodiments, the mutation is L43Q, R85S, D99E, G100A, G100Y, Tl 16L, or combinations thereof. In another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 115 with a mutation at amino acid position 62 and or 63. In such embodiments, the mutation can be selected from D62E, D62Q, D62T, D62N, S63A, S63Q, S63V, or combinations thereof. In some embodiments, the mutation is D62E, D62Q, S63A, or combinations thereof.
[0014] In some embodiments, the TREM2 agonist antigen binding proteins comprise one or more CDRs of a variant of the anti-TREM2 antibodies described herein. For instance, the TREM2 agonist antigen binding proteins may comprise one or more CDRs of the anti- TREM2 antibody variants set forth in Tables 2A, 2B, 3 A, 3B, and 19. In certainembodiments, the TREM2 agonist antigen binding proteins comprise one or more CDRs of antd-TREM2 antibody variants with improved binding affinity. In these and otherembodiments, the TREM2 agonist antigen binding proteins comprise a CDRLl comprising the sequence of SEQ ID NO: 16; a CDRL2 comprising a CDRL2 consensus sequence; a CDRL3 comprising a CDRL3 consensus sequence; a CDRH1 comprising the sequence of SEQ ID NO: 85, a CDRH2 comprising a CDRH2 consensus sequence; and a CDRH3 comprising a CDRH3 consensus sequence. In one embodiment, the CDRL2 consensus sequence is X1ASSX2QX3 (SEQ ID NO: 139), where Xi is A or G; X2 is L or R; and X3 is N, K, R, L, or T. In related embodiments, the CDRL3 consensus sequence is XtQADXiXsPXiT (SEQ ID NO: 140), where X. is Q or G; X2 is S or R; X3 is F, L, or Y; and X4 is R or H. In these and other embodiments, the CDRH2 consensus sequence isX1IYPGDSDX2RX3X4PX5FQX6 (SEQ ID NO: 141), where Xi is I or T; X» is T or V; X3is Y or L; Xt is S or A; Xs is S, G, or E; and Χβ is G or D. The CDRH3 consensus may be XiRTF Y YDS SD YX2D Y (SEQ ID NO: 142), where Xi is Q, G, S, or M; and ¾ is F or S. In further embodiments, the CDRL2 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 26 and 143-147. In still further embodiments, the CDRL3 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 43 and 148-152. In some embodiments, the CDRH2 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 91 and 170-175. In otherembodiments, the CDRH3 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 176-179.
[0015] In other embodiments, the TREM2 agonist antigen binding proteins comprise one or more CDRs of anti-TREM2 antibody variants with reduced binding affinity. In these and other embodiments, the TREM2 agonist antigen binding proteins comprise a CDRLl comprising a CDRLl consensus sequence; a CDRL2 comprising a CDRL2 consensus sequence; a CDRL3 comprising a CDRL3 consensus sequence; a CDRH1 comprising a CDRHl consensus sequence, a CDRH2 comprising a CDRH2 consensus sequence; and a CDRH3 comprising a CDRH3 consensus sequence. In one embodiment, the CDRLl consensus sequence is X1ASQGISX2WLA (SEQ ID NO: 284), where Xi is R or A; and X2 is S or R In related embodiments, the CDRL2 consensus sequence is X1AX2SLQN (SEQ ID NO: 285), where Xi is A or S; and X2 is S or G. In other related embodiments, the CDRL3 consensus sequence is QQAX1SFPX2T (SEQ ID NO: 286), where Xi is D or V; and ¾ is R or L. In these and other embodiments, the CDRHl consensus sequence is SXiWIA (SEQ ID NO: 287), where Xi is Y or E. In related embodiments, the CDRH2 consensus sequence isHYPXiDSDTRYSPSFQG (SEQ ID NO: 288), where Xi is G or S. The CDRH3 consensus may be QRX1FX2X3DSSDYFDY (SEQ ID NO: 289), where Xi is T or G; X2 is Y or R; and ¾ is Y or G. In some embodiments, the CDRLl of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 16, 290, and 291. In further embodiments, the CDRL2 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 28, 292, and 293. In still further embodiments, the CDRL3 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 43, 294, and 271. In some embodiments, the CDRH1 of the TREM2 agonist antigen binding proteins of the invention may comprise the sequence of SEQ ID NO: 85 or SEQ ID NO: 302. In other embodiments, the CDRH2 of the TREM2 agonist antigen binding proteins of the invention may comprise the sequence of SEQ ID NO: 91 or SEQ ID NO: 303. In still other embodiments, the CDRH3 of the TREM2 agonist antigen binding proteins of the invention may comprise a sequence selected from SEQ ID NOs: 107 and 304-306.
[0016] In certain embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region and / or heavy chain variable region from any of the anti-TREM2 variant antibodies set forth in Tables 2 A, 2B, 3 A, 3B, and 19. Accordingly, in some embodiments, the light chain variable region of the TREM2 agonist antigen binding proteins comprises a sequence that is at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, or at least 95% identical to a sequence selected from SEQ ID NOs: 61, 153-162, and 295-300. In these and other embodiments, the heavy chain variable region of the TREM2 agonist antigen binding proteins comprises a sequence that is at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, or at least 95% identical to a sequence selected from SEQ ID NOs: 124, 180-190, and 307-312.
[0017] In any of the embodiments described herein, including the embodiments described above, the TREM2 agonist antigen binding protein is an antibody or binding fragment thereof, preferably a monoclonal antibody or binding fragment thereof. In someembodiments, the monoclonal antibody or binding fragment thereof is a chimeric antibody or binding fragment thereof. In other embodiments, the monoclonal antibody or binding fragment thereof is a humanized antibody or binding fragment thereof. In yet other embodiments, the monoclonal antibody or binding fragment thereof is a fully human antibody or binding fragment thereof. The monoclonal antibody can be of any isotype, suchas a human IgGl, IgG2, IgG3, or IgG4. In one particular embodiment, the monoclonal antibody is a human IgGl antibody. In another particular embodiment, the monoclonal antibody is a human IgG2 antibody.
[0018] In certain embodiments in which the TREM2 agonist antigen binding protein is an antibody (e.g. monoclonal antibody), the antibody may contain one or more modifications that affect the glycosylation of the antibody. In some embodiments, the antibody comprises one or more mutations to reduce or eliminate glycosylation. In such embodiments, the aglycosylated antibody may comprise a mutation at amino acid position N297 (according to the EU numbering scheme), such as aN297G mutation, in its heavy chain. The aglycosylated antibody may comprise further mutations to stabilize the antibody structure. Such mutations can include pairs of cysteine substitutions, such as A287C and L306C, V259C and L306C, R292C and V302C, and V323C and I332C (amino acid positions according to the EU numbering scheme). In one embodiment, the aglycosylated antibody comprises R292C and V302C mutations (according to the EU numbering scheme) in its heavy chain. In certain embodiments, the aglycosylated anti-TREM2 agonist antibody comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 202 or SEQ ID NO: 203.
[0019] In further embodiments in which the TREM2 agonist antigen binding protein is a human IgG2 antibody (e.g. monoclonal antibody) or comprises a CHI region and hinge region from a human IgG2 antibody, the antibody may contain one or more modifications that affect the hinge structure of the antibody. In one such embodiment, the anti-TREM2 agonist antibody comprises a C131S mutation (according to the EU numbering scheme) in its heavy chain. In another embodiment, the anti-TREM2 agonist antibody comprises a C214S mutation (according to the EU numbering scheme) in its light chain and a C219S mutation (according to the EU numbering scheme) in its heavy chain. In another embodiment, the anti-TREM2 agonist antibody comprises a C214S mutation (according to the EU numbering scheme) in its light chain and a C220S mutation (according to the EU numbering scheme) in its heavy chain.
[0020] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise a CHI region and hinge region from a human IgG2 antibody (e.g. the amino acid of SEQ ID NO: 207), and an Fc region from a human IgGl antibody. In one embodiment, the TREM2 agonist antigen binding protein comprises a CHI region and hinge region from a human IgG2 antibody (e.g. the amino acid sequence of SEQ ID NO: 207) andan Fc region from a human IgGl antibody, wherein the Fc region comprises the amino acid sequence of SEQ ID NO: 281.
[0021] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising a light chain variable region and a heavy chain comprising a heavy chain variable region, wherein: (a) the light chain variable region having the amino acid sequence of SEQ ID NO: 326, and the heavy chain variable region having the amino acid sequence of SEQ ID NO: 327; (b) the light chain variable region having the amino acid sequence of SEQ ID NO: 328, and the heavy chain variable region having the amino acid sequence of SEQ ID NO: 329; (c) the light chain variable region having the amino acid sequence of SEQ ID NO: 330, and the heavy chain variable region having the amino acid sequence of SEQ ID NO: 331 ; or (d) the light chain variable region having the amino acid sequence of SEQ ID NO: 332, and the heavy chain variable region having the amino acid sequence of SEQ ID NO: 333. In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain and a heavy chain, wherein: (a) the light chain having the amino acid sequence of SEQ ID NO: 334, and the heavy chain having the amino acid sequence of SEQ ID NO: 335; (b) the light chain having the amino acid sequence of SEQ ID NO: 334, and the heavy chain having the amino acid sequence of SEQ ID NO: 336; (c) the light chain having the amino acid sequence of SEQ ID NO: 337, and the heavy chain having the amino acid sequence of SEQ ID NO: 338; (d) the light chain having the amino acid sequence of SEQ ID NO: 339, and the heavy chain having the amino acid sequence of SEQ ID NO: 340; or (e) the light chain having the amino acid sequence of SEQ ID NO: 341, and the heavy chain having the amino acid sequence of SEQ ID NO: 342.
[0022] The present invention also provides polynucleotides and expression vectors encoding the TREM2 agonist antigen binding proteins described herein as well as host cells, such as CHO cells, comprising the encoding polynucleotides and expression vectors. In certain embodiments, the present invention includes methods for producing the TREM2 agonist antigen binding proteins, including anti-TREM2 agonist monoclonal antibodies and binding fragments thereof. In one embodiment, the method comprises culturing a host cell comprising an expression vector encoding the antigen binding protein under conditions that allow expression of the antigen binding protein, and recovering the antigen binding protein from the culture medium or host cell.
[0023] The TREM2 agonist antigen binding proteins described herein can be used in the manufacture of a pharmaceutical composition or medicament for the treatment or preventionof conditions associated with TREM2 deficiency or loss of TREM2 biological activity, such as Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke. Thus, the present invention also provides a pharmaceutical composition comprising a TREM2 agonist antigen binding protein described herein and a pharmaceutically acceptable excipient.
[0024] In certain embodiments, the present invention provides methods for treating, preventing, or reducing the risk of developing conditions associated with TREM2 deficiency or loss of TREM2 biological activity in a patient in need thereof. In one embodiment, the method comprises administering to the patient an effective amount of any of the TREM2 agonist antigen binding proteins described herein. In some embodiments, H e condition to be treated, prevented, or ameliorated is Alzheimer's disease. In other embodiments, the condition to be treated, prevented, or ameliorated is multiple sclerosis. The patient in need of treatment may be determined to have one or more genotypes associated with an increased risk of developing a disease or condition that can be treated according to the methods of the invention. For instance, in some embodiments, the patient has a genotype associated with an increased risk of developing Alzheimer's disease, such as the genotypes described herein. In further embodiments, the patient may be determined to carry an allele encoding a TREM2 variant associated with an increased risk of developing Alzheimer's disease. Such variants can include the R47H TREM2 variant and the R62H TREM2 variant.
[0025] The present invention also includes methods of increasing survival or proliferation of myeloid cells, such as macrophages, microglia, and dendritic cells, in a patient in need thereof. In one embodiment, the method comprises administering to the patient an effective amount of any of the TREM2 agonist antigen binding proteins described herein. In some embodiments, the patient in need of treatment is at risk for, suffers from, or has been diagnosed with a neurodegenerative disorder, such as Alzheimer's disease. In other embodiments, the patient in need of treatment is at risk for, suffers from, or has been diagnosed with an autoimmune disorder, such as multiple sclerosis.BRIEF DESCRIPTION OF THE DRAWINGS
[0026] Figure 1A depicts dose-response curves for agonist activity of purified monoclonal human anti-TREM2 antibodies from harvest 1. The fold-increase in phosphorylated Syk (pSyk) levels in HEK293T cells expressing human TREM2 / DAP12 is plotted as a function of concentration of human anti-TREM2 antibodies. Agonist activity of a commercially availablerat anti-human / mouse TREM2 antibody (mAbl7291; "R&D mAb" or "Antibody 1") is included for comparison. Human IgG2 and rat IgG2b isotype antibodies were used as controls.
[0027] Figure IB depicts dose-response curves for agonist activity of unpurified monoclonal human anti-TREM2 antibodies from hybridoma supematants from harvests 3, 4, and 5. The fold-increase in pSyk levels in HE 293T cells expressing human TREM2 / DAP12 is plotted as a function of concentration of human anti-TREM2 antibodies. Human IgG2 isotype antibody was used as a control.
[0028] Figures 2A and 2B are sequence alignments of kappa light chain variable regions of exemplary anti-TREM2 antibodies to original germline sequences. Figure 2B is a continuation of the sequences in Figure 2A.
[0029] Figures 3A and 3B are sequence alignments of lambda light chain variable regions of exemplary anti-TREM2 antibodies to original germline sequences. Figure 3B is a continuation of the sequences in Figure 3A.
[0030] Figures 4A and 4B are sequence alignments of heavy chain variable regions of exemplary anti-TREM2 antibodies to original germline sequences. Figure 4B is a continuation of the sequences in Figure 4A.
[0031] Figure 5 is a plot of binding signal as a function of time of an anti-human Fc kinetic sensor (Octet®HTX instrument; Pall ForteBio) loaded with the 6E7 antibody at the time indicated by the dotted line ("1stAb capture"). The first solid denotes the time at which an irrelevant human IgG2 antibody was added to the sensor to reduce non-specific binding events ("Sensor blocking with G2"). The second solid line denotes the time at which the target antigen (soluble human TREM2) was added to the sensor to interact with the captured 6E7 antibody. The final solid line indicates the time at which the sandwich antibody (5E3, 6E7, or a control IgG2 antibody) was added to the sensor. An increase in binding is observed when the 5E3 antibody is added, which suggests that the 5E3 antibody binds to a different epitope on human TREM2 from the epitope bound by the 6E7 antibody.
[0032] Figure 6 depicts a dose-response curve for agonist activity of monoclonal human anti-TREM2 antibodies (4C5, 4G10, 5E3, 6E7, 10E3, 13E7, 24G6, 16B8, 25F12, 26F2, 32E3, and 33B12) in differentiated THP-1 cells. The fold-increase in phosphorylated Syk (pSyk) levels over baseline is plotted as a function of concentration of human anti-TREM2 antibodies. Human IgG2 (HuIgG) and rat IgG2b (RtlgG) isotype antibodies were used ascontrols. Agonist activity of a commercially available rat anti-human / mouse TREM2 antibody (mAb 17291; "RnD") is included for comparison.
[0033] Figure 7 depicts dose-response curves for agonist activity of purified 6E7 and 5E3 human anti-TREM2 antibodies in an IgG2 ("G2"), IgGl ("Gl") or an aglycosylated IgGl ("SEFL2") format. The fold-increase in phosphorylated Syk (pSyk) levels over the corresponding isotype control in HEK293T cells expressing human TREM2 / DAP12 is plotted as a function of concentration of the human anti-TREM2 antibodies. Conversion of the 6E7 and 5E3 antibodies from an IgG2 isotype to an IgGl isotype results in the partial loss of agonist activity.
[0034] Figure 8A is a bar graph of numbers of bone marrow derived macrophages(BMDMs) derived from wild-type (TREM+ / +) and TREM2- / -mice in different days of culture under limiting conditions of CSF-1. The TREM2- / -BMDMs exhibit a survival defect in these culture conditions.
[0035] Figure 8B is a bar graph of percent cell confluence of mouse adult microglia derived from wild-type (TREM+ / +) and TREM2- / -mice at different time points in culture under limiting conditions of CSF-1. TREM2- / -mouse adult microglia exhibit a survival defect in these culture conditions.
[0036] Figure 8C is a bar graph of percent cell confluence of mouse neonatal microglia derived from wild-type (TREM+ / +) and TREM2"Amice at different time points in culture under limiting conditions of CSF-1. Neonatal TREM2- / -microglia exhibit a survival defect over time.
[0037] Figure 8D is a bar graph of numbers of BMDMs derived from wild-type (TREM+ / +) and TREM2R47Hmice in different days of culture under limiting conditions of CSF-1.TREM2R47Hmouse BMDMs exhibit a survival defect in these culture conditions.
[0038] Figure 8E is a bar graph of percent cell confluence of mouse adult microglia derived from wild-type (TREMf / +) and TREM2R47Hmice at different time points in culture under limiting conditions of CSF-1. TREM2R47Hmouse adult microglia exhibit a survival defect in these culture conditions.
[0039] Figure 8F is a bar graph of percent cell confluence of mouse neonatal microglia derived from wild-type (TREM+ / +) and TREM2R47Hmice at different time points in culture under limiting conditions of CSF-1. Neonatal TREM2R47Hmicroglia exhibit a survival defect that increases over time.
[0040] Figure 9A is a western blot of cell lysates from TREM2R47Hand wild-type (TREM+ / +) BMDMs treated with an anti-TREM2 antibody or an isotype control. The anti-TREM2 antibody activates TREM2 / DAP12 signaling in both types of macrophage as indicated by the increase in pSyk levels.
[0041] Figure 9B is a western blot of cell lysates from TREM2- / -and wild-type (TREM+ / +) BMDMs treated with an anti-TREM2 antibody or an isotype control. The anti-TREM2 antibody does not increase pSyk levels in the TREM2- / -BMDMs confirming that the effect is specific for TREM2.
[0042] Figure 10A is a graph depicting percent cell confluence over time for TREM2R47HBMDMs treated with an isotype control antibody or an anti-TREM2 agonist antibody as measured by a real-time cell confluence assay. Data are plotted as mean + / - s.d. and are from a single representative experiment. The experiment was conducted twice independently (n=2 and assayed in triplicate).
[0043] Figure lOB is a graph depicting percent cell confluence over time for wild-type (TREM2+ / +) BMDMs treated with an isotype control antibody or an anti-TREM2 agonist antibody as measured by a real-time cell confluence assay. Data are plotted as mean + / - s.d. and are from a single representative experiment. The experiment was conducted twice independently (n=2 and assayed in triplicate).
[0044] Figure IOC is a bar graph depicting cell viability as measured by CellTiter Glo ATP detection assay for TREM2R47Hand TREM2+ / -BMDMs treated with vehicle, isotype control, or an anti-TREM2 agonist antibody for 14 days.
[0045] Figure 10D is a bar graph depicting percent cell confluence at particular times in culture for TREM2R47Hadult mouse microglia treated with an isotype control antibody or an anti-TREM2 agonist antibody. An increase in survival of TREM2R47Hmicroglia is observed with anti-TREM2 agonist antibody treatment.
[0046] Figure 10E is a graph depicting percent cell confluence over time for BMDMs harvested from aged (18-month old) wildtype (TREM2+ / +) mice (n=3 animals) treated with an isotype control antibody or an anti-TREM2 agonist antibody of the present invention (henceforth referred to as "Antibody 2") as measured by a real-time cell confluence assay. Data are plotted as mean + / - s.d. and are from a single representative experiment****p<.0001, 2-way ANOVA with Sidak's correction for multiple comparisons. Figure 10F is a graph depicting percent cell confluence over time for BMDMs harvested from aged (18- month old) TREM2R47Hmice (n=3 animals, exception - wild-type age-matched littermatecontrols for day 6 samples in the knockout experiment) treated with an isotype control antibody or an anti-TREM2 agonist antibody (Antibody 2) as measured by a real-time cell confluence assay. Data are plotted as mean + / - s.d. and are from a single representative experiment. ****p<.0001, 2-way ANOVA with Sidak's correction for multiple comparisons. An increase in survival of wildtype and TREM2R47Hmacrophages is observed with anti- TREM2 agonist antibody treatment.
[0047] Figure 11A is a graph depicting percent cell confluence over time in a culture compartment in a migration assay for wild-type (TREM2+ / +) BMDMs treated with an isotype control antibody or an anti-TREM2 agonist antibody (Antibody 1) as measured by a real-time cell confluence assay. The anti-TREM2 agonist antibody had minimal effects on migration of the wild-type BMDMs in this assay.
[0048] Figure 1 IB is a graph depicting percent cell confluence over time in a culture compartment in a migration assay for TREM2R47HBMDMs treated with an isotype control antibody or an anti-TREM2 agonist antibody (Antibody 1) as measured by a real-time cell confluence assay. The anti-TREM2 agonist antibody resulted in a small but statistically significant reduction of migration of the TREM2R47HBMDMs in this assay.
[0049] Figure 11C is a graph depicting percent cell confluence over time in a culture compartment in a migration assay for TREM2- / -BMDMs treated with an isotype control antibody or an anti-TREM2 agonist antibody (Antibody 1) as measured by a real-time cell confluence assay. The anti-TREM2 agonist antibody has no effect on the migration of the TREM2V- BMDMs in this assay.
[0050] Figure 11D and Figure 11E are graphs depicting percent cell confluence over time in a culture compartment in a migration assay for wildtype (TREM2+ / +) and TREM2R47HBMDMs, respectively, treated with an isotype control antibody or an anti-TREM2 agonist antibody (Antibody 2) as measured by a real-time cell confluence assay. The anti-TREM2 agonist antibody treatment has no effect on the migration of the wildtype and TREM2R47HBMDMs in this assay.
[0051] Figure 12A shows the differential regulation of CDC20 transcripts as measured by qPCR in wild-type (TREM2+ / +), TREM2R47H, and TREM2- / -macrophages at day 5 and day 6.
[0052] Figure 12B shows the differential regulation of PKB transcripts as measured by qPCR in wild-type (TREM2+ / +), TREM2R47H, and TREM2- / -macrophages at day 5 and day 6.
[0053] Figure 12C shows the differential regulation of NDC80 transcripts as measured by qPCR in wild-type (TREM2f / +), TREM2R47H, and TREM2- / -macrophages at day 5 and day 6.
[0054] Figure 12D shows the differential regulation of CCR2 transcripts as measured by qPCR in wild-type (TREM2+ / +), TREM2R47H, and TREM2- / -macrophages at day 5 and day 6.
[0055] Figure 13A depicts the differential regulation of ApoE transcripts as measured by qPCR in wild-type (TREM2+ / +), heterozygous (TREM2+ / "), and knockout (TREM2V) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0056] Figure 13B depicts the differential regulation of ApoE transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (TREM2R47H / +), and R47H homozygous (TREM2R47H) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0057] Figure 13C depicts the differential regulation of IL-la transcripts as measured by qPCR in wild-type (TREM2f / +), heterozygous (TREM2+ / -), and knockout (TREM2V) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0058] Figure 13D depicts the differential regulation of IL-la transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (JKEM2R<i7lVi), and R47H homozygous (TREM2R47H) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0059] Figure 13E depicts the differential regulation of CX3CR1 transcripts as measured by qPCR in wild-type (TREM2+ / +)5heterozygous (TREM2+ / -)5and knockout (TREM2- / -) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0060] Figure 13F depicts the differential regulation of CX3CR1 transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (TREM2R47H / +), and R47H homozygous (TREM2R47H) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0061] Figure 13G depicts the differential regulation of FLT1 transcripts as measured by qPCR in wild-type (TREM2+ / +), heterozygous (TREM2+ / "), and knockout (TREM2V) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0062] Figure 13H depicts the differential regulation of FLT1 transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (TREM2R47H / +), and R47H homozygous(TREM2R47H) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0063] Figures 131 and 13 J depict the differential regulation oiClqa transcripts as measured by qPCR in wild-lype (TREM2+ / +), R47H heterozygous (TREM2R47H+ / "), and R47H homozygous (TREM2R47H) macrophages at different time points in culture. All gene expression levels are normalized to wild-lype control macrophages at Day 4 of culture.
[0064] Figures 13K and 13L depict the differential regulation of Ccl5 transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (TREM2R47H+ / "and TREM2f / "), and R47H homozygous (TREM2R47Hand TREM27) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0065] Figures 13M and 13N depict the differential regulation of Ccl22 transcripts as measured by qPCR in wild-type (TREM2+ / +), R47H heterozygous (TREM2R47H+ / "and TREM2+ / "), and R47H homozygous (TREM2R47Hand TREM2r / ") macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0066] Figures 130 and 13P depict the differential regulation of C3 transcripts as measured by qPCR in wild-lype (TREM2+ / +), R47H heterozygous (TREM2R47H+ / " and TREM2+ / "), and R47H homozygous (TREM2R47Hand TREM2- / -) macrophages at different time points in culture. All gene expression levels are normalized to wild-type control macrophages at Day 4 of culture.
[0067] Figure 14A is a graph depicting percent cell confluence over time in a culture compartment in a migration assay for wild-type (TREM2+ / +) and knockout (TREM2- / -) BMDMs as measured by a real-time cell confluence assay. The TREM2 knockout macrophages exhibit a migration defect as compared to wild-type macrophages in this in vitro assay.
[0068] Figure 14B is a graph depicting percent cell confluence over time in a culture compartment in a migration assay for wild-type (TREM2+ / +) and TREM2R47HBMDMs as measured by a real-time cell confluence assay. The TREM2R47Hmacrophages exhibit a migration defect as compared to wild-type macrophages in this in vitro assay.
[0069] Figure ISA shows a reduction in secreted CCL2 protein from TREM2R47Hand TREM2- / -macrophages as compared with wild-type (TREM2+ / +) macrophages as measured by ELISA.
[0070] Figure 15B depicts levels of secreted CCL2 protein as measured by ELIS A from TREM2R47Hand wild-type TREM2+ / +macrophages treated with an anti-TREM2 agonist antibody or isolype control. Anti-TREM2 agonist antibody treatment restores levels of secreted CCL2 protein from TREM2R47Hmacrophages.
[0071] Figure 16A shows the results of the pathway analysis of genes regulated by anti- TREM2 agonist antibody treatment in TREM2R47Hmacrophages. The modulated genes include those involved in regulation of myeloid cell migration, proliferation, cell cycle and survival.
[0072] Figure 16B shows the RNA-Seq analysis comparing wildtype (TREM2+ / +), knockout (TREM2- / -) and TREM2R47Hmacrophages at day 7 under limiting conditions of CSF-1. Pathway analyses (WGCNA) identified 5 modules / gene networks that are differentially regulated in the knockout and TREM2R47Hmacrophages compared to wild-type. The results indicate a role for TREM2 in cell cycle / proliferation and survival, immune response and migration and lipid and cholesterol homeostasis.
[0073] Figure 16C shows the differential regulation of UBE2C, MELK and MMP14 transcripts as measured by qPCR in wild-type (TREM2+ / +) and TREM2R47Hmacrophages treated with an anti-TREM2 agonist antibody (Antibody 1) or isotype control. The data show that expression of the expression of the MMP14 enzyme is upregulated while the expression of the UBE2C and MELK enzymes is downregulated in the R47H macrophages, but the changes can be restored with treatment with the anti-TREM2 agonist antibody.
[0074] Figure 17 shows that antibody treatment increases the expression of homeostatic microglial genes (P2ry 12, Tmeml 19) in WT and R47H KI microglia, WT microglia alone and R47H KI microglia alone (A, B and C). Also antibody treatment reduces the expression pro-inflamamtory chemokines and cytokines such as Ccl3, Ccl4, CclS, 1112b (D, E and F). All statistics are Wilcoxon rank scores. Expression is ln(counts+l).
[0075] Figure 18 shows that the microglia infiltrate population has increased expression of myeloid and inflammatory genes and slightly lower expression of homeostatic microglia genes (A and B), and that the administration of Trem2 antibody decreased the proinflammatory chemokines and cytokines in the infiltrate microglia cells from WT and R47H KI mice, WT only mice and R47HKI only mice (C, D and E). All statistics are Wilcoxon rank scores. Expression is ln(counts+l) adjusted for umi count.DETAILED DESCRIPTION
[0076] The present invention relates to isolated antigen binding proteins that specifically bind to TREM2, particularly human TREM2. In humans, the TREM2 gene is located within a TREM gene cluster at chromosome 6p21.1. The TREM gene cluster encodes four TREM proteins (TREMl, TREM2, TREM4, and TREM5) as well as two TREM-like proteins (TLT- 1 and TLT-2). The TREM2 gene encodes a 230 amino acid protein consisting of an extracellular domain, a transmembrane region, and a short cytoplasmic tail (Paradowska- Gorycka et ah, Human Immunology, Vol. 74: 730-737, 2013). The extracellular domain contains a single type V Ig-super family domain, with three potential N-glycosylation sites. The wild-type human TREM2 amino acid sequence (NCBI Reference Sequence:NP_061838.1) is provided below as SEQ ID NO: 1.1 MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC 60 61 QRWSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT 120121 LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA 180181 CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT 230
[0077] Amino acids 1 to 18 of the wild-type human TREM2 protein (SEQ ID NO: 1) is a signal peptide, which is generally removed from the mature protein. The mature human TREM2 protein comprises an extracellular domain at amino acids 19-174 of SEQ ID NO: 1 , a transmembrane domain at amino acids 175-195 of SEQ ID NO: 1, and a cytoplasmic domain at amino acids 196-230 of SEQ ID NO: 1. The amino acid sequence of the extracellular domain (including the signal peptide) of human TREM2 is provided below as SEQ ID NO: 2.1 MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC 6061 QRWSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT 120121 LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS 174
[0078] The term 'Tiuman triggering receptor expressed on myeloid cells-2" or "human TREM2" can refer to a polypeptide of SEQ ID NO: 1, a polypeptide of SEQ ID NO: 2, polypeptides of SEQ ID NO: 1 or SEQ ID NO: 2 minus the signal peptide (amino acids 1-18), allelic variants of human TREM2, or splice variants of human TREM2. In some embodiments, the term "human TREM2" includes naturally occurring variants of TREM2, such as mutations R47H, Q33X (X is a stop codon), Y38C, T66M, D87N, H157Y, R98W, and S116C.
[0079] Because the cytoplasmic domain of TREM2 lacks signaling capability, it must interact with other proteins to transduce TREM2-activating signals. One such protein is DNAX-activating protein of 12 kDa (DAP 12). DAP12 is also known as killer cell activating receptor-associated protein (KARAP) and tyrosine kinases binding protein (TYROBP). DAP 12 is a type I transmembrane adaptor protein that comprises an ITAM motif in its cytoplasmic domain. The ITAM motif mediates signal propagation by activation of the ZAP70 and Syk tyrosine kinases, which in turn activate several downstream signaling cascades, including P13K, PKC, ERK, and elevation of intracellular calcium (Colonna, Nature Reviews Immunology, Vol. 3: 445-453, 2003; Ulrich and Holtzman, ACS Che Neurosci., Vol. 7: 420-427, 2016). DAP12 and TREM2 associate through theirtransmembrane domains; a charged lysine residue within the transmembrane domain of TREM2 interacts with a charged aspartic acid residue within the transmembrane domain of DAP12.
[0080] Human DAP12 is encoded by the TYROBP gene located on chromosome 19ql3.1. The human protein is 113 amino acids in length and comprises a leader sequence (amino acids 1-27 of SEQ ID NO: 3), a short extracellular domain (amino acids 28-41 of SEQ ID NO: 3), a transmembrane domain (amino acids 42-65 of SEQ ID NO: 3) and a cytoplasmic domain (amino acids 66-113 of SEQ ID NO: 3)(Paradowska-Gorycka et al, HumanImmunology, Vol. 74: 730-737, 2013). DAP12 forms a homodimer through two cysteine residues in the short extracellular domain. The wild-type human DAP12 amino acid sequence (NCBI Reference Sequence: NP_003323.1) is provided below as SEQ ID NO: 3.1 MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALA 6061 VYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYY 113
[0081] The term "human DAP 12" can refer to a polypeptide of SEQ ID NO: 3, a polypeptide of SEQ ID NO: 3 minus the leader peptide (amino acids 1-27), allelic variants of human DAP 12, or splice variants of human DAP 12.
[0082] In some embodiments, the present invention provides isolated antigen binding proteins that specifically bind to human TREM2. As used herein, the term "antigen binding protein" refers to a protein that specifically binds to one or more target antigens. An antigen binding protein typically comprises an antigen-binding fragment that specifically binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen-binding fragment to adopt a conformation that promotes binding of the antigen binding protein to the antigen. An "antigen binding fragment," used interchangeably herein with "binding fragment" or "fragment," is a portion of an antibody that lacks at least some of the amino acids present in a full-length heavy chain and / or light chain, but which is still capable of specifically binding to an antigen. An antigen-binding fragment includes, but is not limited to, a single-chain variable fragment (scFv), a nanobody (e.g. VH domain of camelid heavy chain antibodies; VHH fragment, see Cortez-Retamozo etal., Cancer Research, Vol.64:2853-57, 2004), a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a Fd fragment, and a complementarity determining region (CDR) fragment, and can be derived from any mammalian source, such as human, mouse, rat, rabbit, or camelid. Antigen-binding fragments may compete for binding of a target antigen with an intact antibody and the fragments may be produced by the modification of intact antibodies (e.g. enzymatic or chemical cleavage) or synthesized de novo using recombinant DNA technologies or peptide synthesis. In some embodiments, the antigen-binding fragment comprises at least one CDR from an antibody that binds to the antigen, for example, the heavy chain CDR3 from an antibody that binds to the antigen. In other embodiments, the antigen-binding fragment comprises all three CDRs from the heavy chain of an antibody that binds to the antigen or all three CDRs from the light chain of an antibody that binds to the antigen. In still other embodiments, the antigen-binding fragment comprises all six CDRs from an antibody that binds to the antigen (three from the heavy chain and three from the light chain). In certain embodiments, an antigen binding protein is an antibody or binding fragment thereof.
[0083] An antigen binding protein can also include a protein comprising one or more antigen-binding fragments incorporated into a single polypeptide chain or into multiple polypeptide chains. For instance, antigen binding proteins can include, but are not limited to, a diabody (see, e.g., EP 404,097; WO 93 / 11161; and HoUinger etal, Proc. Natl. Acad. Sci. USA, Vol. 90:6444-6448, 1993); an intrabody; a domain antibody (single VL or VH domain or two or more VH domains joined by a peptide linker; see Ward et al, Nature, Vol.341:544-546, 1989); a maxibody (2 scFvs fused to Fc region, see Fredericks et al, ProteinEngineering, Design & Selection, Vol. 17:95-106, 2004 and Powers etal, Journal of Immunological Methods, Vol. 251:123-135, 2001); atriabody; a tetrabody; a minibody (scFv fused to CH3 domain; see Olafsen et ah, Protein Eng Des Sel. , Vol.17:315-23, 2004); a peptibody (one or more peptides attached to an Fc region, see WO 00 / 24782); a linear antibody (a pair of tandem Fd segments (VH-CHl-VH-CHl) which, together with complementary light chain polypeptides, form a pair of antigen binding regions, see Zzjpate. et al, Protein Eng., Vol. 8: 1057-1062, 1995); a small modular immunopharmaceutical (see U.S. Patent Publication No. 20030133939); and immunoglobulin fusion proteins (e.g. IgG-scFv, IgG-Fab, 2scFv-IgG, 4scFv-lgG, VH-IgG, IgG-VH, and Fab-scFv-Fc; see, e.g., Spiess etal, Mol. Immunol., Vol. 67(2 Pt A):95-106, 2015).
[0084] The term "isolated molecule" (where the molecule is, for example, a polypeptide, a polynucleotide, antigen binding protein or an antibody) is a molecule that by virtue of its origin or source of derivation (1) is not associated with naturally associated components that accompany it in its native state, (2) is substantially free of other molecules from the same species (3) is expressed by a cell from a different species, or (4) does not occur in nature. Thus, a molecule that is chemically synthesized, or expressed in a cellular system different from the cell from which it naturally originates, will be "isolated" from its naturally associated components. A molecule also may be rendered substantially free of naturally associated components by isolation, using purification techniques well known in the art. Molecule purity or homogeneity may be assayed by a number of means well known in the art. For example, the purity of a polypeptide sample may be assayed using poly aery lamide gel electrophoresis and staining of the gel to visualize the polypeptide using techniques well known in the art. For certain purposes, higher resolution may be provided by using HPLC or other means well known in the art for purification.
[0085] In certain embodiments of the invention, the antigen binding proteins specifically bind to human TREM2. An antigen binding protein "specifically binds" to a target antigen when it has a significantly higher binding affinity for, and consequently is capable of distinguishing, that antigen compared to its affinity for other unrelated proteins, under similar binding assay conditions. Antigen binding proteins that specifically bind an antigen may have an equilibrium dissociation constant (KD) < 1 X 10"6M. The antigen binding protein specifically binds antigen with "high affinity" when the KD is < 1 x 10" M. In one embodiment, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 5 x 10"7M. In another embodiment, the antigen binding proteins of the invention bind to human TREM2with a KD of < 1 x 10"7M. In yet another embodiment, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 5 x 10"8M. In another embodiment, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 1 x 10" M. In certain embodiments, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 5 x 10"9M. In other embodiments, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 1 x 10"9M. In one particular embodiment, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 5 x 10"10M. In another particular embodiment, the antigen binding proteins of the invention bind to human TREM2 with a KD of < 1 x 10"10M.
[0086] Affinity is determined using a variety of techniques, an example of which is an affinity ELISA assay. In various embodiments, affinity is determined by a surface plasmon resonance assay (e.g., BIAcore®-based assay). Using this methodology, the association rate constant (ka in M'V1) and the dissociation rate constant (kd in s"1) can be measured. The equilibrium dissociation constant (KD in M) can then be calculated from the ratio of the kinetic rate constants (kd / ka). In some embodiments, affinity is determined by a kinetic method, such as a Kinetic Exclusion Assay (KinExA) as described in Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008. Using a KinExA assay, the equilibrium dissociation constant (KD in M) and the association rate constant (ka in M'V1) can be measured. The dissociation rate constant (kd in s"1) can be calculated from these values (KD X ka). In other embodiments, affinity is determined by a bio-layer interferometry method, such as that described in Kumaraswamy etal, Methods Mol. Biol., Vol. 1278:165-82, 2015 and employed in Octet®systems (Pall ForteBio). The kinetic (ka and kd) and affinity (KD) constants can be calculated in real-time using the bio-layer interferometry method. In some embodiments, the antigen binding proteins described herein exhibit desirable characteristics such as binding avidity as measured by kd (dissociation rate constant) for human TREM2 of about 10"2, 10"3, 10"*, 10"5, 10"6s"1or lower (lower values indicating higher binding avidity), and / or binding affinity as measured by KD (equilibrium dissociation constant) for human TREM2 of about 10"8, 10"9, 10"10, 10"11M or lower (lower values indicating higher binding affinity).
[0087] In certain embodiments, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD from about 1 pM to about 100 nM as measured by bio- layer interferometry at 25° C. For instance, in some embodiments, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 100 nM asmeasured by bio-layer interferometry at 25° C. In other embodiments, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 50 nM as measured by bio-layer interferometry at 25° C. In yet other embodiments, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 25 nM as measured by bio-layer interferometry at 25° C. In one particular embodiment, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 10 nM as measured by bio-layer interferometry at 25° C. In another particular embodiment, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 5 nM as measured by bio-layer interferometry at 25° C. In another particular embodiment, the antigen binding proteins of the invention specifically bind to human TREM2 with a KD less than 1 nM as measured by bio-layer interferometry at 25° C.
[0088] The antigen binding proteins of the invention may, in some embodiments, bind to a particular region or epitope of human TREM2. As used herein, an "epitope" refers to any determinant capable of being specifically bound by an antigen binding protein, such as an antibody or fragment thereof. An epitope is a region of an antigen that is bound by, or interacts with, an antigen binding protein that targets that antigen, and when the antigen is a protein, includes specific amino acids that directly contact, or interact with, the antigen binding protein. An epitope can be formed both by contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. A "linear epitope" is an epitope where an amino acid primary sequence comprises the recognized epitope. A linear epitope typically includes at least 3 or 4 amino acids, and more usually, at least 5, at least 6, or at least 7 amino acids, for example, about 8 to about 10 amino acids in a unique sequence. A "conformational epitope", in contrast to a linear epitope, is a group of d scontinuous amino acids (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein). Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoiyl or sulfonyl groups, and can have specific three dimensional structural characteristics, and / or specific charge characteristics. Generally, antigen binding proteins specific for a particular target molecule will preferentially recognize an epitope on the target molecule in a complex mixture of proteins and / or macromolecules. In some embodiments, the antigen binding proteins bind to human TREM2 at an epitope within the extracellular domain of human TREM2 (SEQ ID NO: 2). In related embodiments, theantigen binding proteins bind to human TREM2 at an epitope within amino acids 19-174 of SEQ ID NO: 1. In certain embodiments, the antigen binding proteins bind to human TREM2 at an epitope within amino acids 23-128 of SEQ ID NO: 1.
[0089] In certain embodiments, the antigen binding proteins of the invention do not specifically bind to human TREM1. Like TREM2, TREM1 is a transmembrane glycoprotein that is expressed on myeloid cells and signals through DAP12. Activation of TREM1 signaling results in inflammatory effects, such as pro-inflammatory cytokine production, degranulation of neutrophils, and phagocytosis (Arts et al, Journal of Leukocyte Biology, Vol. 93: 209-215, 2013). As discussed above, TREM1 is encoded by the TREM1 gene, which is located in the TREM gene cluster along with the TREM2 gene at chromosome 6p21.1. The wild-type human TREM1 amino acid sequence (NCBI Reference Sequence: NP 061113.1) is provided below as SEQ ID NO: 4.1 MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD 6061 GEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK 120121 EPHMLFDRIRLWTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKST 180181 ADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP 234
[0090] The term "human TREM1" can refer to a polypeptide of SEQ ID NO: 4, a polypeptide of SEQ ID NO: 4 minus the signal peptide (amino acids 1-20), allelic variants of human TREMl, or splice variants of human TREMl. An antigen binding protein of the invention "does not specifically bind" to human TREMl if it has an equivalent or lower binding affinity for human TREMl as it does for an unrelated human antigen protein.Antigen binding proteins that do not specifically bind to human TREMl may have a KD for human TREMl > 1 x 10"sM, > 1 x 10"4M, or >1 x lO'3M as determined by any of the methods for measuring affinity as described herein. An antigen binding protein of the invention may be considered to not specifically bind human TREMl if the antigen binding protein has equivalent or lower binding to human TREMl as compared to the binding to human TREMl of an isotype control antibody as measured by any method known in the art, such as the FACS binding method described in Example 2.
[0091] In certain embodiments, the antigen binding proteins of the invention are agonist antigen binding proteins. An "agonist antigen binding protein" or "activating antigen binding protein" is an antigen binding protein (e.g. an antibody) that binds to and induces or increases one or more TREM2-mediated functions or activities. TREM2-mediated functions or activities include, but are not limited to, DAP 12 phosphorylation (e.g. tyrosinephosphorylation within the ITAM motif within the DAP 12 cytoplasmic domain); Syk phosphorylation; Src phosphorylation / activation; activation / phosphorylation of extracellular regulated kinase (ERK1 / 2); translocation of activated phosphatidylinositol 3-kinase (PI3K) to the membrane; activation of protein kinase B (PKB, also known as Akt); activation of NF-KB and NF-KB-mediated transcription; activation of nuclear factor of activated T-cells (NFAT)- mediated transcription; activation of protein kinase C (PKC); elevation of intracellular inositol (l,4,5)-triphosphate (IP3); elevation of intracellular calcium levels; increase in survival or proliferation of myeloid cells, such as macrophages, microglia, and dendritic cells; reduction of apoptosis of myeloid cells, such as macrophages, microglia, and dendritic cells; increase in CCL2 protein expression in macrophages; reduction of inflammatory cytokine (e.g. TNF-α, IL-6, IL-10, IL-12p70, and IFN-γ) production from myeloid cells (e.g. macrophages), and increase in phagocytosis by macrophages and microglia of necrotic and / or apoptotic cells (e.g. neuronal cells), cellular debris, and misfolded peptides.
[0092] The agonist TREM2 antigen binding proteins of the invention are capable of inducing or activating TREM2-mediated functions in the absence of aggregation, clustering, and / or Fc- mediated cross-linking of the antigen binding proteins. Accordingly, in vitro, the agonist activity of the antigen binding proteins can be detected with soluble (i.e. not bound to a solid support), monomeric, bivalent forms of the antigen binding proteins or antibodies. In vivo, the agonist activity of the antigen binding proteins of the invention can occur in the absence of the antigen binding proteins binding to receptors (e.g. Fc receptors) on adjacent cells to cluster or aggregate the antigen binding protein. Thus, in some embodiments, the agonist activity of the antigen binding proteins described herein is independent of the ability of the antigen binding proteins to bind to or interact with Fc receptors. In embodiments in which the antigen binding proteins comprise an Fc region (e.g. antibodies), the antigen binding proteins retain TREM2 agonist activity without binding or interacting with an Fey receptor, such as the FcyRIIB receptor. The cross-linking independent nature of the agonist antigen binding proteins of the invention is advantageous for therapeutic uses of the antigen binding proteinsbecause the agonist activity of the antigen binding proteins will not vary with the Fey receptor expression or accessibility at the therapeutic site of action.
[0093] The dependence of TREM2 agonist activity on cross-linking, aggregation, and / or clustering of the antigen binding proteins can be assessed by measuring activation or induction of any of the TREM2-mediated functions described herein in the absence of a cross-linking agent. A cross-linking agent can be any agent that interacts with antigen binding proteins at a site other than the antigen-binding site to cluster two or more antigen binding proteins together. In embodiments in which the antigen-binding protein comprises an Fc region (e.g. an antibody), a cross-linking agent can be a protein that binds to or interacts with the Fc region, such as protein A, protein G, an anti-Fc antibody, or Fey receptor.
[0094] In some embodiments, a TREM2 agonist antigen binding protein of the invention increases levels of phosphorylated Syk (pSyk) in cells expressing a TREM2 protein (e.g. a human TREM2 protein) relative to pSyk levels in the absence of the antigen binding protein or relative to pSyk levels in the presence of a control. The cells can be cells of a myeloid linage including, but not limited to, monocytes, macrophages, microglial cells, dendritic cells, osteoclasts, neutrophils, basophils, eosinophils, megakaryocytes, and platelets. In certain embodiments, the TREM2 agonist antigen binding proteins increase pSyk levels with an ECS0 less than about 100 nM, less than about 80 nM, less than about 60 nM, less than about 50 nM, less than about 40 nM, less than about 30 nM, less than about 20 nM, less than about 10 nM, less than about 5 nM, less than about 1 nM, less than about 500 pM, less than about 300 pM, or less than about 100 pM. In some embodiments, the TREM2 agonist antigen binding proteins increase pSyk levels with an EC50 from about 1 pm to about 100 nM, from about 10 pM to about 50 nM, from about 50 pM to about 5 nM, from about 100 pM to about 1 nM, or from about 150 pM to about 500 pM. An "EC50" or '¾alf maximal effective concentration" is a measure of potency of the antigen binding protein and refers to the concentration of antigen binding protein required to induce a response halfway between baseline and maximal response after a particular exposure period. The EC50 of any particular agonist can be determined by constructing a dose-response curve and examining the effect of different concentrations of the agonist in inducing activity in a particular functional assay (e.g. pSyk levels). The EC50 is the concentration of the agonist at which 50% of its maximal effect is observed. Increases in intracellular pSyk levels induced by the TREM2 agonist antigen binding proteins of the invention can be assessed by various methods, such as the cell-based assays described in Examples 2 and 6. For instance, cells expressing TREM2 (e.g.human TREM2) are contacted with one or more concentrations of an agonist antigen binding protein, the cells are lysed, and pSyk levels in the cell lysates are assessed, for example by Western blot, FRET-based assay or chemiluminescent assay (e.g. AlphaLISA-based assay). The cells in the cell-based assay may be cells, such as HEK293T cells or CHO cells, which recombinantly express TREM2 (e.g. human TREM2). Alternatively, the cells in the cell- based assay are cells that natively express TREM2 (e.g. human TREM2), such as THP-1 cells, macrophage, microglial cells, or dendritic cells.
[0095] In certain embodiments, the potency of the TREM2 agonist antigen binding proteins for inducing or increasing pSyk levels in a cell expressing TREM2 (e.g. human TREM2) is retained in the absence of a cross-linking agent. For instance, in some embodiments, the TREM2 agonist antigen binding proteins of the invention increase pSyk levels with an EC50 from about 1 pM to about 100 nM, from about 10 pM to about 50 nM, from about 50 pM to about 5 nM, from about 100 pM to about 1 nM, or from about 150 pM to about 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In one embodiment, the TREM2 agonist antigen binding protein increases pSyk levels with an EC50 less than 5 nM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In another embodiment, the TREM2 agonist antigen binding protein increases pSyk levels with an EC50 less than 1 nM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In another embodiment, the TREM2 agonist antigen binding protein increases pSyk levels with an EC50 less than 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In still another embodiment, the TREM2 agonist antigen binding protein increases pSyk levels with an EC50 less than 300 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay. In yet another embodiment, the TREM2 agonist antigen binding protein increases pSyk levels with an EC50 less than 100 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay.
[0096] The TREM2 agonist antigen binding proteins of the invention may comprise one or more complementarity determining regions (CDRs) from the light and heavy chain variable regions of antibodies that specifically bind to human TREM2 as described herein. The term "CDR" refers to the complementarity determining region (also termed "minimal recognition units" or "hypervariable region") within antibody variable sequences. There are three heavy chain variable region CDRs (CDRHl, CDRH2 and CDRH3) and three light chain variable region CDRs (CDRL1, CDRL2 and CDRL3). The term "CDR region" as used herein refers to a group of three CDRs that occur in a single variable region (i.e. the three light chainCDRs or the three heavy chain CDRs). The CDRs in each of the two chains typically are aligned by H e framework regions (FRs) to form a structure that binds specifically with a specific epitope or domain on the target protein (e.g., human TREM2). FromN-terminus to C-terminus, naturally -occurring light and heavy chain variable regions both typically conform with the following order of these elements: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. A numbering system has been devised for assigning numbers to amino acids that occupy positions in each of these domains. This numbering system is defined in Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD), or Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothiaer a / ., 1989, Nature 342:878-883. Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody may be identified using this system. Other numbering systems for the amino acids in immunoglobulin chains include IMGT®(the international ImMunoGeneTics information system; Lefranc etal, Dev. Comp. Immunol. 29:185-203; 2005) and AHo (Honegger and Pluckthun, J. Mol. Biol. 309(3):657-670; 2001). One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
[0097] In some embodiments, an antigen binding protein of the invention may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate Hie CDR(s) noncovalently. The antigen binding proteins may comprise at least one of the CDRs described herein incorporated into a biocompatible framework structure. In one example, the biocompatible framework structure comprises a polypeptide or portion thereof that is sufficient to form a conformationally stable structural support, or framework, or scaffold, which is able to display one or more sequences of amino acids that bind to an antigen (e.g., CDRs, a variable region, etc.) in a localized surface region. Such structures can be a naturally occurring polypeptide or polypeptide 'Told" (a structural motif), or can have one or more modifications, such as additions, deletions or substitutions of amino acids, relative to a naturally occurring polypeptide or fold. These scaffolds can be derived from a polypeptide of any species (or of more than one species), such as a human, other mammal, other vertebrate, invertebrate, plant, bacteria or virus.
[0098] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise at least one light chain variable region comprising a CDRLl, CDRL2, and CDRL3, and at least one heavy chain variable region comprising a CDRHl, CDRH2, and CDRH3 from an anti-TREM2 agonist antibody described herein. Light chain and heavy chain variableregions and associated CDRs of exemplary human anti-TREM2 antibodies are set forth below in Tables 1 A and IB, respectively.Table 1A. Exemplary Anti-Human TREM2 Antibody Light Chain Variable Region Amino Acid SequencesTable IB. Exemplary Anti-Human TREM2 Antibody Heavy Chain Variable Region Amino Acid Se uences
[0099] The TREM2 agonist antigen binding proteins of the invention may comprise one or more of the CDRs presented in Table 1A (light chain CDRs; i.e. CDRLs) and Table IB (heavy chain CDRs, i.e. CDRHs). For instance, in certain embodiments, the TREM2 agonist antigen binding proteins comprise one or more light chain CDRs selected from (i) a CDRL1 selected from SEQ ID NOs: 5 to 18, (ii) a CDRL2 selected from SEQ ID NOs: 19 to 30, and (iii) a CDRL3 selected from SEQ ID NOs: 31 to 45, and (iv) a CDRL of (i), (ii) and (iii) that contains one or more, e.g., one, two, three, four or more amino acid substitutions (e.g., conserv ative amino acid substitutions), deletions or insertions of no more than five, four, three, two, or one amino acids. In these and other embodiments, the TREM2 agonist antigen binding proteins comprise one or more heavy chain CDRs selected from (i) a CDRH1 selected from SEQ ID NOs: 77 to 86, (ii) a CDRH2 selected from SEQ ID NOs: 87 to 94, and (iii) a CDRH3 selected from SEQ ID NOs: 95 to 109, and (iv) a CDRH of (i), (ii) and (iii) that contains one or more, e.g., one, two, three, four or more amino acid substitutions (e.g., conservative amino acid substitutions), deletions or insertions of no more than five, four, three, two, or one amino acids amino acids.
[0100] In certain embodiments, the TREM2 agonist antigen binding proteins may comprise 1, 2, 3, 4, 5, or 6 variant forms of the CDRs listed in Tables 1 A and IB, each having at least 80%, 85%, 90% or 95% sequence identity to a CDR sequence listed in Tables 1 A and IB. In some embodiments, the TREM2 agonist antigen binding proteins include 1, 2, 3, 4, 5, or 6 of the CDRs listed in Tables 1 A and IB, each differing by no more than 1, 2, 3, 4 or 5 amino acids from the CDRs listed in these tables. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a CDRL1 comprising a sequence selected from SEQ ID NOs: 5-18 or a variant thereof having one, two, three or four amino acid substitutions; a CDRL2 comprising a sequence selected from SEQ ID NOs: 19-30 or a variant thereof having one, two, three or four amino acid substitutions; a CDRL3 comprisinga sequence selected from SEQ ID NOs: 31-45 or a variant thereof having one, two, three or four amino acid substitutions; a CDRH1 comprising a sequence selected from SEQ ID NOs: 77-86 or a variant thereof having one, two, three or four amino acid substitutions; a CDRH2 comprising a sequence selected from SEQ ID NOs: 87-94 or a variant thereof having one, two, three or four amino acid substitutions; and a CDRH3 comprising a sequence selected from SEQ ID NOs: 95-109 or a variant thereof having one, two, three or four amino acid substitutions. In other embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a CDRL1 comprising a sequence selected from SEQ ID NOs: 5-18; a CDRL2 comprising a sequence selected from SEQ ID NOs: 19-30; a CDRL3 comprising a sequence selected from SEQ ID NOs: 31-45; a CDRH1 comprising a sequence selected from SEQ ID NOs: 77-86; a CDRH2 comprising a sequence selected from SEQ ID NOs: 87-94; and a CDRH3 comprising a sequence selected from SEQ ID NOs: 95-109.
[0101] In particular embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRL1, a CDRL2, and a CDRL3, wherein: (a) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 5, 19, and 31, respectively; (b) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 20, and 32, respectively; (c) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 21, and 33, respectively; (d) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 20, and 33, respectively; (e) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 7, 22, and 34, respectively; (f) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 8, 22, and 35, respectively; (g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 9, 22, and 36, respectively; (h) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 10, 23, and 37, respectively; (i) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 11, 23, and 38, respectively; (j) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 12, 24, and 39, respectively; (k) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 13, 25, and 40, respectively; 0) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 14, 26, and 41, respectively; (m) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 15, 27, and 42, respectively; (n) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively; (o) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 17, 29, and 44, respectively, or (p) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 18, 30, and 45, respectively.
[0102] In other particular embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain variable region comprising a CDRH1, a CDRH2, and a CDRH3, wherein: (a) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 87, and 95, respectively; (b) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 88, and 96, respectively; (c) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 88, and 97, respectively; (d) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 89, and 96, respectively; (e) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 90, and 98, respectively; (f) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 79, 90, and 99, respectively; (g) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 80, 91, and 100, respectively; (h) CDRHl , CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 101 , respectively; (i) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 82, 92, and 102, respectively; 0) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 103, respectively; (k) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 104, respectively; (1) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 83, 93, and 105, respectively; (m) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 84, 91, and 106, respectively; (n) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively; (o) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 86, 94, and 108, respectively; or (p) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 109, respectively.
[0103] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRL1, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein:(a) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 5, 19, and 31, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 87, and 95, respectively;(b) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 20, and 32, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 88, and 96, respectively;(c) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 21, and 33, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 88, and 97, respectively;(d) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 20, and 33, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 88, and 97, respectively;(e) CDRL1 , CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 6, 20, and 33, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 78, 89, and 96, respectively;(f) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 7, 22, and 34, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 87, and 95, respectively;(g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 8, 22, and 35, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 90, and 98, respectively;(h) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 9, 22, and 36, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 79, 90, and 99, respectively;(i) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 10, 23, and 37, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 80, 91, and 100, respectively;(j) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 10, 23, and 37, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 101, respectively;(k) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 11, 23, and 38, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 82, 92, and 102, respectively;0) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 12, 24, and 39, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 103, respectively;(m) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 13, 25, and 40, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 104, respectively;(n) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 14, 26, and 41, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 83, 93, and 105, respectively;(o) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 15, 27, and 42, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 84, 91, and 106, respectively;(p) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively;(q) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 17, 29, and 44, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 86, 94, and 108, respectively; or(r) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 18, 30, and 45, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 109, respectively.
[0104] In one embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a CDRLl , a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 10, 23, and 37, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 80, 91, and 100, respectively. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 10, 23, and 37, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 81, 91, and 101, respectively. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 15, 27, and 42, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 84, 91, and 106, respectively. In still another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively. In one particular embodiment, the TREM2 agonist antigen binding protein comprises a lightchain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 17, 29, and 44, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 86, 94, and 108, respectively. In another particular embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRH1, a CDRH2, and a CDRH3, wherein CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 8, 22, and 35, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 77, 90, and 98, respectively.
[0105] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise an immunoglobulin heavy chain variable region (VH) and an immunoglobulin light chain variable region (VL) from an antibody that specifically binds to human TREM2, such as the antibodies described herein. The "variable region," used interchangeably herein with "variable domain" (variable region of a light chain (VL), variable region of a heavy chain (VH)), refers to the region in each of the light and heavy immunoglobulin chains which is involved directly in binding the antibody to the antigen. As discussed above, the regions of variable light and heavy chains have the same general structure and each region comprises four framework (FR) regions, the sequences of which are widely conserved, connected by three CDRs. The framework regions adopt a beta-sheet conformation and the CDRs may form loops connecting the beta-sheet structure. The CDRs in each chain are held in their three-dimensional structure by the framework regions and form, together with the CDRs from the other chain, the antigen binding site.
[0106] In some embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise a light chain variable region selected from LV-01, LV-02, LV-03, LV-04, LV- 05, LV-06, LV-07, LV-08, LV-09, LV-10, LV-11, LV-12, LV-13, LV-14, LV-15, LV-16, LV-17, and LV-18, as shown in Table 1A, and / or a heavy chain variable region selected from HV-01, HV-02, HV-03, HV-04, HV-05, HV-06, HV-07, HV-08, HV-09, HV-10, HV- 1 1, HV-12, HV-13, HV-14, HV-15, HV-16, and HV-17, as shown in Table IB, and functional fragments, derivatives, muteins and variants of these light chain and heavy chain variable regions.
[0107] Each of the light chain variable regions listed in Table 1 A may be combined with any of the heavy chain variable regions listed in Table IB to form an anti-TREM2 binding domain of the antigen binding proteins of the invention. Examples of such combinationsinclude, but are not limited to: LV-01 (SEQ ID NO: 46) and HV-01 (SEQ ID NO: 110); LV- 02 (SEQ ID NO: 47) and HV-02 (SEQ ID NO: 111); LV-03 (SEQ ID NO: 48) and HV-03 (SEQ ID NO: 112); LV-04 (SEQ ID NO: 49) and HV-04 (SEQ ID NO: 113); LV-05 (SEQ ED NO: 50) and HV-05 (SEQ ID NO: 114); LV-06 (SEQ ID NO: 51) and HV-01 (SEQ ID NO: 110); LV-07 (SEQ ID NO: 52) and HV-06 (SEQ ID NO: 115); LV-08 (SEQ ID NO: 53) and HV-07 (SEQ ID NO: 116); LV-09 (SEQ ID NO: 54) and HV-08 (SEQ ID NO: 117); LV- 10 (SEQ ID NO: 55) and HV-09 (SEQ ID NO: 118); LV-11 (SEQ ID NO: 56) and HV-10 (SEQ ID NO: 119); LV-12 (SEQ ID NO: 57) and HV-11 (SEQ ID NO: 120); LV-13 (SEQ ID NO: 58) and HV-12 (SEQ ID NO: 121); LV-14 (SEQ ID NO: 59) and HV-13 (SEQ ID NO: 122); LV-15 (SEQ ID NO: 60) and HV-14 (SEQ ID NO: 123); LV-16 (SEQ ID NO: 61) and HV-15 (SEQ ID NO: 124); LV-17 (SEQ ID NO: 62) and HV-16 (SEQ ID NO: 125); and LV-18 (SEQ JD NO: 63) and HV-17 (SEQ ID NO: 126).
[0108] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-09 (SEQ ID NO: 54) and a heavy chain variable region comprising the sequence of HV-08 (SEQ ID NO: 117). In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-10 (SEQ ID NO: 55) and a heavy chain variable region comprising the sequence of HV-09 (SEQ ID NO: 118). In other embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-15 (SEQ ID NO: 60) and a heavy chain variable region comprising the sequence of HV-14 (SEQ ID NO: 123). In still other embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-16 (SEQ ID NO: 61) and a heavy chain variable region comprising the sequence of HV-15 (SEQ ID NO: 124). In someembodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-17 (SEQ ID NO: 62) and a heavy chain variable region comprising the sequence of HV-16 (SEQ ID NO: 125). In certainembodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the sequence of LV-07 (SEQ ID NO: 52) and a heavy chain variable region comprising the sequence of HV-06 (SEQ ID NO: 115).
[0109] In some embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising a sequence of contiguous amino acids that differs from the sequence of a light chain variable region in Table 1 A, i.e. a VL selected from LV-01, LV-02,LV-03, LV-04, LV-05, LV-06, LV-07, LV-08, LV-09, LV-10, LV-11, LV-12, LV-13, LV- 14, LV-15, LV-16, LV-17, or LV-18, at only 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acid residues, wherein each such sequence difference is independently either a deletion, insertion or substitution of one amino acid, with the deletions, insertions and / or substitutions resulting in no more than IS amino acid changes relative to the foregoing variable domain sequences. The light chain variable region in some TREM2 agonist antigen binding proteins comprises a sequence of amino acids that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the amino acid sequences of SEQ ID NOs: 46-63 (i.e. the light chain variable regions in Table 1 A). In one embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 46-63. In another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 46-63. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence selected from SEQ ID NOs: 46-63. In some embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 54. In other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 55. In yet other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 60. In still other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 61. In certain embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 62. In other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising a sequence of SEQ ID NO: 52.
[0110] In these and other embodiments, the TREM2 agonist antigen binding proteins comprise a heavy chain variable region comprising a sequence of contiguous amino acids that differs from the sequence of a heavy chain variable region in Table IB, i.e., a VH selected from HV-01, HV-02, HV-03, HV-04, HV-05, HV-06, HV-07, HV-08, HV-09, HV-10, HV- 11, HV-12, HV-13, HV-14, HV-15, HV-16, or HV-17, at only 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acid residues, wherein each such sequence difference is independently either a deletion, insertion or substitution of one amino acid, with the deletions, insertionsand / or substitutions resulting in no more than 15 amino acid changes relative to the foregoing variable domain sequences. The heavy chain variable region in some TREM2 agonist antigen binding proteins comprises a sequence of amino acids that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity to the amino acid sequences of SEQ ID NOs: 110-126 (i.e. the heavy chain variable regions in Table IB). In one embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 110-126. In another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 110-126. In yet another embodiment, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence selected from SEQ ID NOs: 110-126. In some embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 117. In other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 118. In yet other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 123. In still other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 124. In certain embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 125. In other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising a sequence of SEQ ID NO: 115.
[0111] The term "identity," as used herein, refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity," as used herein, means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) must be addressed by a particular mathematical model or computer program (i.e., an "algorithm"). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A. M., ed.), 1988, New York: Oxford University Press;Biocomputing Informatics and Genome Projects, (Smilh, D. W., ed.), 1993, New York:Academic Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M, and Griffin, H. G., eds.), 1994, New Jersey: Humana Press; von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press; Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds.), 1991, New York: M. Stockton Press; and Carillo et al., 1988, SIAM J. Applied Math. 48:1073. For example, sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as BLAST or FAST A, two polypeptide or two polynucleotide sequences are aligned for optimal matching of their respective residues (either along the full length of one or both sequences, or along a pre-determined portion of one or both sequences). The programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 (Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3, 1978) or BLOSUM62 (Henikoff et al., 1992, Proc. Natl. Acad. Sci. U.S.A. 89:10915-10919) can be used in conjunction with the computer program. For example, the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the longer sequences in order to align the two sequences. In calculating percent identity, the sequences being compared are aligned in a way that gives the largest match between the sequences.
[0112] The GCG program package is a computer program that can be used to determine percent identity, which package includes GAP (Devereux et al., 1984, Nucl. Acid Res.12:387; Genetics Computer Group, University of Wisconsin, Madison, WI). The computer algorithm GAP is used to align the two polypeptides or two polynucleotides for which the percent sequence identity is to be determined. The sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm). A gap opening penalty (which is calculated as 3x the average diagonal, wherein the "average diagonal" is the average of the diagonal of the comparison matrix being used; the "diagonal" is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1 / 10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm. In certain embodiments, a standard comparison matrix (see, Dayhoff et al., 1978, Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al., 1992, Proc. Natl. Acad. Sci. U.S.A. 89: 10915- 10919 for the BLOSUM 62 comparison matrix) is also used by the algorithm.
[0113] Recommended parameters for determining percent identity for polypeptides or nucleotide sequences using the GAP program include the following:Algorithm: Needleman et al., 1970, J. Mol. Biol. 48:443-453;Comparison matrix: BLOSUM 62 from Henikoff et al., 1992, supra;Gap Penalty: 12 (but with no penalty for end gaps)Gap Length Penalty: 4Threshold of Similarity: 0
[0114] Certain alignment schemes for aligning two amino acid sequences may result in matching of only a short region of the two sequences, and this small aligned region may have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, the selected alignment method (GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
[0115] Variants of the anti-TREM2 antibodies described herein can be generated by substituting one or more amino acids in the light chain or heavy chain variable regions to address chemical liabilities (e.g. aspartate isomerization, asparagine deamidation, tryptophan and methionine oxidation) or correct covariance violations (see WO 2012 / 125495, which is hereby incorporated by reference in its entirety) as described in Example 7. Such variants can have improved biophysical, expression, and or stability properties as compared with the parental antibody. Thus, in some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and or heavy chain variable region having one or more of the amino acid substitutions set forth in any of Tables 13-18.
[0116] Unless indicated otherwise by reference to a specific sequence, throughout the present specification and claims, the numbering of the amino acid residues in an immunoglobulin heavy chain or light chain is according to Kabat-EU numbering as described in Kabat el al, Sequences of Proteins of Immunological Interest, 5th Ed., US Department of Health and Human Services, NIH publication No. 91-3242, pp 662,680,689 (1991) and Edelman et al, Proc. Natl. Acad. USA, Vol. 63: 78-85 (1969). The Kabat numbering scheme is typically used when referring to the position of an amino acid within the variable regions, whereas the EU numbering scheme is generally used when referring to the position of an amino acid with an immunoglobulin constant region. A chart summarizing correspondence between Kabat and EU numbering schemes with other numbering schemes is available on the IMGT®website (the international ImMunoGeneTics information system).
[0117] An amino acid substitution in an amino acid sequence is typically designated herein with a one-letter abbreviation for H e amino acid residue in a particular position, followed by the numerical amino acid position relative to an original sequence of interest, which is then followed by the one-letter abbreviation for the amino acid residue substituted in. For example, ' 30D" symbolizes a substitution of a threonine residue by an aspartate residue at amino acid position 30, relative to the original sequence of interest. Another example, "S218G" symbolizes a substitution of a serine residue by a glycine residue at amino acid position 218, relative to the original amino acid sequence of interest.
[0118] In some embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 54 with a mutation at one or more amino acid positions 64, 79, 80, 85, 94, and / or 100. Such mutations can include V64G, V64A, Q79E, Q79D, S80P, S80A, F85V, F85L, F85A, F85D, F85I, F85L, F85M, F85T, W94F, W94Y, W94S, W94T, W94A, W94H, W94I, W94Q, P100R, P100Q, P100G, or combinations thereof. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 117 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104. In certain embodiments, the mutation is selected from M19K, M19R, M19T, M19E, M19N, M19Q, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y, W104T, W104S, W104A, W104H, W104I, W104Q, or combinations thereof.
[0119] In other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 55 with a mutation at one or more amino acid positions 64, 79, 80, 94, and / or 100. In some embodiments, the mutation is selected from V64G, V64A, Q79E, Q79D, S80P, S80A, W94F, W94Y, W94S, W94T, W94A, W94H, W94I, W94Q, P100R, P100Q, P100G, or combinations thereof. In certain embodiments, the mutation is selected from V64G, V64A, Q79E, S80P, S80A, W94Y, W94S, P100R, P100Q, or combinations thereof. For instance, in some embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 55 with one or more mutations selected from V64G, Q79E, S80P, W94Y, and P100Q. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 118 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104. Such mutations can include M19K, M19R, M19T, M19E, M19N, M19Q, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y,W104T, W104S, W104A, W104H, W104I, W104Q, or combinations thereof. In certain embodiments, the mutation is selected from M19K, D55E, S56A, D57E, T58A, W104Y, W104T, or combinations thereof.
[0120] In certain other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 60 with a mutation at one or more amino acid positions 60, 92, and / or 93. The mutation can be selected from L60S, L60P, L60D, L60A, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 123 with a mutation at one or more amino acid positions 27, 55, 56, 57, 58, 105, and / or 106. In some embodiments, the mutation is selected from H27Y, H27D, H27F, H27N, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, S106V, S106T, or combinations thereof.
[0121] In some embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 with a mutation at one or more amino acid positions 56, 57, 92, and / or 93. In certain embodiments, the mutation is selected fromN56S, N56T, N56Q, N56E, G57A, G57V, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof. In some embodiments, the mutation is selected fromN56S, N56Q, G57A, D92E, D92Q, S93A, or combinations thereof. In particular embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 with one or more mutations selected from N56S, D92E, and S93A. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 124 with a mutation at one or more amino acid positions 55, 56, 57, 58, 105, and / or 106. The mutation can be selected from D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, S106V, S106T, or combinations thereof. In certain embodiments, the mutation is D55E, D55Q, S56A, D57E, T58A, D105E, D105N, S106A, or combinations thereof. In some embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 124 with one or more mutations selected from D55E, S56A, D57E, D105E, and S106A.
[0122] In other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 62 with a mutation at aminoacid position 36, 46, 61 and / or 100. In particular embodiments, the mutation is selected from F36Y, S46L, S46R, S46V, S46F, K61R, P100Q, P100G, P100R or combinations thereof. In some embodiments, the mutation is F36Y, K61R, P100Q, or combinations thereof. In some embodiments, the mutation is S46L, P100Q, or combinations thereof. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 125 with a mutation at one or more amino acid positions 43, 76, 85, 99, 100, and or 116. The mutation can be selected from L43Q, L43K, L43H, I76T, R85S, R85G, R85N, R85D, D99E, D99Q, D99S, D99T, G100A, G100Y, G100V, T116L, T116M, T116P, T116R, or combinations thereof. In certain embodiments, the mutation is L43Q, I76T, R85S, D99E, G100A, G100Y, T116L, or combinations thereof.
[0123] In still other embodiments, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 52 with a mutation at amino acid position 91. The mutation can be selected from F91V, F91I, F91T, F91L, or F91D. In one embodiment, the mutation is F91V. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 115 with a mutation at amino acid position 62 and / or 63. In particular embodiments, the mutation is selected from D62E, D62Q, D62T, D62N, S63A, S63Q, S63V, or combinations thereof. In some embodiments, the mutation is selected from D62E, D62Q, S63A, or combinations thereof.
[0124] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the amino acid sequence of SEQ ID NO: 326 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 327. In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the amino acid sequence of SEQ ID NO: 328 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 329. In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the amino acid sequence of SEQ ID NO: 330 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 331. In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising the amino acid sequence of SEQ ID NO: 332 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 333.
[0125] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 326, 328, 330 or 332. In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 327, 329, 331 or 333. In a specific embodiment, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and a heavy chain variable region, wherein the light chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 326 and the heavy chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 327. In a specific embodiment, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and a heavy chain variable region, wherein the light chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 328 and the heavy chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 329. In a specific embodiment, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and a heavy chain variable region, wherein the light chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 330 and the heavy chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 331. In a specific embodiment, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and a heavy chain variable region, wherein the light chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 332 and the heavy chain variable region consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 333.
[0126] Additional variants of the anti-TREM2 antibodies described herein can be generated by affinity modulating any of the anti-TREM2 antibodies described herein. An "affinity- modulated antibody" is an antibody that comprises one or more amino acid substitutions in its light chain variable region sequence and / or heavy chain variable region sequence that increases or decreases the affinity of the antibody for the target antigen as compared to the parental antibody that does not contain the amino acid substitutions. Antibody affinity modulation methods are known to those of skill in the art and can include CDR walking mutagenesis (Yang et al., J. Mol. Biol., 254, 392-403, 1995), chain shuffling (Marks et al., Bio / Technology, 10, 779-783, 1992), use of mutation strains of E. coli (Low et al., J. Mol.Biol., 250, 350-368, 1996), DNA shuffling (Patten et al., Curr. Opin. Biotechnol., 8, 724-733, 1997), phage display (Thompson et al., J. Mol. Biol., 256, 7-88, 1996), PCR techniques (Crameri, et al., Nature, 391, 288-291, 1998), and other mutagenesis strategies (Barbas et al. ProcNat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al., J. Immunol. 154(7): 3310-9, 1995; and Hawkins et al, J. Mol. Biol. 226:889-896, 1992). Methods of affinity modulation are discussed in Hoogenboom, Trends in Biotechnology, Vol. 15: 62-70, 1995 and Vaughan et al, Nature Biotechnology, 16: 535-539, 1998. One specific method for generating affinity- modulated variants of the anti-TREM2 antibodies described herein is the use of a yeast- display Fab mutagenesis library as described in Example 8.
[0127] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region and / or heavy chain variable region from an affinity- modulated variant of the 6E7 antibody (Example 8). For instance, in some embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region and / or a heavy chain variable region having one or more of the amino acid substitutions set forth in Table 23. In one embodiment, the TREM2 agonist antigen binding protein comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 with a mutation at one or more amino acid positions 24, 31, 50, 52, 54, 56, 89, 92, 93, 94 and / or 96. In certain embodiments, the mutation is selected from R24A, S31R, A50S, A50G, S52G, L54R, N56K, N56R, N56L, N56T, Q89G, D92V, S93R, F94Y, F94L, R96H, R96L, or combinations thereof. In these and other embodiments, the TREM2 agonist antigen binding protein comprises a heavy chain variable region comprising the sequence of SEQ ID NO: 124 with a mutation at one or more amino acid positions 27, 28, 30, 32, 50, 54, 58, 60, 61, 63, 66, 99, 101, 103, 104, and / or 110. In some embodiments, the mutation is selected from Y27S, S28G, S28H, T30N, T30G, T30E, T30A, Y32E, I50T, G54S, T58V, Y60L, S61 A, S63G, S63E, G66D, Q99G, Q99S, Q99M, T101G, Y103R, Y104G, Fl 10S, or combinations thereof.Amino acid sequences for light chain and heavy chain variable regions and associated CDRs of exemplary variants of the 6E7 antibody with improved affinity are set forth below in Tables 2A and 2B, respectively. Amino acid sequences for light chain and heavy chain variable regions and associated CDRs of exemplary variants of the 6E7 antibody with reduced affinity are set forth below in Tables 3A and 3B, respectively. The corresponding sequences for the 6E7 antibody are listed for comparison.Table 2A. Light Chain Variable Region Amino Acid Sequences for Improved Affinity TREM2 AntibodiesTable 2B. Heavy Chain Variable Region Amino Acid Sequences for Improved Affinity TREM2 Antibodies
[0128] The TREM2 agonist antigen binding proteins of the invention may comprise one or more of the CDRs from the improved affinity variants presented in Table 2 A (light chain CDRs; i.e. CDRLs) and Table 2B (heavy chain CDRs, i.e. CDRHs). In some embodiments, the TREM2 agonist antigen binding proteins comprise a consensus CDR sequence derived from the improved affinity variants. For instance, in one embodiment, the TREM2 agonist antigen binding proteins comprise a CDRL2 consensus sequence of X1ASSX2QX3 (SEQ ID NO: 139), where Xi is A or G; ¾ is L or R; and X3 is N, K, R, L, or T. In another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRL3 consensus sequence of X1QADX2X3PX4T (SEQ ID NO: 140), where Xi is Q or G; X2 is S or R; ¾ is F, L, or Y; and X* is R or H. In yet another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRH2 consensus sequence of X1IYPGDSDX2RX3X4PX5FQX6 (SEQ ID NO: 141), where Xi is 1 or T; X2 is T or V; X3 is Y or L; X* is S or A; X5 is S, G, or E; and Xe is G or D. In still another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRH3 consensus sequence of X1RTFYYDSSDYX2DY (SEQ ID NO: 142), where Xi is Q, G, S, or M; and X2 is F or S. In certain embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising complementarity determining regions CDRL1, CDRL2, and CDRL3 and a heavy chain variable region comprising complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein CDRL1 comprises the sequence of SEQ ID NO: 16, CDRL2 comprises the consensus sequence of SEQ ID NO: 139, CDRL3 comprises the consensus sequence of SEQ ID NO: 140, CDRHl comprises the sequence of SEQ ID NO: 85, CDRH2 comprises the consensus sequence of SEQ ID NO: 141, and CDRH3 comprises the consensus sequence of SEQ ID NO: 142.
[0129] In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a CDRLl comprising the sequence of SEQ ID NO: 16; a CDRL2 comprising a sequence selected from SEQ ID NOs: 26 and 143-147; a CDRL3 comprising a sequence selected from SEQ ID NOs: 43 and 148-152; a CDRHl comprising the sequence of SEQ IDNO: 85; a CDRH2 comprising a sequence selected from SEQ ID NOs: 91 and 170-175; and a CDRH3 comprising a sequence selected from SEQ ID NOs: 176-179.
[0130] In particular embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRL1, a CDRL2, and a CDRL3, wherein: (a) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 143, and 148, respectively; (b) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 144, and 149, respectively; (c) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and 43, respectively; (d) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 146, and 148, respectively; (e) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 26, and 150, respectively; (f CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 143, and 151, respectively; (g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and 148, respectively; (h) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and 152, respectively; (i) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 144, and 43, respectively; or (j) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 147, and 43, respectively.
[0131] In related embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein: (a) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 170, and 176, respectively; (b) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 171, and 177, respectively; (c) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 172, and 177, respectively; (d) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 171, and 178, respectively; (e) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 171, and 179, respectively; (f) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 173, and 177, respectively; (g) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 176, respectively; (h) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 174, and 176, respectively; (i) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 175, and 178, respectively; or (j) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 178, respectively.
[0132] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein:(a) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 143, and148, respectively, and CDRH1, CDRH2, and CDRH3 have Ihe sequence of SEQ ID NOs: 85,170, and 176, respectively;(b) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 144, and149, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85,171, and 177, respectively;(c) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85,172, and 177, respectively;(d) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 146, and 148, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 171, and 178, respectively;(e) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 26, and150, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 171, and 179, respectively;(f CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 143, and151, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85,173, and 177, respectively;(g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and 148, respectively, and CDRHl, CDRH2, and CDRH3 have Ihe sequence of SEQ ID NOs: 85, 91, and 176, respectively;(h) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 145, and152, respectively, and CDRHl, CDRH2, and CDRH3 have Ihe sequence of SEQ ID NOs: 85, 171, and 178, respectively;(i) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 143, and 151, respectively, and CDRHl, CDRH2, and CDRH3 have Ihe sequence of SEQ ID NOs: 85,174, and 176, respectively;(j) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 144, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 175, and 178, respectively; or(k) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 147, and 43, respectively, and CDRHl , CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 178, respectively.
[0133] In some embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise a light chain variable region selected from LV-101, LV-102, LV-103, LV-104, LV-105, LV-106, LV-107, LV-108, LV-109, and LV-110, as shown in Table 2A, and / or a heavy chain variable region selected from HV-101, HV-102, HV-103, HV-104, HV-105, HV-106, HV-107, HV-108, HV-109, HV-110, and HV-111, as shown in Table 2B, or sequences that are at least 80% identical, at least 85% identical, at least 90% identical, or at least 95% identical to any of the sequences in Tables 2A and 2B. For instance, in certain embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 153-162, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 153-162, or (iii) a sequence selected from SEQ ID NOs: 153-162. In related embodiments, the TREM2 agonist antigen binding proteins comprise a heavy chain variable region comprising (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 180-190, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 180-190, or (iii) a sequence selected from SEQ ID NOs: 180- 190.
[0134] Each of the light chain variable regions listed in Table 2A may be combined with any of the heavy chain variable regions listed in Table 2B to form an anti-TREM2 binding domain of the antigen binding proteins of the invention. Examples of such combinations include, but are not limited to: LV-101 (SEQ ID NO: 153) and HV-101 (SEQ ID NO: 180); LV-102 (SEQ ID NO: 154) and HV-102 (SEQ ID NO: 181); LV-103 (SEQ ID NO: 155) and HV-103 (SEQ ID NO: 182); LV-104 (SEQ ID NO: 156) and HV-104 (SEQ ID NO: 183); LV-105 (SEQ ID NO: 157) and HV-105 (SEQ ID NO: 184); LV-106 (SEQ JD NO: 158) and HV-106 (SEQ ID NO: 185); LV-107 (SEQ ID NO: 159) and HV-107 (SEQ ID NO: 186); LV-108 (SEQ ID NO: 160) and HV-108 (SEQ ID NO: 187); LV-106 (SEQ ID NO: 158) and HV-109 (SEQ ID NO: 188); LV-109 (SEQ ID NO: 161) and HV-110 (SEQ ID NO: 189); and LV-110 (SEQ ID NO: 162) and HV-111 (SEQ ID NO: 190).Table 3A. Light Chain Variable Region Amino Acid Sequences for Reduced Affinity TREM2 AntibodiesTable 3B. Heavy Chain Variable Region Amino Acid Sequences for Reduced Affinity TREM2 Antibodies
[0135] The TREM2 agonist antigen binding proteins of the invention may comprise one or more of the CDRs from the reduced affinity variants presented in Table 3 A flight chain CDRs; i.e. CDRLs) and Table 3B (heavy chain CDRs, i.e. CDRHs). In some embodiments, the TREM2 agonist antigen binding proteins comprise a consensus CDR sequence derived from the reduced affinity variants. For instance, in one embodiment, the TREM2 agonist antigen binding proteins comprise a CDRL1 consensus sequence of X1ASQGISX2WLA (SEQ ID NO: 284), where X. is R or A; and X2 is S or R. In another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRL2 consensus sequence of X1AX2SLQN (SEQ ID NO: 285), where X. is A or S; and X2 is S or G. In another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRL3 consensus sequence of QQAX1SFPX2T (SEQ ID NO: 286), where Xi is D or V; and X2 is R or L. Inanother embodiment, the TREM2 agonist antigen binding proteins comprise a CDRH1 consensus sequence of SXiWIA (SEQ ID NO: 287), where Xi is Y or E. In yet another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRH2 consensus sequence of IIYPXiDSDTRYSPSFQG (SEQ ID NO: 288), where Xi is G or S. In still another embodiment, the TREM2 agonist antigen binding proteins comprise a CDRH3 consensus sequence of QRXJX2X3DSSDYFDY (SEQ ID NO: 289), where Xi is T or G; X2 is Y or R; and X3 is Y or G. In certain embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising complementarity determining regions CDRL1, CDRL2, and CDRL3 and a heavy chain variable region comprising complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein CDRL1 comprises the sequence of SEQ ID NO: 284, CDRL2 comprises the consensus sequence of SEQ ID NO: 285, CDRL3 comprises the consensus sequence of SEQ ID NO: 286, CDRH1 comprises the sequence of SEQ ID NO: 287, CDRH2 comprises the consensus sequence of SEQ ID NO: 288, and CDRH3 comprises the consensus sequence of SEQ ID NO: 289.
[0136] In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a CDRL1 comprising a sequence selected from SEQ JD NOs: 16, 290, and 291; a CDRL2 comprising a sequence selected from SEQ ID NOs: 28, 292, and 293; a CDRL3 comprising a sequence selected from SEQ ID NOs: 43, 294, and 271; a CDRH1 comprising the sequence of SEQ ID NO: 85 or SEQ ID NO: 302; a CDRH2 comprising the sequence of SEQ ID NO: 91 or SEQ ID NO: 303; and a CDRH3 comprising a sequence selected from SEQ ID NOs: 107 and 304-306.
[0137] In particular embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRL1, a CDRL2, and a CDRL3, wherein: (a) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively; (b) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 292, and 43, respectively; (c) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 294, respectively; (d) CDRL1, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 290, 28, and 43, respectively; (e) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 293, and 43, respectively; (f) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 271, respectively; or (g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 291, 28, and 43, respectively.
[0138] In related embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3,wherein: (a) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 304, respectively; (b) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively; (c) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 305, respectively; (d) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 303, and 107, respectively; (e) CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 306, respectively; or (f) CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 302, 91, and 107, respectively.
[0139] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain variable region comprising a CDRLl, a CDRL2, and a CDRL3 and a heavy chain variable region comprising a CDRHl, a CDRH2, and a CDRH3, wherein:(a) CDRLl , CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 304, respectively;(b) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 292, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively;(c) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 294, respectively, and CDRHl , CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively;(d) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91 , and 107, respectively;(e) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 305, respectively;(f CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 303, and 107, respectively;(g) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 290, 28, and 43, respectively, and CDRHl, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively;(h) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 43, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 306, respectively;(i) CDRLl , CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 293, and 43, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively;(j) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 16, 28, and 271, respectively, and CDRH1, CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 85, 91, and 107, respectively; or(k) CDRLl, CDRL2, and CDRL3 have the sequence of SEQ ID NOs: 291, 28, and 43, respectively, and CDRHl , CDRH2, and CDRH3 have the sequence of SEQ ID NOs: 302, 91, and 107, respectively.
[0140] In some embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise a light chain variable region selected from LV-16, LV-201, LV-202, LV-203, LV-204, LV-205, and LV-206, as shown in Table 3A, and / or a heavy chain variable region selected fromHV-15, HV-201, HV-202, HV-203, HV-204, HV-205, and HV-206, as shown in Table 3B, or sequences that are at least 80% identical, at least 85% identical, at least 90% identical, or at least 95% identical to any of the sequences in Tables 3 A and 3B. For instance, in certain embodiments, the TREM2 agonist antigen binding proteins comprise a light chain variable region comprising (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 61 and 295-300, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 61 and 295-300, or (iii) a sequence selected from SEQ ID NOs: 61 and 295-300. In related embodiments, the TREM2 agonist antigen binding proteins comprise a heavy chain variable region comprising (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 124 and 307-312, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 124 and 307-312, or (iii) a sequence selected from SEQ ID NOs: 124 and 307-312.
[0141] Each of the light chain variable regions listed in Table 3A may be combined with any of the heavy chain variable regions listed in Table 3B to form an anti-TREM2 binding domain of the antigen binding proteins of the invention. Examples of such combinations include, but are not limited to: LV-16 (SEQ ID NO: 61) and HV-201 (SEQ ID NO: 307); LV- 201 (SEQ ID NO: 295) and HV-15 (SEQ ID NO: 124); LV-202 (SEQ ID NO: 296) and HV- 15 (SEQ ID NO: 124); LV-16 (SEQ ID NO: 61) and HV-202 (SEQ ID NO: 308); LV-16(SEQ ID NO: 61) and HV-203 (SEQ ID NO: 309); LV-16 (SEQ ID NO: 61) and HV-204 (SEQ ID NO: 310); LV-203 (SEQ ID NO: 297) and HV-15 (SEQ ID NO: 124); LV-16 (SEQ ED NO: 61) and HV-205 (SEQ ID NO: 311); LV-204 (SEQ ID NO: 298) and HV-15 (SEQ ID NO: 124); LV-205 (SEQ ID NO: 299) and HV-15 (SEQ ID NO: 124); and LV-206 (SEQ ID NO: 300) and HV-206 (SEQ ID NO: 312).
[0142] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention are anti-TREM2 agonist antibodies or binding fragments thereof. As used herein, die term "antibody" refers to a tetrameric immunoglobulin protein comprising two light chain polypeptides (about 25 kDa each) and two heavy chain polypeptides (about 50-70 kDa each). An "antibody" is a species of an antigen binding protein. The term 'light chain" or"immunoglobulin light chain" refers to a polypeptide comprising, from amino terminus to carboxyl terminus, a single immunoglobulin light chain variable region (VL) and a single immunoglobulin light chain constant domain (CL). The immunoglobulin light chain constant domain (CL) can be a human kappa (κ) or human lambda (λ) constant domain. The term "heavy chain" or "immunoglobulin heavy chain" refers to a polypeptide comprising, from amino terminus to carboxyl terminus, a single immunoglobulin heavy chain variable region (VH), an immunoglobulin heavy chain constant domain 1 (CHI), an immunoglobulin hinge region, an immunoglobulin heavy chain constant domain 2 (CH2), an immunoglobulin heavy chain constant domain 3 (CH3), and optionally an immunoglobulin heavy chain constant domain 4 (CH4). Heavy chains are classified as mu (μ), delta (Δ), gamma (γ), alpha (a), and epsilon (ε), and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. The IgG-class and IgA-class antibodies are further divided into subclasses, namely, IgGl, IgG2, IgG3, and IgG4, and IgAl and IgA2, respectively. The heavy chains in IgG, IgA, and IgD antibodies have three domains (CHI, CH2, and CH3), whereas the heavy chains in IgM and IgE antibodies have four domains (CHI, CH2, CH3, and CH4). The immunoglobulin heavy chain constant domains can be from any immunoglobulin isotype, including subtypes. The antibody chains are linked together via inter-polypeptide disulfide bonds between die CL domain and the CHI domain (i.e. between the light and heavy chain) and between the hinge regions of the antibody heavy chains.
[0143] The anti-TREM2 antibodies of the invention can comprise any immunoglobulin constant region. The term "constant region" as used herein refers to all domains of an antibody other than the variable region. The constant region is not involved directly in binding of an antigen, but exhibits various effector functions. As described above, antibodiesare divided into particular isotypes (IgA, IgD, IgE, IgG, and IgM) and subtypes (IgGl, IgG2, IgG3, IgG4, IgAl IgA2) depending on the amino acid sequence of the constant region of their heavy chains. The light chain constant region can be, for example, a kappa- or lambda- type light chain constant region, e.g., a human kappa- or lambda-type light chain constant region, which are found in all five antibody isotypes. Examples of human immunoglobulin light chain constant region sequences are shown in the following table.Table 4. Exemplary Human Immunoglobulin Light Chain Constant Regions
[0144] The heavy chain constant region of the anti-TREM2 antibodies of the invention can be, for example, an alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant region, e.g., a human alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant region. In some embodiments, the anti-TREM2 antibodies comprise a heavy chain constant region from an IgGl, IgG2, IgG3, or IgG4 immunoglobulin. In one embodiment, the anti-TREM2 antibody comprises a heavy chain constant region from a human IgGl immunoglobulin. In such embodiments, the human IgGl immunoglobulin constant region may comprise one or more mutations to prevent glycosylation of the antibody as described in more detail herein. Inanother embodiment, the anti-TREM2 antibody comprises a heavy chain constant region from a human IgG2 immunoglobulin. In yet another embodiment, the anti-TREM2 antibody comprises a heavy chain constant region from a human IgG4 immunoglobulin. Examples of human IgGl, IgG2, and IgG4 heavy chain constant region sequences are shown below in Table 5.Table 5. Exemplary Human Immunoglobulin Heavy Chain Constant Regions
[0145] Each of the light chain variable regions disclosed in Tables 1 A, 2A, and 3A and each of the heavy chain variable regions disclosed in Tables 1 B, 2B, and 3B may be attached to the above light chain constant regions (Table 4) and heavy chain constant regions (Table 5) to form complete antibody light and heavy chains, respectively. Further, each of the so generated heavy and light chain sequences may be combined to form a complete antibody structure. It should be understood that the heavy chain and light chain variable regions provided herein can also be attached to other constant domains having different sequences than the exemplary sequences listed above.
[0146] The TREM2 agonist antigen binding proteins of the invention can be any of the anti- TREM2 antibodies disclosed herein. For example, in certain embodiments, the anti-TREM2 agonist antigen binding protein is an anti-TREM2 antibody selected from antibodies 12G10, 26A10, 26C10, 26F2, 33B12, 24C12, 24G6, 24A10, 10E3, 13E7, 14C12, 25F12, 32E3, 24F4,16B8, 4C5, 6E7, 5E3, and 4G10, the variable region and CDR sequences of which are set forth in Tables 1 A and IB. In some embodiments, the anti-TREM2 agonist antigen binding protein is an anti-TREM2 antibody selected from antibodies 24G6, 10E3, 13E7, 4C5, 6E7, and 5E3. In other embodiments, the anti-TREM2 agonist antigen binding protein is an anti- TREM2 antibody selected from antibodies V3, V24, V27, V40, V48, V49, V52, V60, V73, V76, and V84, the variable region and CDR sequences of which are set forth in Tables 2A and 2B. In certain other embodiments, the anti-TREM2 agonist antigen binding protein is an anti-TREM2 antibody selected from antibodies V9, V10, V23, V30, V33, V44, V57, V68, V70, V83, and V90, the variable region and CDR sequences of which are set forth in Tables 3A and 3B.
[0147] The TREM2 agonist antigen binding proteins of the invention can be monoclonal antibodies, polyclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, chimeric antibodies, or multispecific antibodies. In certain embodiments, the TREM2 agonist antigen binding protein is a monoclonal antibody. In such embodiments, die anti-TREM2 antibody may be a chimeric antibody, a humanized antibody, or a fully human antibody having a human immunoglobulin constant domain. In these and otherembodiments, the anti-TREM2 antibody is a human IgGl, IgG2, IgG3, or IgG4 antibody. Thus, the anti-TREM2 antibody may, in some embodiments, have a human IgGl, IgG2, IgG3, or IgG4 constant domain. In one embodiment, the anti-TREM2 antibody is a monoclonal human IgGl antibody. In another embodiment, the anti-TREM2 antibody is a monoclonal human IgG2 antibody. In yet another embodiment, the anti-TREM2 antibody is a monoclonal human IgG4 antibody.
[0148] The term "monoclonal antibody" (or "mAb") as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against an individual antigenic site or epitope, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different epitopes. Monoclonal antibodies may be produced using any technique known in the art, e.g., by immortalizing spleen cells harvested from an animal after completion of the immunization schedule. The spleen cells can be immortalized using any technique known in the art, e.g., by fusing them with myeloma cells to produce hybridomas. See, for example, Antibodies; Harlow and Lane, Cold Spring Harbor Laboratory Press, 1stEdition, e.g. from 1988, or 2ndEdition, e.g. from 2014. Myeloma cells for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media, which support the growth of only the desired fused cells (hybridomas). Examples of suitable cell lines for use in fusions with mouse cells include, but are not limited to, Sp-20, P3-X63 / Ag8, P3-X63-Ag8.653, NSl / l.Ag 4 1, Sp210-Agl4, FO, NSO / U, MPC-11, MPC 11 -X45-GTG 1.7 and S194 / 5XXO Bui. Example of suitable cell lines used for fusions with rat cells include, but are not limited to, R210.RCY3, Y3-Ag 1.2.3, IR983F and 4B210. Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LlCR-LON-HMy2 and UC729-6.
[0149] In some instances, a hybridoma cell line is produced by immunizing an animal (e.g., a rabbit, rat, mouse, or a transgenic animal having human immunoglobulin sequences) with a TREM2 immunogen (such as the immunogens described in Example 1); harvesting spleen cells from the immunized animal; fusing the harvested spleen cells to a myeloma cell line, thereby generating hybridoma cells; establishing hybridoma cell lines from the hybridoma cells, and identifying a hybridoma cell line that produces an antibody that binds to human TREM2. Another useful method for producing monoclonal antibodies is the SLAM method described in Babcook etal, Proc. Natl. Acad. Sci. USA, Vol. 93: 7843-7848, 1996.
[0150] Monoclonal antibodies secreted by a hybridoma cell line can be purified using any technique known in the art, such as protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography. Hybridoma supernatants or mAbs may be further screened to identify mAbs with particular properties, such as the ability to bind human TREM2, cross-reactivity to TREM2 proteins from other species (e.g., mouse TREM2, rat TREM2, and cynomologus monkey TREM2), cross-reactivity to other TREM family members (e.g. human TREMl), ability to induce or increase TREM2-mediated signaling, e.g. using a pSyk assay as described herein, or ability to induce or increase TREM2 -mediated function or activities as described herein (e.g. proliferation or survival of TREM2-expressing myeloid cells).
[0151] In some embodiments, the TREM2 agonist antigen binding proteins of the invention are chimeric or humanized antibodies based upon the CDR and variable region sequences of the anti-TREM2 antibodies described herein. A chimeric antibody is an antibody composed of protein segments from different antibodies that are covalently joined to produce functional immunoglobulin light or heavy chains or binding fragments thereof. Generally, a portion of the heavy chain and / or light chain is identical with or homologous to a correspondingsequence in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is / are identical with or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass. For methods relating to chimeric antibodies, see, for example, United States Patent No. 4,816,567 and Morrison etal, 1985, Proc. Natl. Acad. Sci. USA 81:6851-6855, both of which are hereby incorporated by reference in their entireties.
[0152] Generally, the goal of making a chimeric antibody is to create a chimera in which the number of amino acids from the intended species is maximized. One example is the "CDR- grafted" antibody, in which the antibody comprises one or more CDRs from a particular species or belonging to a particular antibody class or subclass, while the remainder of the antibody chain(s) is / are identical with or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass. CDR grafting is described, for example, in United States Patent No. 6,180,370, No.5,693,762, No. 5,693,761, No. 5,585,089, and No. 5,530,101. For use in humans, the variable region or selected CDRs from a rodent or rabbit antibody often are grafted into a human antibody, replacing H e naturally-occurring variable regions or CDRs of the human antibody.
[0153] One useful type of chimeric antibody is ae¾umanized" antibody. Generally, a humanized antibody is produced from a monoclonal antibody raised initially in anon-human animal, such as a rodent or rabbit. Certain amino acid residues in this monoclonal antibody, typically from non-antigen recognizing portions of the antibody, are modified to be homologous to corresponding residues in a human antibody of corresponding isotype.Humanization can be performed, for example, using various methods by substituting at least a portion of a rodent or rabbit variable region for the corresponding regions of a human antibody (see, e.g., United States Patent No. 5,585,089, and No. 5,693,762; Jones et al, 1986, Nature 321 :522-525; Riechmann et al, 1988, Nature 332:323-27; and Verhoeyen et al, 1988, Science 239:1534-1536).
[0154] In one aspect, the CDRs of the light and heavy chain variable regions of die antibodies provided herein (see, Tables 1 A, IB, 2A, 2B, 3 A and 3B) are grafted to framework regions (FRs) from antibodies from the same, or a different, phylogenetic species. For example, the CDRs of the heavy and light chain variable regions listed in Tables 1 A, IB, 2A, 2B, 3A, and 3B can be grafted to consensus human FRs. To create consensus human FRs, FRs from several human heavy chain or light chain amino acid sequences may be aligned toidentify a consensus amino acid sequence. Alternatively, the grafted variable regions from the one heavy or light chain may be used with a constant region that is different from the constant region of that particular heavy or light chain as disclosed herein. In other embodiments, the grafted variable regions are part of a single chain Fv antibody.[01SS] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention are fully human antibodies. Fully human antibodies that specifically bind to human TREM2 can be generated using the immunogens or fragments thereof described herein, such as polypeptides consisting of the sequences of SEQ ID NOs: 1 and 2 or the immunogens described in Example 1. A "fully human antibody" is an antibody that comprises variable and constant regions derived from or indicative of human germ line immunoglobulin sequences. One specific means provided for implementing the production of fully human antibodies is the "humanization" of the mouse humoral immune system. Introduction of human immunoglobulin (Ig) loci into mice in which the endogenous Ig genes have been inactivated is one means of producing fully human monoclonal antibodies (mAbs) in mouse, an animal that can be immunized with any desirable antigen. Using fully human antibodies can minimize the immunogenic and allergic responses that can sometimes be caused by administering mouse or mouse-derived mAbs to humans as therapeutic agents.
[0156] Fully human antibodies can be produced by immunizing transgenic animals (usually mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production. Antigens for this purpose typically have six or more contiguous amino acids, and optionally are conjugated to a carrier, such as a hapten. See, e.g., Jakobovits etal, 1993, Proc. Natl. Acad. Sci. USA 90:2551-2555; Jakobovits et al, 1993, Nature 362:255-258; and Bruggermann et al, 1993, Year in Immunol. 7:33. In one example of such a method, transgenic animals are produced by incapacitating the endogenous mouse immunoglobulin loci encoding the mouse heavy and light immunoglobulin chains therein, and inserting into the mouse genome large fragments of human genome DNA containing loci that encode human heavy and light chain proteins. Partially modified animals, which have less than the full complement of human immunoglobulin loci, are then cross-bred to obtain an animal having all of the desired immune system modifications. When administered an immunogen, these transgenic animals produce antibodies that are immunospecific for the immunogen but have human rather than murine amino acid sequences, including the variable regions. For further details of such methods, see, for example, W096 / 33735 and WO94 / 02602. Additional methods relating to transgenic micefor making human antibodies are described in United States Patent No. 5,545,807; No.6,713,610; No. 6,673,986; No. 6,162,963; No. 5,939,598; No. 5,545,807; No. 6,300,129; No. 6,255,458; No. 5,877,397; No. 5,874,299 and No. 5,545,806; in PCT publications WO91 / 10741, WO90 / 04036, WO 94 / 02602, WO 96 / 30498, WO 98 / 24893 and in EP 546073B1 and EP 546073A1.
[0157] The transgenic mice described above, referred to herein as "HuMab" mice, contain a human immunoglobulin gene minilocus that encodes unrearranged human heavy (mu and gamma) and kappa light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous mu and kappa chain loci (Lonberg et al, 1994, Nature 368:856-859). Accordingly, the mice exhibit reduced expression of mouse IgM and kappa proteins and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG kappa monoclonal antibodies (Lonberg and Huszar, 1995, Intern. Rev. Immunol. 13: 65-93; Harding and Lonberg, 1995, Ann. N.Y Acad. Sci. 764:536-546). The preparation of HuMab mice is described in detail in Taylor etal, 1992, Nucleic Acids Research 20:6287-6295; Chen etal, 1993, International Immunology 5:647-656; Tuaillon etal, 1994, J. Immunol. 152:2912-2920; Lonberg etal, 1994, Nature 368:856-859; Lonberg, 1994, Handbook of Exp. Pharmacology 113:49-101; Taylor etal, 1994, International Immunology 6:579-591; Lonberg and Huszar, 1995, Intern. Rev. Immunol. 13:65-93; Harding and Lonberg, 1995, Ann. N.Y Acad. Sci. 764:536-546; Fishwild etal, 1996, Nature Biotechnology 14:845-851; the foregoing references are hereby incorporated by reference in their entireties for all purposes. See, further United States Patent No. 5,545,806; No. 5,569,825; No. 5,625,126; No. 5,633,425; No. 5,789,650; No. 5,877,397; No. 5,661,016; No. 5,814,318; No. 5,874,299; and No. 5,770,429; as well as United States Patent No. 5,545,807; International Publication Nos. WO 93 / 1227; WO 92 / 22646; and WO 92 / 03918, the disclosures of all of which are hereby incorporated by reference in their entireties for all purposes. Technologies utilized for producing human antibodies in these transgenic mice are disclosed also in WO 98 / 24893, and Mendez etal, 1997, Nature Genetics 15:146-156, which are hereby incorporated by reference. For example, the HCo7 and HCol2 transgenic mice strains can be used to generate fully human anti-TREM2 antibodies. One particular transgenic mouse line suitable for generation of fully human anti-TREM antibodies is the XenoMouse®transgenic mice described in Example 1 and in U.S. Pat. Nos. 6,114,598; 6,162,963; 6,833,268;7,049,426; 7,064,244; Green et al, 1994, Nature Genetics 7: 13-21; Mendez et al, 1997, NatureGenetics 15:146-156; Green and Jakobovitis, 1998, J. Ex. Med, 188:483-495; Green, 1999, Journal of Immunological Methods 231:11-23; Kellerman and Green, Current Opinion in Biotechnology 13, 593-597, 2002, all of which are hereby incorporated by reference in their entireties.[01S8] Human-derived antibodies can also be generated using phage display techniques. Phage display is described in e.g., Dower et al, WO 91 / 17271, McCafferty et al, WO 92 / 01047, and Caton and Koprowski, Proc. Natl. Acad. Sci. USA, 87:6450-6454 (1990), each of which is incorporated herein by reference in its entirety. The antibodies produced by phage technology are usually produced as antigen binding fragments, e.g. Fv or Fab fragments, in bacteria and thus lack effector functions. Effector functions can be introduced by one of two strategies: The fragments can be engineered either into complete antibodies for expression in mammalian cells, or into bispecific antibody fragments with a second binding site capable of triggering an effector function, if desired. Typically, the Fd fragment (VH-CHl) and light chain (VL-CL) of antibodies are separately cloned by PCR and recombined randomly in combinatorial phage display libraries, which can then be selected for binding to a particular antigen. The antibody fragments are expressed on the phage surface, and selection of Fv or Fab (and therefore the phage containing the DNA encoding the antibody fragment) by antigen binding is accomplished through several rounds of antigen binding and re-amplification, a procedure termed panning. Antibody fragments specific for the antigen are enriched and finally isolated. Phage display techniques can also be used in an approach for the humanization of rodent monoclonal antibodies, called "guided selection" (see Jespers, L. S., et al., Bio / Technology 12, 899-903 (1994)). For this, the Fd fragment of the mouse monoclonal antibody can be displayed in combination with a human light chain library, and the resulting hybrid Fab library may then be selected with antigen. The mouse Fd fragment thereby provides a template to guide the selection. Subsequently, the selected human light chains are combined with a human Fd fragment library. Selection of the resulting library yields entirely human Fab.
[0159] Once cells producing anti-TREM2 antibodies according to the invention have been obtained using any of the above-described immunization and other techniques, the specific antibody genes may be cloned by isolating and amplifying DNA or mRNA therefrom according to standard procedures as described herein. The antibodies produced therefrom may be sequenced and the CDRs identified and die DNA coding for the CDRs may bemanipulated as described herein to generate other TREM2 agonist antigen binding proteins or antibodies according to the invention.
[0160] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention (e.g. monoclonal antibodies or binding fragments thereof) compete for binding to human TREM2 (SEQ ID NO: 1) or an extracellular domain of human TREM2 (SEQ ID NO: 2) with a reference antibody, such as one or more of the anti-TREM2 antibodies described herein. The term "compete" refers to the ability of an antibody or other antigen binding protein to interfere with the binding of other antibodies or binding fragments to a target (e.g. human TREM2). The extent to which an antibody or binding fragment is able to interfere with the binding of another antibody or binding fragment to a target (e.g. human TREM2), and therefore whether it can be said to compete, can be determined using competition binding assays. Numerous types of competitive binding assays can be used, including for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (El A), sandwich competition assay (see, e.g., Stahli etal, 1983, Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland etal., 1986, J. Immunol. 137:3614-3619); solid phase direct-labeled assay, solid phase direct-labeled sandwich assay (see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et al, 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al, 1990, Virology 176:546-552); surface plasmon resonance-based assays (e.g. using Biacore®systems); bio-layer interferometry -based assays (e.g. using Octet®systems); and direct labeled RIA (Moldenhauer et al, 1990, Scand. J. Immunol. 32:77-82). Typically, a competitive binding assay involves the use of purified antigen bound to a solid surface or cells bearing the antigen, an unlabeled test antibody or other antigen binding protein, and a labeled reference antibody or other antigen binding protein. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody or other antigen binding protein. Usually the test antibody or other antigen binding protein is present in excess. Antibodies or other antigen binding proteins identified by competition assay (i.e. competing antibodies and antigen binding proteins) include antibodies and antigen binding proteins binding to the same epitope as the reference antibody or antigen binding protein. Usually, when a competing antibody or other antigen binding protein is present in excess, it will inhibit specific binding of a reference antibody or other antigen binding protein to a target antigen by at least 40%, 45%, 50%, 55%,60%, 65%, 70% or 75%. In some instances, binding of the reference antibody or other antigen binding protein is inhibited by at least 80%, 85%, 90%, 95%, or 97% or more. In some embodiments, a competing antigen binding protein (e.g. antibody or binding fragment thereof) reduces human TREM2 binding of a reference antibody between about 40% and about 100%, such as about 60% and about 100%, specifically between about 70% and about 100%, and more specifically between about 80% and about 100%.
[0161] A particularly suitable quantitative assay for detecting competitive binding uses a Biacore®machine which measures the extent of interactions using surface plasmon resonance technology. An exemplary Biacore®-based competitive binding assay involves the immobilization of a reference antibody to a sensor chip. The target antigen is then contacted with the sensor chip where the target antigen is captured by the immobilized reference antibody. Test antibodies are then injected over the captured target antigen. If the injected test antibody recognizes a distinct epitope from that recognized by the immobilized antibody, then a second binding event is observed and the test antibody would be considered not to compete for binding to the target antigen with the reference antibody.
[0162] Another particularly suitable assay for detecting competitive binding employs kinetic sensors used with Octet®systems (Pall ForteBio), which measures binding interactions using bio-layer interferometry methodology. Such an assay is described in Example 4, in which each of sixteen different anti-TREM2 antibodies described herein were evaluated against each other for the ability to compete for binding to human TREM2. The results of the analysis provided in Table 9 show that the sixteen different antibodies could be grouped into four distinct epitope bins. That is, one group of antibodies (antibodies 10E3, 13E7, 24F4, 4C5, 4G10, 32E3, and 6E7) competed with each other for binding to human TREM2, indicating that they share the same or similar epitope on human TREM2. Antibodies 16B8, 26A10, 26C10, 26F2, 33B12, and 5E3 competed with each other for TREM2 binding, but did not compete with antibodies in the first group or antibodies 24A10, 24G6, or 25F12, indicating that this second group of antibodies bind to a distinct epitope on human TREM2. Antibodies 24A10 and 24G6 share a similar epitope on human TREM2 as these two antibodies competed with each other for human TREM2 binding, but did not compete with any other antibody. Antibody 25F12 did not compete with any of the other tested antibodies for human TREM2 binding, indicating that this antibody binds to yet another epitope.
[0163] In some embodiments, a TREM2 agonist antigen binding protein of the invention competes with a reference antibody for binding to human TREM2, wherein the referenceantibody comprises a light chain variable region comprising a sequence selected from SEQ ID NOs: 46-63 and a heavy chain variable region comprising a sequence selected from SEQ ED NOs: 110-126. In other embodiments, a TREM2 agonist antigen binding protein of the invention competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising a sequence selected from SEQ ID NOs: 153-162 and a heavy chain variable region comprising a sequence selected from SEQ ID NOs: 180-190. In still other embodiments, a TREM2 agonist antigen binding protein of the invention competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising a sequence selected from SEQ ID NOs: 61 and 295-300 and a heavy chain variable region comprising a sequence selected from SEQ ID NOs: 124 and 307-312. In certainembodiments, a TREM2 agonist antigen binding protein of the invention competes for binding to human TREM2 with one or more of the anti-TREM2 antibodies described herein, including 12G10, 26A10, 26C10, 26F2, 33B12, 24C12, 24G6, 24A10, 10E3, 13E7, 14C12, 25F12, 32E3, 24F4, 16B8, 4C5, 6E7, 5E3, 4G10, V3, V9, V10, V23, V24, V27, V30, V33, V40, V44, V48, V49, V52, V57, V60, V68, V70, V73, V76, V83, V84, and V90.
[0164] In one embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 61 and a heavy chain variable region comprising the sequence of SEQ ID NO: 124. In such embodiments, antigen binding proteins that compete with this reference antibody for binding to human TREM2 would bind the same or similar epitope as antibody 6E7 or any of the other antibodies in epitope bin A (e.g. 10E3, 13E7, 24F4, 4C5, 4G10, 32E3), as described in Example 4.
[0165] In another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 62 and a heavy chain variable region comprising the sequence of SEQ ID NO: 125. In such embodiments, antigen binding proteins that compete with this reference antibody for binding to human TREM2 would bind the same or similar epitope as antibody 5E3 or any of the other antibodies in epitope bin B (e.g. 16B8, 26A10, 26C10, 26F2, 33B12), as described in Example 4.
[0166] In yet another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 52 and aheavy chain variable region comprising the sequence of SEQ ID NO: 115. In such embodiments, antigen binding proteins that compete with this reference antibody for binding to human TREM2 would bind the same or similar epitope as antibody 24G6 or antibody 24A10 (epitope bin C as described in Example 4).
[0167] In still another embodiment, the TREM2 agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises a light chain variable region comprising the sequence of SEQ ID NO: 56 and a heavy chain variable region comprising the sequence of SEQ ID NO: 119. In such embodiments, antigen binding proteins that compete with this reference antibody for binding to human TREM2 would bind the same or similar epitope as antibody 25F12 (epitope bin D as described in Example 4).
[0168] In certain embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise one or more mutations or modifications to a constant region. For example, in embodiments in which the TREM2 agonist antigen binding proteins comprise an Fc region (e.g. monoclonal antibodies), the heavy chain constant regions or the Fc regions of the antigen binding proteins (e.g. monoclonal antibodies) may comprise one or more amino acid substitutions that affect the glycosylation, effector function, and / or Fey receptor binding of the antigen binding protein.
[0169] The term "Fc region" refers to the C-terminal region of an immunoglobulin heavy chain which may be generated by papain digestion of an intact antibody. The Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain, and optionally comprises a CH4 domain. In certain embodiments, the Fc region is an Fc region from an IgGl, IgG2, IgG3, or IgG4 immunoglobulin. In some embodiments, the Fc region comprises CH2 and CH3 domains from a human IgGl or human IgG2 immunoglobulin. The Fc region may retain effector function, such as Clq binding, complement-dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell- mediated cytotoxicity (ADCC), and phagocytosis. In other embodiments, the Fc region may be modified to reduce or eliminate effector function as described in further detail below.
[0170] One of the functions of the Fc region of an immunoglobulin is to communicate to the immune system when the immunoglobulin binds its target. This is commonly referred to as "effector function." Communication leads ADCC, antibody-dependent cellular phagocytosis (ADCP), and / or CDC. ADCC and ADCP are mediated through the binding of the Fc region to Fc receptors on the surface of cells of the immune system CDC is mediated through thebinding of the Fc with proteins of the complement system, e.g., Clq. In some embodiments, the antigen binding proteins, e.g. monoclonal antibodies, of the invention comprise one or more amino acid substitutions in the Fc region to enhance effector function, including ADCC activity, CDC activity, ADCP activity, and / or the clearance or half-life of the antigen binding protein. Exemplary amino acid substitutions (according to EU numbering scheme) that can enhance effector function include, but are not limited to, E233L, L234I, L234Y, L235S, G236A, S239D, F243L, F243V, P247I, D280H, K290S, K290E, K290N, K290Y, R292P, E294L, Y296W, S298A, S298D, S298V, S298G, S298T, T299A, Y300L, V305I, Q311M, K326A, K326E, K326W, A330S, A330L, A330M, A330F, I332E, D333A, E333S, E333A, K334A, K334V, A339D, A339Q, P396L, or combinations of any of the foregoing.
[0171] In other embodiments, the TREM2 agonist antigen binding proteins (e.g. monoclonal antibodies) of the invention comprise one or more amino acid substitutions in a heavy chain constant region to reduce effector function. Exemplary amino acid substitutions (according to EU numbering scheme) that can reduce effector function include, but are not limited to, C220S, C226S, C229S, E233P, L234A, L234V, V234A, L234F, L235A, L235E, G237A, P238S, S267E, H268Q, N297A, N297G, V309L, E318A, L328F, A330S, A331S, P331S or combinations of any of the foregoing.
[0172] Glycosylation can contribute to the effector function of antibodies, particularly IgGl antibodies. Thus, in some embodiments, the TREM2 agonist antigen binding proteins of the invention may comprise one or more amino acid substitutions that affect the level or type of glycosylation of the binding proteins. Glycosylation of polypeptides is typically either N- linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tri-peptide sequences asparagine-X-serine and asparagme-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tri-peptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N- acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
[0173] In certain embodiments, glycosylation of the TREM2 agonist antigen binding proteins described herein is increased by adding one or more glycosylation sites, e.g., to the Fc region of the binding protein. Addition of glycosylation sites to the antigen binding protein can be conveniently accomplished by altering the amino acid sequence such that it contains one ormore of the above-described tri-peptide sequences (for N-linked glycosylates sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the starting sequence (for O-linked glycosylation sites). For ease, the antigen binding protein amino acid sequence may be altered through changes at the DNA level, particularly by mutating the DNA encoding the target polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
[0174] The invention also encompasses production of TREM2 antigen binding protein molecules with altered carbohydrate structure resulting in altered effector activity, including antigen binding proteins with absent or reduced fucosylation that exhibit improved ADCC activity. Various methods are known in the art to reduce or eliminate fucosylation. For example, ADCC effector activity is mediated by binding of the antibody molecule to the FcyRIII receptor, which has been shown to be dependent on the carbohydrate structure of the N-linked glycosylation at the N297 residue of the CH2 domain. Non-fucosylated antibodies bind this receptor with increased affinity and trigger FcyRIII-mediaied effector functions more efficiently than native, fucosylated antibodies. For example, recombinant production of non-fucosylated antibody in CHO cells in which the alpha-l,6-fucosyl transferase enzyme has been knocked out results in antibody with 100-fold increased ADCC activity (see Yamane-Ohnuki et al, Biotechnol Bioeng. 87(5):614-22, 2004). Similar effects can be accomplished through decreasing the activity of alpha- 1,6-fucosyl transferase enzyme or other enzymes in the fucosylation pathway, e.g., through siRNA or antisense RNA treatment, engineering cell lines to knockout the enzyme(s), or culturing with selective glycosylation inhibitors (see Rothman et al, Mol Immunol. 26(12): 1113-23, 1989). Some host cell strains, e.g. Lecl3 or rat hybridoma YB2 / 0 cell line naturally produce antibodies with lower fucosylation levels (see Shields et al, J Biol Che 277(30):26733-40, 2002 and Shinkawa et al, J Biol Chem. 278(5):3466-73, 2003). An increase in the level of bisected carbohydrate, e.g. through recombinantly producing antibody in cells that overexpress GnTIII enzyme, has also been determined to increase ADCC activity (see Umana et al, Nat Biotechnol.17(2): 176-80, 1999).
[0175] In other embodiments, glycosylation of the TREM2 agonist antigen binding proteins described herein is decreased or eliminated by removing one or more glycosylation sites, e.g., from the Fc region of the binding protein. In some embodiments, the TREM2 agonist antigen binding protein is an aglycosylated human monoclonal antibody, e.g. an aglycosylated human IgGl monoclonal antibody. Amino acid substitutions that eliminate or alter N-linkedglycosylation sites can reduce or eliminate N-linked glycosylation of the antigen binding protein. In certain embodiments, the TREM2 agonist antigen binding proteins described herein comprise a mutation at position N297 (according to EU numbering scheme), such as N297Q, N297A, or N297G. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise an Fc region from a human lgGl antibody with a mutation at position N297. In one particular embodiment, the TREM2 agonist antigen binding proteins of the invention comprise an Fc region from a human IgGl antibody with aN297G mutation. For instance, in some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain constant region comprising the sequence of SEQ ID NO: 202.
[0176] To improve the stability of molecules comprising aN297 mutation, the Fc region of the TREM2 agonist antigen binding proteins may be further engineered. For instance, in some embodiments, one or more amino acids in the Fc region are substituted with cysteine to promote disulfide bond formation in the dimeric state. Residues corresponding to V259, A287, R292, V302, L306, V323, or 1332 (according to EU numbering scheme) of an IgGl Fc region may thus be substituted with cysteine. Preferably, specific pairs of residues are substituted with cysteine such that they preferentially form a disulfide bond with each other, thus limiting or preventing disulfide bond scrambling. Preferred pairs include, but are not limited to, A287C and L306C, V259C and L306C, R292C and V302C, and V323C and I332C. In certain embodiments, the TREM2 agonist antigen binding proteins described herein comprise an Fc region from a human IgGl antibody with mutations R292C and V302C. In such embodiments, the Fc region may also comprise aN297 mutation, such as a N297G mutation. In some embodiments, the TREM2 agonist antigen binding proteins of H e invention comprise a heavy chain constant region comprising the sequence of SEQ ID NO: 203.
[0177] Modifications to the hinge region and / or CHI domain of the heavy chain and / or the constant region of the light chain of the TREM2 agonist antigen binding proteins (e.g.monoclonal antibodies) of the invention can be made to reduce or eliminate disulfide heterogeneity. Structural hetereogeneity of IgG2 antibodies has been observed where the disulfide bonds in the hinge and CHI regions of IgG2 antibodies can be shuffled to create different structural disulfide isoforms (IgG2A, IgG2B, and IgG2A-B), which can have different levels of activity. See, e.g., Dillon et al, J. Biol. Che , Vol. 283: 16206-16215; Martinez et al, Biochemistry, Vol. 47: 7496-7508, 2008; and White et al, Cancer Cell, Vol.27: 138-148, 2015. Amino acid substitutions can be made in the hinge region, CHI domain, and / or light chain constant region to promote the formation of a single disulfide isoform or lock the antigen binding protein (e.g. monoclonal antibody) into a particular disulfide isoform (e.g. IgG2A or IgG2B). Such mutations are described in WO 2009 / 036209 and White etal, Cancer Cell, Vol. 27: 138-148, 2015, both of which are hereby incorporated by reference in its entirely, and include CI 3 IS, C219S, and C220S (according to EU numbering scheme) mutations in the heavy chain and a C214S (according to EU numbering scheme) mutation in the light chain. In certain embod ments, the TREM2 agonist antigen binding proteins of the invention are human IgG2 anti-TREM2 agonist antibodies. In some such embodiments, the TREM2 agonist antibodies comprise a C 13 IS mutation (according to the EU numbering scheme) in their heavy chains. In other embodiments, the TREM2 agonist antibodies comprise a C214S mutation (according to the EU numbering scheme) in their light chains and a C220S mutation (according to the EU numbering scheme) in their heavy chains. In still other embodiments, the TREM2 agonist antibodies comprise a C214S mutation (according to the EU numbering scheme) in their light chains and a C219S mutation (according to the EU numbering scheme) in their heavy chains.
[0178] In other embodiments, the TREM2 agonist antigen binding proteins of the invention are anti-TREM2 agonist antibodies comprising a CHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody. The unique arrangement of the disulfide bonds in the hinge region of IgG2 antibodies has been reported to impart enhanced stimulatory activity for certain anticancer antibodies (White et al., Cancer Cell, Vol. 27: 138- 148, 2015). This enhanced activity could be transferred to IgGl -type antibodies by exchanging the CHI and hinge regions of the IgGl antibody for those in the IgG2 antibody (White etal, 2015). The IgG2 hinge region includes the amino acid sequenceERKCCVECPPCP (SEQ ID NO: 206). The amino acid sequence of the CHI and hinge regions from a human IgG2 antibody may comprise the amino acid sequence ofASTKGPSVFP LAPCSRSTSE STAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS GLYSLSSWT VPSSNFGTQT YTCNVDHKPS NTKVDKTVER KCCVECPPCP (SEQ ID NO: 207). Thus, in some embodiments, the anti-TREM2 agonist antibodies comprise the sequence of SEQ ID NO: 207 in combination with an Fc region from a human IgGl antibody. In such embodiments, the anti-TREM2 antibodies can comprise one or more of the mutations described above to lock the anti-TREM2 antibodies into a particular disulfide isoform For instance, in one embodiment, the anti-TREM2 antibody comprises aCHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody and comprises a C 13 IS mutation (according to the EU numbering scheme) in its heavy chain. In another embodiment, the anti-TREM2 antibody comprises a CHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody and comprises a C214S mutation (according to the EU numbering scheme) in its light chain and a C220S mutation (according to the EU numbering scheme) in its heavy chain. In yet another embodiment, the anti-TREM2 antibody comprises a CHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody and comprises a C214S mutation (according to the EU numbering scheme) in its light chain and a C219S mutation (according to the EU numbering scheme) in its heavy chain.
[0179] In embodiments in which the anti-TREM2 antibodies comprise a CHI region and hinge region from a human lgG2 antibody and an Fc region from a human IgGl antibody, the anti-TREM2 antibodies may comprise any of the mutations in the Fc region described above to modulate the glycosylation of the antibodies. For instance, the human IgGl Fc region of such anti-TREM2 antibodies may comprise a mutation at amino acid position N297(according to the EU numbering scheme) in its heavy chain. In one particular embodiment, the N297 mutation is a N297G mutation. In certain embodiments, the Fc region may further comprise R292C and V302C mutations (according to the EU numbering scheme) in its heavy chain.
[0180] In certain embodiments, the anti-TREM2 antibodies of the invention comprise a CHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody, wherein the Fc region comprises the amino acid sequence of:APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYGSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIE^SKAKGQPREPQVYTXPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 281).
[0181] In other embodiments, the anti-TREM2 antibodies of the invention comprise a CHI region and hinge region from a human IgG2 antibody and an Fc region from a human IgGl antibody, wherein the Fc region comprises the amino acid sequence of:APELLGGPSVFLFPPKPKDTXMSRTTEVTCVWDVSHEDPEVKFNWY VDGVEVHNAKTKPCEEQYGSTYRCVSVLTVLHQDWLNGKEYKCKVS NKALPAPIE^SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 282).
[0182] Modifications of the TREM2 agonist antigen binding proteins of the invention to increase serum half-life also may desirable, for example, by incorporation of or addition of a salvage receptor binding epitope (e.g., by mutation of the appropriate region or by incorporating the epitope into a peptide tag that is then fused to the antigen binding protein at either end or in the middle, e.g., by DNA or peptide synthesis; see, e.g., W096 / 32478) or adding molecules such as PEG or other water soluble polymers, including polysaccharide polymers. The salvage receptor binding epitope preferably constitutes a region wherein any one or more amino acid residues from one or two loops of an Fc region are transferred to an analogous position in the antigen binding protein. Even more preferably, three or more residues from one or two loops of the Fc region are transferred. Still more preferred, the epitope is taken from the CH2 domain of the Fc region (e.g., an IgG Fc region) and transferred to the CHI , CH3, or VH region, or more than one such region, of the antigen binding protein. Alternatively, the epitope is taken from the CH2 domain of the Fc region and transferred to the CL region or VL region, or both, of the antigen binding protein. SeeInternational applications WO 97 / 34631 and WO 96 / 32478 for a description of Fc variants and their interaction with the salvage receptor.
[0183] In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising the sequence of SEQ ID NO: 334 and a heavy chain comprising the sequence of SEQ ID NO: 335. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising the sequence of SEQ ID NO: 334 and a heavy chain comprising the sequence of SEQ ID NO: 336. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising the sequence of SEQ ID NO: 337 and a heavy chain comprising the sequence of SEQ ID NO: 338. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising the sequence of SEQ ID NO: 339 and a heavy chain comprising the sequence of SEQ ID NO: 340. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain comprising the sequence of SEQ ID NO: 341 and a heavy chain comprising the sequence of SEQ ID NO: 342.
[0184] In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a light chain consisting of or consisting essentially of the amino acid sequence ofSEQ ID NO: 334, 337, 339 or 341. In some embodiments, the TREM2 agonist antigen binding proteins of the invention comprise a heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 335, 336, 338, 340, or 342. In a specific embodiment, the TREM2 agonist antigen binding proteins of the invention comprise a light chain and a heavy chain, wherein (a) the light chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 334 and the heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 335; (b) the light chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 334 and the heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 336; (c) the light chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 337 and the heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 338; (d) the light chain consisting of or consisting of essentially of the amino acid sequence of SEQ ID NO: 339 and the heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 340; or (e) the light chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 341 and the heavy chain consisting of or consisting essentially of the amino acid sequence of SEQ ID NO: 342.
[0185] In some embodiments, the TREM2 agonist antigen binding proteins of the invention are "bispecific" meaning that they are capable of specifically binding to two different antigens, human TREM2 and a second antigen. In certain embodiments, the second antigen is a protein that facilitates transport across the blood-brain barrier, such as a receptor that mediates blood-brain barrier transport. Such receptors include, but are not limited to, the insulin receptor, the transferrin receptor, the leptin receptor, the insulin-like growth factor (IGF) receptor, low density lipoprotein receptors (e.g. low density lipoprotein receptor- related protein 8 (LRP8), low density lipoprotein receptor-related protein 1 (LRP1), low density lipoprotein receptor-related protein 2(LRP2)), heparin-binding epidermal growth factor-like growth factor, CD98 heavy chain (CD98hc), basigin, the human transmembrane protein 30A (TMEM30A), and Glucose Transporter Type 1 (Glutl). In one embodiment, the second antigen is the human insulin receptor. In one embodiment, the second antigen is the human insulin-like growth receptor. In another embodiment, the second antigen is the human transferrin receptor. In one embodiment, the second antigen is TMEM30A. In any of these instances, the human TREM2 binding domain could be at the N-terminal end or the C- terminal end of the multivalent bispecific (IgG-Fab, IgG-scFv), or expressed in the multi-specific binding formats described in Spiess, C. et al., Molecular Immunology 67, 95-106 (2015) and Brinkman, U. etal, MABS 9(2)182-212 (2017).
[0186] In certain embodiments, the TREM2 agonist antigen binding proteins are multivalent. The valency of the binding protein denotes the number of individual antigen binding domains within the binding protein. For example, the terms "monovalent," "bivalent," and"tetravalent" with reference to the antigen binding proteins of the invention refer to binding proteins with one, two, and four antigen binding domains, respectively. Thus, a multivalent antigen binding protein comprises two or more antigen binding domains. In some embodiments, the bispecific antigen binding proteins of the invention are bivalent. Thus, such bispecific, bivalent antigen binding proteins contain two antigen binding domains: one antigen-binding domain binding to human TREM2 and one antigen-binding domain binding to a second antigen, such as an antigen that facilitates transport across the blood-brain barrier. In other embodiments, the bispecific antigen binding proteins are multivalent. For instance, in certain embodiments, the bispecific antigen binding proteins are trivalent or tetravalent comprising three or four antigen-binding domains: one or two antigen-binding domains binding to human TREM2 and one or two antigen-binding domains binding to a second antigen, such as an antigen that facilitates transport across the blood-brain barrier.
[0187] The term "antigen binding domain," which is used interchangeably with "binding domain," refers to the region of the antigen binding protein that contains the amino acid residues that interact with the antigen and confer on the antigen binding protein its specificity and affinity for the antigen. The binding domain may be derived from an antibody or functional fragment thereof that specifically binds to the antigen. In certain embodiments, the bispecific antigen binding proteins of the invention comprise one antigen-binding domain binding to human TREM2 and one antigen-binding domain binding to the human insulin receptor. In other embodiments, the bispecific antigen binding proteins of the invention comprise one antigen-binding domain binding to human TREM2 and one antigen-binding domain binding to the human transferrin receptor. In some embodiments, the bispecific antigen binding proteins of the invention comprise two antigen-binding domains binding to human TREM2 and two antigen-binding domains binding to the human insulin receptor. In other embodiments, the bispecific antigen binding proteins of the invention comprise two antigen-binding domains binding to human TREM2 and two antigen-binding domains binding to the human transferrin receptor. In one embodiment, the bispecific antigen binding proteins of the invention comprise one or two antigen-binding domains binding to humanTREM2 and one or two antigen-binding domains binding to the human insulin-like growth receptor. In one embodiment, the bispecific antigen binding proteins of the invention comprise one or two antigen-binding domains binding to human TREM2 and one or two antigen-binding domains binding to TMEM30A. The antigen binding domains binding to human TREM2 of the bispecific TREM2 agonist antigen binding proteins can be derived from any of the anti-TREM2 agonist antibodies described herein. The antigen binding domains binding to the human insulin receptor, the human insulin like growth receptor, TMEM30A, or the human transferrin receptor can be derived from monoclonal antibodies to these receptors known in the art, such as those described in US Patent No. 7,388,079; US Patent No. 8,663,598; and US Patent Publication No. 2015 / 0110791, Abulrob, A etai, J. Newochem. 95, 1201-1214 (2005), and Muruganandam, A. et al, FASEBJ. 16, 240-242 (2002). In certain embodiments, the antigen binding domains binding to the human insulin receptor, the human insulin like growth receptor, TMEM30A, or the human transferrin receptor is a single domain antibody. In certain embodiments, the human TREM2 binding domain is at the N-terminal end or the C -terminal end of die multivalent bispecific (IgG-Fab, IgG-scFv), or expressed in the multi-specific binding formats known in the art, such as those described in Spiess, C. et al., Molecular Immunology 67, 95-106 (2015) and Brinkman, U. et al., MABS 9(2)182-212 (2017).
[0188] Methods of making bispecific antibodies are known in the art. One such method of making a "bispecific" antigen binding protein or antibody involves the fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321; Kostelny etal, 1992, J. Immunol. 148:1547-1553. Another method involves engineering the Fc portion of the heavy chains such as to create "knobs" and "holes" which facilitate heterodimer formation of the heavy chains when co-expressed in a cell. See, e.g., WO 96 / 027011. Still another method also involves engineering the Fc portion of the heavy chain but uses electrostatic steering to encourage heterodimer formation while discouraging homodimer formation of the heavy chains when co-expressed in a cell. See, e.g.,WO2009089004 and WO2014081955.
[0189] The present invention includes one or more isolated polynucleotides or isolated nucleic acids encoding the TREM2 agonist antigen binding proteins, such as the anti-TREM2 agonist monoclonal antibodies, described herein. In addition, the present invention encompasses vectors comprising the nucleic acids, host cells or cell lines comprising the nucleic acids, and methods of making the antigen binding proteins of the invention. Thenucleic acids comprise, for example, polynucleotides that encode all or part of an antigen binding protein, for example, one or both chains of an antibody of the invention, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense oligonucleotides for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing. The nucleic acids can be any length as appropriate for the desired use or function, and can comprise one or more additional sequences, for example, regulatory sequences, and / or be part of a larger nucleic acid, for example, a vector. Nucleic acid molecules of the invention include DNA and RNA in both single-stranded and double-stranded form, as well as the corresponding complementary sequences. DNA includes, for example, cDNA, genomic DNA, chemically synthesized DNA, DNA amplified by PCR, and combinations thereof. The nucleic acid molecules of the invention include full-length genes or cDNA molecules as well as a combination of fragments thereof. The nucleic acids of the invention can be derived from human sources as well as non-human species.
[0190] Relevant amino acid sequences from an immunoglobulin or region thereof (e.g.variable region, Fc region, etc.) or polypeptide of interest may be determined by direct protein sequencing, and suitable encoding nucleotide sequences can be designed according to a universal codon table. Alternatively, genomic or cDNA encoding monoclonal antibodies or binding fragments thereof of the invention can be isolated and sequenced from cells producing such antibodies (e.g. hybridomas) using conventional procedures, such as the methods described in Example 3.
[0191] An "isolated nucleic acid," which is used interchangeably herein with "isolated polynucleotide," is a nucleic acid that has been separated from adjacent genetic sequences present in the genome of the organism from which the nucleic acid was isolated, in the case of nucleic acids isolated from naturally-occurring sources. In the case of nucleic acids synthesized enzymatically from a template or chemically, such as PCR products, cDNA molecules, or oligonucleotides for example, it is understood that the nucleic acids resulting from such processes are isolated nucleic acids. An isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct. In one preferred embodiment, the nucleic acids are substantially free from contaminating endogenous material. The nucleic acid molecule has preferably been derived from DNA or RNA isolated at least once in substantially pure form and in a quantityor concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in Sambrook el al, Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989)). Such sequences are preferably provided and / or constructed in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non-translated DNA can be present 5' or 3' from an open reading frame, where the same do not interfere with manipulation or expression of the coding region. Unless specified otherwise, the left-hand end of any single-stranded polynucleotide sequence discussed herein is the 5' end; the left- hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction. The direction of 5' to 3' production of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences."
[0192] The present invention also includes nucleic acids that hybridize under moderately stringent conditions, and more preferably highly stringent conditions, to nucleic acids encoding polypeptides as described herein. The basic parameters affecting the choice of hybridization conditions and guidance for devising suitable conditions are set forth by Sambrook,, Fritsch, and Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11; and Current Protocols in Molecular Biology, 1995, Ausubel et al., eds., John Wiley & Sons, Inc., sections 2.10 and 6.3-6.4), and can be readily determined by those having ordinary skill in the art based on, for example, the length and / or base composition of the DNA. One way of achieving moderately stringent conditions involves the use of a prewashing solution containing 5 x SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6 x SSC, and a hybridization temperature of about 55°C (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of about 42°C), and washing conditions of about 60°C, in 0.5 x SSC, 0.1% SDS. Generally, highly stringent conditions are defined as hybridization conditions as above, but with washing at approximately 68°C, 0.2 x SSC, 0.1% SDS. SSPE (1 x SSPE is 0.15M NaCl, 10 mMNaH2P04, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC 0 SSC is 0.15M NaCland 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for IS minutes after hybridization is complete. It should be understood that the wash temperature and wash salt concentration can be adjusted as necessary to achieve a desired degree of stringency by applying the basic principles that govern hybridization reactions and duplex stability, as known to those skilled in the art and described further below (see, e.g., Sambrook etai, 1989).
[0193] When hybridizing a nucleic acid to a target nucleic acid of unknown sequence, the hybrid length is assumed to be that of the hybridizing nucleic acid. When nucleic acids of known sequence are hybridized, the hybrid length can be determined by aligning the sequences of the nucleic acids and identifying the region or regions of optimal sequence complementarily. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be S to 10°C less than the melting temperature (Tm) of the hybrid, where Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm (°C) = 2(# of A + T bases) + 4(# of G + C bases). For hybrids above 18 base pairs in length, Tm (°C) = 81.5 + 16.6(logl0 [Na+]) + 0.41(% G + C) - (600 / N), where N is the number of bases in the hybrid, and [ a+] is the concentration of sodium ions in the hybridization buffer ([Na+] for 1 x SSC = 0.165M). Preferably, each such hybridizing nucleic acid has a length that is at least 15 nucleotides (or more preferably at least 18 nucleotides, or at least 20 nucleotides, or at least 25 nucleotides, or at least 30 nucleotides, or at least 40 nucleotides, or most preferably at least 50 nucleotides), or at least 25% (more preferably at least 50%, or at least 60%, or at least 70%, and most preferably at least 80%) of the length of the nucleic acid of the present invention to which it hybridizes, and has at least 60% sequence identity (more preferably at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, and most preferably at least 99.5%) with the nucleic acid of the present invention to which it hybridizes, where sequence identity is determined by comparing the sequences of the hybridizing nucleic acids when aligned so as to maximize overlap and identity while minimizing sequence gaps as described in more detail above.
[0194] Variants of the antigen binding proteins, including the variants described herein, can be prepared by site-specific mutagenesis of nucleotides in the DNA encoding thepolypeptide, using cassette or PCR mutagenesis or other techniques well known in the art, toproduce DNA encoding the variant, and thereafter expressing the recombinant DNA in cell culture as outlined herein. However, antigen binding proteins comprising variant CDRs having up to about 100-150 residues may be prepared by in vitro synthesis using established techniques. The variants typically exhibit the same qualitative biological activity as the naturally occurring analogue, e.g., binding to antigen. Such variants include, for example, deletions and / or insertions and / or substitutions of residues within the amino acid sequences of the antigen binding proteins. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the antigen binding protein, such as changing the number or position of glycosylation sites. In certain embodiments, antigen binding protein variants are prepared with the intent to modify those amino acid residues which are directly involved in epitope binding. In other embodiments, modification of residues which are not directly involved in epitope binding or residues not involved in epitope binding in any way, is desirable, for purposes discussed herein. Mutagenesis within any of the CDR regions, framework regions, and / or constant regions is contemplated. Covariance analysis techniques can be employed by the skilled artisan to design useful modifications in the amino acid sequence of the antigen binding protein. See, e.g., Choulier, etal, Proteins 41 :475-484, 2000; Demarest etal, J. Mol. Biol. 335:41-48, 2004; Hugo etal, Protein Engineering 16(5):381-86, 2003; Aurora et al, US Patent Publication No. 2008 / 0318207 Al ; Glaser et al, US Patent Publication No.2009 / 0048122 Al; Urech etal, WO 2008 / 1 10348 Al; Borras etal, WO 2009 / 000099 A2. Such modifications determined by covariance analysis can improve potency,pharmacokinetic, pharmacodynamic, and / or manufacturability characteristics of an antigen binding protein.
[0195] Table 6 shows exemplary nucleic acid sequences encoding the light and heavy chain variable regions of anti-TREM2 antibodies described herein. Polynucleotides encoding the anti-TREM2 antibody variable regions can be used to construct the antigen binding proteins described herein.Table 6. Exemplary Anti-TREM2 Antibody Variable Region Nucleic Acid Sequences
[0196] Isolated nucleic acids encoding the anti-TREM2 binding domain of the antigen binding proteins of the invention may comprise a nucleotide sequence that is at least 80% identical, at least 90% identical, at least 95% identical, or at least 98% identical to any of the nucleotide sequences listed in Table 6. In some embodiments, an isolated nucleic acid encoding an anti-TREM2 antibody light chain variable region comprises a sequence that is at least 80% identical, at least 90% identical, at least 95% identical, or at least 98% identical to a sequence selected from SEQ ID NOs: 208-236 and 313-318. In certain embodiments, an isolated nucleic acid encoding an anti-TREM2 antibody light chain variable region comprises a sequence selected from SEQ ID NOs: 208-236 and 313-318. In related embodiments, an isolated nucleic acid encoding an anti-TREM2 antibody heavy chain variable region comprises a sequence that is at least 80% identical, at least 90% identical, at least 95% identical, or at least 98% identical to a sequence selected from SEQ ID NOs: 237-264 and 319-325. In other related embodiments, an isolated nucleic acid encoding an anti-TREM2 antibody heavy chain variable region comprises a sequence selected from SEQ ID NOs: 237- 264 and 319-325.
[0197] The nucleic acid sequences provided in Table 6 are exemplary only. As will be appreciated by those in the art, due to the degeneracy of the genetic code, an extremely largenumber of nucleic acids may be made, all of which encode the CDRs, variable regions, and heavy and light chains or other components of the antigen binding proteins described herein. Thus, having identified a particular amino acid sequence, those skilled in the art could make any number of different nucleic acids, by simply modifying the sequence of one or more codons in a way which does not change the amino acid sequence of the encoded protein.
[0198] The present invention also includes vectors comprising one or more nucleic acids encoding one or more components of the antigen binding proteins of the invention (e.g. variable regions, light chains, and heavy chains). The term "vector" refers to any molecule or entit (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell. Examples of vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors. The term "expression vector" or "expression construct" as used herein refers to a recombinant DNA molecule containing a desired coding sequence and appropriate nucleic acid control sequences necessary for the expression of the operably linked coding sequence in a particular host cell. An expression vector can include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto. Nucleic acid sequences necessary for expression in prokaryotes include a promoter, optionally an operator sequence, a ribosome binding site and possibly other sequences. Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals. A secretory signal peptide sequence can also, optionally, be encoded by the expression vector, operably linked to the coding sequence of interest, so that the expressed polypeptide can be secreted by the recombinant host cell, for more facile isolation of the polypeptide of interest from the cell, if desired. For instance, in some embodiments, signal peptide sequences may beappended / fused to the amino terminus of any of the variable region polypeptide sequences listed in Tables 1A, IB, 2 A, 2B, 3 A, and 3B. In certain embodiments, a signal peptide having the amino acid sequence of MDMRVP AQLLGLLLLWLRGARC (SEQ ID NO: 265) is fused to the amino terminus of any of the variable region polypeptide sequences in Tables 1 A, IB, 2A, 2B, 3A, and 3B. In other embodiments, a signal peptide having the amino acid sequence of MAWALLLLTLLTQGTGSW A (SEQ ID NO: 266) is fused to the amino terminus of any of the variable region polypeptide sequences in Tables 1 A, IB, 2A, 2B, 3A, and 3B. In still other embodiments, a signal peptide having the amino acid sequence of MTCSPLLLTLLIHCTGSWA (SEQ ID NO: 267) is fused to the amino terminus of any ofthe variable region polypeptide sequences in Tables 1 A, IB, 2A, 2B, 3 A, and 3B. Other suitable signal peptide sequences that can be fused to the amino terminus of the variable region polypeptide sequences described herein include: MEAPAQLLFLLLLWLPDTTG (SEQ ID NO: 268), MEWTWRVLFLVAAATGAHS (SEQ ID NO: 269),METPAQLLFLLLLWLPDTTG (SEQ ID NO: 270), KHLWFFLLLVAAPRWVLS (SEQ ID NO: 272), MEWSWVFLFFLSVTTGVHS (SEQ ID NO: 273),MDIRAPTQLLGLLLLWLPGAKC (SEQ ID NO: 274), MDIRAPTQLLGLLLLWLPGARC (SEQ ID NO: 275), MDTRAPTQLLGLLLLWLPGATF (SEQ ID NO: 276),MDTRAPTQLLGLLLLWLPGARC (SEQ ID NO: 277), METGLRWLLLVAVLKGVQC (SEQ ID NO: 278), METGLRWLLLVAVL GVQCQE (SEQ ID NO: 279), andMDMRAPTQLLGLLLLWLPGARC (SEQ ID NO: 280). Other signal or secretory peptides are known to those of skill in the art and may be fused to any of the variable region polypeptide chains listed in Tables 1 A, IB, 2A, 2B, 3 A, and 3B, for example, to facilitate or optimize expression in particular host cells.
[0199] Typically, expression vectors used in the host cells to produce the TREM2 agonist antigen binding proteins of the invention will contain sequences for plasmid maintenance and for cloning and expression of exogenous nucleotide sequences encoding the components of the antigen binding proteins. Such sequences, collectively referred to as "flanking sequences," in certain embodiments will typically include one or more of the following nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. Each of these sequences is discussed below.
[0200] Optionally, the vector may contain a "tag"-encoding sequence, i.e., an oligonucleotide molecule located at the 5' or 3' end of the polypeptide coding sequence; the oligonucleotide tag sequence encodes polyHis (such as hexaHis), FLAG, HA (hemaglutinin influenza A ms), myc, or another "tag" molecule for which commercially available antibodies exist. This tag is typically fused to the polypeptide upon expression of the polypeptide, and can serve as a means for affinity purification or detection of the polypeptide from the host cell. Affinity purification can be accomplished, for example, by column chromatography using antibodiesagainst the tag as an affinity matrix. Optionally, the tag can subsequently be removed from the purified polypeptide by various means such as using certain peptidases for cleavage.
[0201] Flanking sequences may be homologous (i.e., from the same species and / or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of flanking sequences from more than one source), synthetic or native. As such, the source of a flanking sequence may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the flanking sequence is functional in, and can be activated by, the host cell machinery.
[0202] Flanking sequences useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, flanking sequences useful herein will have been previously identified by mapping and / or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of a flanking sequence may be known. Here, the flanking sequence may be synthesized using routine methods for nucleic acid synthesis or cloning.
[0203] Whether all or only a portion of the flanking sequence is known, it may be obtained using polymerase chain reaction (PCR) and / or by screening a genomic library with a suitable probe such as an oligonucleotide and / or flanking sequence fragment from the same or another species. Where the flanking sequence is not known, a fragment of DNA containing a flanking sequence may be isolated from a larger piece of DNA that may contain, for example, a coding sequence or even another gene or genes. Isolation may be accomplished by restriction endonuclease digestion to produce the proper DNA fragment followed by isolation using agarose gel purification, Qiagen® column chromatography (Chatsworth, CA), or other methods known to the skilled artisan. The selection of suitable enzymes to accomplish this purpose will be readily apparent to one of ordinary skill in the art.
[0204] An origin of replication is typically a part of those prokaryotic expression vectors purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector. For example, the origin of replication from the plasmid pBR322 (New England Biolabs, Beverly, MA) is suitable for most gram-negative bacteria, and various viral origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells. Generally, the origin of replication component is notneeded for mammalian expression vectors (for example, the SV40 origin is often used only because it also contains the virus early promoter).
[0205] A transcription termination sequence is typically located 3' to the end of a polypeptide coding region and serves to terminate transcription. Usually, a transcription termination sequence in prokaryotic cells is a G-C rich fragment followed by a poly-T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using known methods for nucleic acid synthesis.
[0206] A selectable marker gene encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells; (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex or defined media Specific selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, and the tetracycline resistance gene. Advantageously, a neomycin resistance gene may also be used for selection in both prokaryotic and eukaryotic host cells.
[0207] Other selectable genes may be used to amplify the gene that will be expressed.Amplification is the process wherein genes that are required for production of a protein critical for growth or cell survival are reiterated in tandem within the chromosomes of successive generations of recombinant cells. Examples of suitable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and promoterless thymidine kinase genes. Mammalian cell transformants are placed under selection pressure wherein only the transformants are uniquely adapted to survive by virtue of the selectable gene present in the vector. Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively increased, thereby leading to the amplification of both the selectable gene and the DNA that encodes another gene, such as one or more components of the antigen binding proteins described herein. As a result, increased quantities of a polypeptide are synthesized from the amplified DNA.
[0208] A ribosome-binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes). The element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed. In certain embodiments, one or more coding regions may beoperably linked to an internal ribosome binding site (IRES), allowing translation of two open reading frames from a single RNA transcript.
[0209] In some cases, such as where glycosylation is desired in a eukaryotic host cell expression system, one may manipulate the various pre- or prosequences to improve glycosylation or yield. For example, one may alter the peptidase cleavage site of a particular signal peptide, or add prosequences, which also may affect glycosylation. The final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed. For example, the final protein product may have one or two amino acid residues found in the peptidase cleavage site, attached to the ammo-terminus. Alternatively, use of some enzyme cleavage sites may result in a slightly truncated form of the desiredpolypeptide, if the enzyme cuts at such area within the mature polypeptide.
[0210] Expression and cloning vectors of the invention will typically contain a promoter that is recognized by the host organism and operably linked to the molecule encoding the polypeptide. The term "operably linked" as used herein refers to the linkage of two or more nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and / or the synthesis of a desired protein molecule is produced. For example, a control sequence in a vector that is "operably linked" to a protein coding sequence is ligated thereto so that expression of the protein coding sequence is achieved under conditions compatible with the transcriptional activity of the control sequences. More specifically, a promoter and / or enhancer sequence, including any combination of cis-acting transcriptional control elements is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system
[0211] Promoters are non-transcribed sequences located upstream (i.e., 5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control transcription of the structural gene. Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters. Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature. Constitutive promoters, on the other hand, uniformly transcribe a gene to which they are operably linked, that is, with little or no control over gene expression. A large number of promoters, recognized by a variety of potential host cells, are well known. A suitable promoter isoperably linked to the DNA encoding e.g., heavy chain, light chain, or other component of the antigen binding proteins of the invention, by removing the promoter from the source DNA by restriction enzyme digestion and inserting the desired promoter sequence into the vector.
[0212] Suitable promoters for use with yeast hosts are also well known in the art. Yeast enhancers are advantageously used with yeast promoters. Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such asAdenovirus serotypes 2, 8 or 9), bovine papilloma virus, avian sarcoma virus,cytomegalovirus, retroviruses, hepatitis-B virus and Simian Virus 40 (SV40). Other suitable mammalian promoters include heterologous mammalian promoters, for example, heat-shock promoters and the actin promoter.
[0213] Additional promoters which may be of interest include, but are not limited to: SV40 early promoter (Benoist and Chambon, 1981, Nature 290:304-310); CMV promoter(Thornsen et al., 1984, Proc. Natl. Acad. U.S.A. 81:659-663); the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787-797); herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78: 1444-1445); promoter and regulatory sequences from the metallothionine gene Prinster et al., 1982, Nature 296:39-42); and prokaryotic promoters such as the beta-lactamase promoter (Villa-Kamaroff et al., 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731); orthe tac promoter (DeBoer et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:21-25). Also of interest are the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: the elastase I gene control region that is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); the insulin gene control region that is active in pancreatic beta cells (Hanahan, 1985, Nature 315: 115-122); the immunoglobulin gene control region that is active in lymphoid cells(Grosschedl et al., 1984, Cell 38:647-658; Adames et al., 1985, Nature 318:533-538;Alexander et al., 1987, Mol. Cell. Biol. 7: 1436-1444); the mouse mammary tumor virus control region that is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495); the albumin gene control region that is active in liver (Pinkert et al., 1987, Genes and Devel. 1:268-276); the alpha-feto-protein gene control region that is active in liver ( rumlauf et al., 1985, Mol. Cell. Biol. 5: 1639-1648; Hammer et al., 1987, Science 253:53-58); the alpha 1-antitiypsin gene control region that is active in liver (Kelsey et al., 1987, Genes and Devel. 1: 161-171); the beta-globin gene control region that is active in myeloid cells (Mogram et al, 1985, Nature 315:338-340; Kollias et al, 1986, Cell 46:89-94); the myelin basic protein gene control region that is active in oligodendrocyte cells in the brain (Readhead et al., 1987, Cell 48:703-712); the myosin light chain-2 gene control region that is active in skeletal muscle (Sani, 1985, Nature 314:283-286); and the gonadotropic releasing hormone gene control region that is active in the hypothalamus (Mason et al., 1986, Science 234: 1372-1378).
[0214] An enhancer sequence may be inserted into the vector to increase transcription of DNA encoding a component of the antigen binding proteins (e.g., light chain, heavy chain, or variable regions) by higher eukaryotes. Enhancers are cis-acting elements of DNA, usually about 10-300 bp in length, that act on the promoter to increase transcription. Enhancers are relatively orientation and position independent, having been found at positions both 5' and 3' to the transcription unit Several enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto-protein and insulin). Typically, however, an enhancer from a virus is used. The SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers known in the art are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be positioned in the vector either 5' or 3' to a coding sequence, it is typically located at a site 5' from the promoter. A sequence encoding an appropriate native or heterologous signal sequence (leader sequence or signal peptide) can be incorporated into an expression vector, to promote extracellular secretion of the antigen binding protein. The choice of signal peptide or leader depends on the type of host cells in which the antigen binding protein is to be produced, and a heterologous signal sequence can replace the native signal sequence.Examples of signal peptides are described above. Other signal peptides that are functional in mammalian host cells include the signal sequence for interleukin-7 (IL-7) described in US Patent No. 4,965,195; the signal sequence for interleukin-2 receptor described in Cosman et al, 1984, Nature 312:768; the interleukin-4 receptor signal peptide described in EP Patent No. 0367 566; the type I interleukin-l receptor signal peptide described in U.S. Patent No.4,968,607; the type 11 interleulrin-1 receptor signal peptide described in EP Patent No. 0460 846.
[0215] The expression vectors may be constructed from a starting vector such as a commercially available vector. Such vectors may or may not contain all of the desiredflanking sequences. Where one or more of the flanking sequences described herein are not already present in the vector, they may be individually obtained and ligated into the vector. Methods used for obtaining each of the flanking sequences are well known to one skilled in the art. The expression vectors can be introduced into host cells to thereby produce proteins, including fusion proteins, encoded by nucleic acids as described herein.
[0216] In certain embodiments, nucleic acids encoding the different components of the TREM2 agonist antigen binding proteins of the invention may be inserted into the same expression vector. For instance, the nucleic acid encoding an anti-TREM2 antibody light chain or variable region can be cloned into the same vector as the nucleic acid encoding an anti-TREM2 antibody heavy chain or variable region. In such embodiments, the two nucleic acids may be separated by an internal ribosome entry site (IRES) and under the control of a single promoter such that the light chain and heavy chain are expressed from the same mRNA transcript. Alternatively, the two nucleic acids may be under the control of two separate promoters such that the light chain and heavy chain are expressed from two separate mRNA transcripts. In some embodiments, the nucleic acid encoding the anti-TREM2 antibody light chain or variable region is cloned into one expression vector and the nucleic acid encoding the anti-TREM2 antibody heavy chain or variable region is cloned into a second expression vector. In such embodiments, a host cell may be co-transfected with both expression vectors to produce complete antigen binding proteins of the invention.
[0217] After the vector has been constructed and the one or more nucleic acid molecules encoding the components of the antigen binding proteins described herein has been inserted into the proper site(s) of the vector or vectors, the completed vector(s) may be inserted into a suitable host cell for amplification and / or polypeptide expression. Thus, the present invention encompasses an isolated host cell or cell line comprising one or more expression vectors encoding the components of the TREM2 agonist antigen binding proteins described herein. The term "host cell" as used herein refers to a cell that has been transformed, or is capable of being transformed, with a nucleic acid and thereby expresses a gene of interest. The term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present. A host cell that comprises an isolated nucleic acid of the invention, preferably operably linked to at least one expression control sequence (e.g. promoter or enhancer), is a "recombinant host cell."
[0218] The transformation of an expression vector for an antigen binding protein into a selected host cell may be accomplished by well-known methods including transfection, infection, calcium phosphate co-precipitation, electroporation, microinjection, lipofection, DEAE-dextran mediated transfection, or other known techniques. The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan, and are set forth, for example, in Sambrook et a / ., 2001.
[0219] A host cell, when cultured under appropriate conditions, synthesizes an antigen binding protein that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted). The selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
[0220] Exemplary host cells include prokaryote, yeast, or higher eukaryote cells. Prokaryotic host cells include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacillus, such as B. subtilis and B. licheniformis, Pseudomonas, and Streptomyces. Eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for recombinant polypeptides. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Pichia, e.g. P. pastoris, Schizosaccharomyces pombe; Kluyveromyces, Yarrowia; Candida; Trichoderma reesia; Neurospora crassa;Schwanniomyces, such as Schwanniomyces occidentalis; and filamentous fungi, such as, e.g., Neurospora, Penicillium, Tolypocladium, mi Aspergillus hosts such as A. nidulans and A. niger.
[0221] Host cells for the expression of glycosylated antigen binding proteins can be derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have beenidentified. A variety of viral strains for transfection of such cells are publicly available, e.g., the L-l variant of Autograp a californica NPV and the Bm-5 strain of Bombyx mori NPV.
[0222] Vertebrate host cells are also suitable hosts, and recombinant production of antigen binding proteins from such cells has become routine procedure. Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to Chinese hamster ovary (CHO) cells, including CHOKl cells (ATCC CCL61), DXB-11, DG-44, and Chinese hamster ovary cells / -DHFR (CHO, Urlaub et al, Proc. Natl. Acad. Sci. USA 77: 4216, 1980); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, (Graham et al, J. Gen Virol. 36: 59, 1977); baby hamster kidney cells (BHK, ATCC CCL 10); mouse Sertoli cells (TM4, Mather, Biol. Reprod. 23: 243-251, 1980); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human hepatoma cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y Acad. Sci. 383: 44-68, 1982); MRC 5 cells or FS4 cells; mammalian myeloma cells, and a number of other cell lines. In certain embodiments, cell lines may be selected through determining which cell lines have high expression levels and constitutively produce antigen binding proteins with human TREM2 binding properties. In another embodiment, a cell line from the B cell lineage that does not make its own antibody but has a capacity to make and secrete a heterologous antibody can be selected. CHO cells are preferred host cells in some embodiments for expressing the TREM2 agonist antigen binding proteins of the invention.
[0223] Host cells are transformed or transfected with the above-described nucleic acids or vectors for production of TREM2 agonist antigen binding proteins and are cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences. In addition, novel vectors and transfected cell lines with multiple copies of transcription units separated by a selective marker are particularly useful for the expression of antigen binding proteins. Thus, the present invention also provides a method for producing a TREM2 agonist antigen binding protein described herein, such as an anti-TREM2 agonist monoclonal antibody or bindingfragment thereof, comprising culturing a host cell comprising one or more expression vectors described herein in a culture medium under conditions permitting expression of the antigen binding protein encoded by the one or more expression vectors; and recovering the antigen binding protein from the culture medium or host cell.
[0224] The host cells used to produce the antigen binding proteins of the invention may be cultured in a variety of media Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium (MEM, Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium (DMEM, Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al, Meth. Enz. 58: 44, 1979; Barnes et al, Anal. Biochem 102: 255, 1980; U.S. Patent Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO90103430; WO 87 / 00195; or U.S. Patent Re. No. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and / or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as Gentamycin™ drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinary skilled artisan.[022S] Upon culturing H e host cells, the antigen binding protein can be produced intracellularly, in the periplasmic space, or directly secreted into the medium If the antigen binding protein is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. The antigen binding protein can be purified using, for example, hydroxyapatite chromatography, cation or anion exchange chromatography, size-exclusion chromatography, or preferably affinity chromatography, using the antigen(s) of interest or protein A or protein G as an affinity ligand. Protein A can be used to purify proteins that include polypeptides that are based on human immunoglobulin γΐ, γ2, or γ4 heavy chains (Lindmark et al, J. Immunol. Meth. 62: 1-13, 1983). Protein G is recommended for all mouse isotypes and for human immunoglobulin γ3 (Guss et al, EMBO J. 5: 15671575, 1986). The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the protein comprises a CH3 domain, the Bakerbond ABX™ resin (J. T. Baker, Phillipsburg, N.J.) is useful for purification. Other techniques for protein purification such as ethanol precipitation, Reverse Phase HPLC, chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also possible depending on the particular antigen binding protein to be recovered.
[0226] In certain embodiments, the invention provides a composition (e.g. a pharmaceutical composition) comprising one or a plurality of the TREM2 agonist antigen binding proteins of the invention (e.g. anti-TREM2 agonist monoclonal antibodies or binding fragments thereof) together with pharmaceutically acceptable diluents, carriers, excipients, solubilizers, emulsifiers, preservatives, and / or adjuvants. Pharmaceutical compositions of the invention include, but are not limited to, liquid, frozen, and lyophilized compositions."Pharmaceutically-acceptable" refers to molecules, compounds, and compositions that are non-toxic to human recipients at the dosages and concentrations employed and / or do not produce allergic or adverse reactions when administered to humans. In some embodiments, the pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. In such embodiments, suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine);antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such asethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine,polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers;monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such aspolyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol);sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing agents (such as sucrose or sorbitol); tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and / or pharmaceutical adjuvants. Methods and suitable materials for formulating molecules for therapeutic use are known in the pharmaceutical arts, and are described, for example, in REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition, (A.R. Genrmo, ed.), 1990, Mack Publishing Company.
[0227] In some embodiments, the pharmaceutical composition of the invention comprises a standard pharmaceutical carrier, such as a sterile phosphate buffered saline solution, bacteriostatic water, and the like. A variety of aqueous carriers may be used, e.g., water, buffered water, 0.4% saline, 0.3% glycine and the like, and may include other proteins for enhanced stability, such as albumin, lipoprotein, globulin, etc., subjected to mild chemical modifications or the like.
[0228] Exemplary concentrations of the antigen binding proteins in the formulation may range from about 0.1 mg / ml to about 200 mg / ml or from about 0.1 mg / mL to about SO mg mL, or from about 0.5 mg mL to about 25 mg / mL, or alternatively from about 2 mg / mL to about 10 mg / mL. An aqueous formulation of the antigen binding protein may be prepared in a pH-buffered solution, for example, at pH ranging from about 4.5 to about 6.5, or from about 4.8 to about 5.5, or alternatively about 5.0. Examples of buffers that are suitable for a pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers. The bufferconcentration can be from about 1 mM to about 200 mM, or from about 10 mM to about 60 mM, depending, for example, on the buffer and the desired isotonicity of the formulation.
[0229] A tonicity agent, which may also stabilize the antigen binding protein, may be included in the formulation. Exemplary tonicity agents include polyols, such as mannitol, sucrose or trehalose. Preferably the aqueous formulation is isotonic, although hypertonic or hypotonic solutions may be suitable. Exemplary concentrations of the polyol in the formulation may range from about 1% to about 15% w / v.
[0230] A surfactant may also be added to the antigen binding protein formulation to reduce aggregation of the formulated antigen binding protein and / or minimize the formation of particulates in the formulation and / or reduce adsorption. Exemplary surfactants includenonionic surfactants such as polysorbates (e.g. polysorbate 20 or polysorbate 80) or poloxamers (e.g. poloxamer 188). Exemplary concentrations of surfactant may range from about 0.001% to about 0.5%, or from about 0.005% to about 0.2%, or alternatively from about 0.004% to about 0.01% w / v.
[0231] In one embodiment, the formulation contains the above-identified agents (i.e. antigen binding protein, buffer, polyol and surfactant) and is essentially free of one or more preservatives, such as benzyl alcohol, phenol, m-cresol, chlorobutanol and benzethonium chloride. In another embodiment, a preservative may be included in the formulation, e.g., at concentrations ranging from about 0.1% to about 2%, or alternatively from about 0.5% to about 1%. One or more other pharmaceutically acceptable carriers, excipients or stabilizers such as those described in REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition, (A.R. Genrmo, ed.), 1990, Mack Publishing Company, may be included in the formulation provided that they do not adversely affect the desired characteristics of the formulation.
[0232] Therapeutic formulations of the antigen binding protein are prepared for storage by mixing the antigen binding protein having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (REMINGTON'SPHARMACEUTICAL SCIENCES, 18lh Edition, (A.R. Genrmo, ed.), 1990, MackPublishing Company), in the form of lyophilized formulations or aqueous solutions.Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers (e.g. phosphate, citrate, and other organic acids); antioxidants (e.g. ascorbic acid and methionine); preservatives (such asoctadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol; resorcinol, cyclohexanol, 3-pentanol, and m-cresol); low molecular weight (e.g. less than about 10 residues) polypeptides; proteins (such as serum albumin, gelatin, or immunoglobulins); hydrophilic polymers (e.g. polyvinylpyrrolidone); amino acids (e.g. glycine, glutamine, asparagine, histidine, arginine, or lysine);monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, maltose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn- protein complexes); and / or non-ionic surfactants, such as polysorbates (e.g. polysorbate 20 or polysorbate 80) or poloxamers (e.g. poloxamer 188); or polyethylene glycol (PEG).
[0233] In one embodiment, a suitable formulation of the claimed invention contains an isotonic buffer such as a phosphate, acetate, or TRIS buffer in combination with a tonicity agent, such as a polyol, sorbitol, sucrose or sodium chloride, which tonicities and stabilizes. One example of such a tonicity agent is 5% sorbitol or sucrose. In addition, the formulation could optionally include a surfactant at 0.01% to 0.02% wt vol, for example, to prevent aggregation or improve stability. The pH of the formulation may range from 4.5 to 6.5 or 4.5 to 5.5. Other exemplary descriptions of pharmaceutical formulations for antigen binding proteins may be found in US Patent Publication No. 2003 / 0113316 and US Patent No.6,171,586, each of which is hereby incorporated by reference in its entirety.
[0234] Suspensions and crystal forms of antigen binding proteins are also contemplated. Methods to make suspensions and crystal forms are known to one of skill in the art.[023S] The formulations to be used for in vivo administration must be sterile. The compositions of the invention may be sterilized by conventional, well-known sterilization techniques. For example, sterilization is readily accomplished by filtration through sterile filtration membranes. The resulting solutions may be packaged for use or filtered under aseptic conditions and lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
[0236] The process of freeze-drying is often employed to stabilize polypeptides for long-term storage, particularly when the polypeptide is relatively unstable in liquid compositions. A lyophilization cycle is usually composed of three steps: freezing, primary drying, and secondary drying (see Williams and Polli, Journal of Parenteral Science and Technology, Volume 38, Number 2, pages 48-59, 1984). In the freezing step, the solution is cooled until it is adequately frozen. Bulk water in the solution forms ice at this stage. The ice sublimes in the primary drying stage, which is conducted by reducing chamber pressure below the vapor pressure of the ice, using a vacuum Finally, sorbed or bound water is removed at the secondary drying stage under reduced chamber pressure and an elevated shelf temperature. The process produces a material known as a lyophilized cake. Thereafter the cake can be reconstituted prior to use.
[0237] The standard reconstitution practice for lyophilized material is to add back a volume of pure water (typically equivalent to the volume removed during lyophilization), although dilute solutions of antibacterial agents are sometimes used in the production ofpharmaceuticals for parenteral administration (see Chen, Drug Development and Industrial Pharmacy, Volume 18: 1311-1354, 1992).
[0238] Excipients have been noted in some cases to act as stabilizers for freeze-dried products (see Carpenter et ah, Volume 74: 225-239, 1991). For example, known excipients include polyols (including mannitol, sorbitol and glycerol); sugars (including glucose and sucrose); and amino acids (including alanine, glycine and glutamic acid).
[0239] In addition, polyols and sugars are also often used to protect polypeptides from freezing and drying-induced damage and to enhance the stability during storage in the dried state. In general, sugars, in particular disaccharides, are effective in both the freeze-drying process and during storage. Other classes of molecules, including mono- and di-saccharides and polymers such as PVP, have also been reported as stabilizers of lyophilized products.
[0240] For injection, the pharmaceutical formulation and / or medicament may be a powder suitable for reconstitution with an appropriate solution as described above. Examples of these include, but are not limited to, freeze dried, rotary dried or spray dried powders, amorphous powders, granules, precipitates, or particulates. For injection, the formulations may optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
[0241] Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antigen binding protein, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Patent No. 3,773,919), copolymers of L-glutamic acid and y ethyl-L- glutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the Lupron Depot™ (injectable microspheres composed of lactic acid- glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene- vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. When encapsulated polypeptides remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37°C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S--S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidicsolutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
[0242] The formulations of the invention may be designed to be short-acting, fast-releasing, long-acting, or sustained-releasing. Thus, the pharmaceutical formulations may also be formulated for controlled release or for slow release.
[0243] Specific dosages may be adjusted depending on the disease, disorder, or condition to be treated (e.g. Alzheimer's disease, multiple sclerosis, frontotemporal dementia, or Nasu- Hakola disease), the age, body weight, general health conditions, sex, and diet of the subject, dose intervals, administration routes, excretion rate, and combinations of drugs.
[0244] The TREM2 agonist antigen binding proteins of the invention can be administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, intrathecal, intracerebral, intracerebroventricular, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral administration includes intravenous, intraarterial, intraperitoneal, intramuscular, intradermal or subcutaneous administration. In addition, the antigen binding protein is suitably administered by pulse infusion, particularly with declining doses of the antigen binding protein. Preferably, the dosing is given by injections, most preferably intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Other administration methods arecontemplated, including topical, particularly transdermal, transmucosal, rectal, oral or local administration e.g. through a catheter placed close to the desired site. In certainembodiments, the TREM2 agonist antigen binding protein of the invention is administered intravenously or subcutaneously in a physiological solution at a dose ranging between 0.01 mg / kg to 100 mg / kg at a frequency ranging from daily to weekly to monthly (e.g. every day, every other day, every third day, or 2, 3, 4, 5, or 6 times per week), preferably a dose ranging from 0.1 to 45 mg / kg, 0.1 to 15 mg / kg or 0.1 to 10 mg / kg at a frequency of once per week, once every two weeks, or once a month.
[0245] The TREM2 agonist antigen binding proteins described herein (e.g. anti-TREM2 agonist monoclonal antibodies and binding fragments thereof) are useful for preventing, treating, or ameliorating a condition associated with TREM2 deficiency or loss of biological function of TREM2 in a patient in need thereof. As used herein, the term "treating" or "treatment" is an intervention performed with the intention of preventing the development or altering the pathology of a disorder. Accordingly, "treatment" refers to both therapeutic treatment and prophylactic or preventative measures. Patients in need of treatment includethose already diagnosed with or suffering from the disorder or condition as well as those in which the disorder or condition is to be prevented, such as patients who are at risk of developing the disorder or condition based on, for example, genetic markers. 'Treatment" includes any indicia of success in the amelioration of an injury, pathology or condition, including any objective or subjective parameter such as abatement, remission, diminishing of symptoms, or making the injury, pathology or condition more tolerable to the patient, slowing in the rate of degeneration or decline, making the final point of degeneration less debilitating, or improving a patient's physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters, including the results of a physical examination, self-reporting by a patient, cognitive tests, motor function tests, neuropsychiatric exams, and / or a psychiatric evaluation.
[0246] TREM2 biological activity has been implicated in various physiological processes, including myeloid cell processes, such as phagocytosis, proliferation, survival, and regulation of inflammatory cytokine production; osteoclastogenesis; osteoclast differentiation; negative regulation of autoimmunity; inflammatory responses; bone remodeling and repair; bone resorption; tissue repair, microgliosis, and brain homeostasis. See, e.g., Colonna, Nature Reviews Immunology, Vol. 3: 445-453, 2003; Paradowska-Gorycka et al, HumanImmunology, Vol. 74: 730-737, 2013; and Ulrich and Holtzman, ACS Che Neurosci., Vol. 7: 420-427, 2016. Loss of TREM2 function or TREM2 deficiency has been linked to several disorders and diseases including polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL; also known as Nasu-Hakola disease), Alzheimer's disease, frontotemporal dementia, multiple sclerosis, prion disease, stroke, osteoporosis, and osteopetrosis. See, e.g., Jonsson et al, New England Journal of Medicine, Vol. 368: 107-116, 2013; Guerreiro et al, New England Journal of Medicine, Vol. 368: 117-127, 2013;Paradowska-Gorycka et al, Human Immunology, Vol. 74: 730-737, 2013; and Ulrich and Holtzman, ACS Chem. Neurosci., Vol. 7: 420-427, 2016. Thus, the TREM2 agonist antigen binding proteins of the invention can be administered to patients to prevent, ameliorate, or treat any of these diseases or disorders or other conditions associated with TREM2 deficiency or loss of TREM2 biological function or activity. In certain embodiments, the present invention provides methods for preventing, treating, or ameliorating a condition associated with TREM2 deficiency or loss of TREM2 function in a patient in need thereof comprising administering to the patient an effective amount of a TREM2 agonist antigen binding protein described herein. In certain embodiments, the TREM2 agonist antigen binding protein is ananti-TREM2 agonist monoclonal antibody or binding fragment thereof. The term "patient" includes human patients and is used interchangeably with the term "subject."
[0247] An "effective amount" is generally an amount sufficient to reduce the severity and / or frequency of symptoms, eliminate the symptoms and / or underlying cause, prevent the occurrence of symptoms and / or their underlying cause, and / or improve or remediate the damage that results from or is associated with a particular condition. In some embodiments, the effective amount is a therapeutically effective amount or a prophylactically effective amount. A "therapeutically effective amount" is an amount sufficient to remedy a disease state or symptom(s), particularly a state or symptom(s) associated with the disease state, or otherwise prevent, hinder, retard or reverse the progression of the disease state or any other undesirable symptom associated with the disease in any way whatsoever (i.e. that provides "therapeutic efficacy"). A "prophylactically effective amount" is an amount of antigen binding protein, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of the condition, or reducing the likelihood of the onset (or reoccurrence) of the condition. The full therapeutic orprophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a therapeutically or prophylactically effective amount may be administered in one or more administrations.
[0248] Conditions or disorders associated with TREM2 deficiency or loss of TREM2 function that may be prevented, treated, or ameliorated according to the methods of the invention include, but are not limited to, Nasu-Hakola disease, Alzheimer's disease, frontotemporal dementia, multiple sclerosis, Guillain-Barre syndrome, amyotrophic lateral sclerosis, Parkinson's disease, traumatic brain injury, spinal cord injury, systemic lupus erythematosus, rheumatoid arthritis, prion disease, stroke, osteoporosis, osteopetrosis, and osteosclerosis. In certain embodiments, the condition or disorder to be prevented, treated, or ameliorated according to the methods of the invention is Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke.
[0249] In one embodiment, the present invention provides a method for preventing, treating, or ameliorating Alzheimer's disease in a patient in need thereof comprising administering to the patient an effective amount of a TREM2 agonist antigen binding protein described herein. In certain embodiments, the TREM2 agonist antigen binding protein administered to the patient is an anti-TREM2 agonist monoclonal antibody, such as the antibodies whose variable and CDR sequences are set forth in Tables 1A, IB, 2A, 2B, 3 A, and 3B. In someembodiments, the patient to be administered a TREM2 agonist antigen binding protein is a patient at risk of developing Alzheimer's disease. For instance, in one embodiment, the patient has been determined to have at least one allele containing the rs75932628-T mutation in the TREM2 gene, e.g. the patient has a genotype of CT at rs75932628. In related embodiments, the patient at risk of developing Alzheimer's disease is a patient who has been determined to carry a TREM2 variant allele that encodes a histidine in place of arginine at position 47 in SEQ ID NO: 1. In other embodiments, the patient has been determined to have at least one allele containing the rsl43332484-T mutation in the TREM2 gene, e.g. the patient has a genot pe of CT at rsl43332484. In related embodiments, the patient at risk of developing Alzheimer's disease is a patient who has been determined to carry a TREM2 variant allele that encodes a histidine in place of arginine at position 62 in SEQ ID NO: 1. In some embodiments, a patient at risk of developing Alzheimer's disease has been determined to have at least one allele containing the rs6910730-G mutation in the TREM1 gene, at least one allele containing the rs7759295-C mutation upstream of the TREM2 gene, and / or at least one ε4 allele of i eAPOE gene.
[0250] In another embodiment, the present invention provides a method for preventing, treating, or ameliorating frontotemporal dementia or Nasu-Hakola disease in a patient in need thereof comprising administering to the patient an effective amount of a TREM2 agonist antigen binding protein described herein. In certain embodiments, the TREM2 agonist antigen binding protein administered to the patient is an anti-TREM2 agonist monoclonal antibody, such as the antibodies whose variable and CDR sequences are set forth in Tables 1 A, IB, 2A, 2B, 3A, and 3B. In some embodiments, the patient to be administered a TREM2 agonist antigen binding protein is a patient at risk of developing frontotemporal dementia or Nasu-Hakola disease. For example, in one such embodiment, the patient has been determined to have at least one allele containing the rsl04894002-A mutation in the TREM2 gene, e.g. the patient has a genotype of GA or AA at rs 104894002. In related embodiments, the patient at risk of developing frontotemporal dementia or Nasu-Hakola disease is a patient who has been determined to carry a TREM2 variant allele that encodes a truncated TREM2 protein as a result of the substitution of a stop codon in place of glutamine at position 33 in SEQ ID NO: 1. In another embodiment, the patient has been determined to have at least one allele containing the rs201258663-A mutation in the TREM2 gene, e.g. the patient has a genotype of GA or AA at rs201258663. In related embodiments, the patient at risk of developing frontotemporal dementia or Nasu-Hakola disease is a patient who has been determined tocany a TREM2 variant allele that encodes a methionine in place of threonine at position 66 in SEQ ID NO: 1. In some embodiments, the patient at risk of developing frontotemporal dementia or Nasu-Hakola disease is a patient who has been determined to carry a TREM2 variant allele that encodes a cysteine in place of tyrosine at position 38 in SEQ ID NO: I.[02S1] In yet another embodiment, the present invention provides a method for preventing, treating, or ameliorating multiple sclerosis in a patient in need thereof comprising administering to the patient an effective amount of a TREM2 agonist antigen binding protein described herein. In certain embodiments, the TREM2 agonist antigen binding protein administered to the patient is an anti-TREM2 agonist monoclonal antibody, such as the antibodies whose variable and CDR sequences are set forth in Tables 1 A, IB, 2A, 2B, 3 A, and 3B. In some embodiments, the patient to be administered a TREM2 agonist antigen binding protein is a patient at risk of developing multiple sclerosis.
[0252] As described in Examples 9 and 10, an agonist anti-TREM2 antibody capable of activating TREM2 / DAP12 signaling as measured by increases in pSyk levels rescued the viability defect from macrophages and microglia resulting from a loss of function mutation in TREM2 and restored CCL2 secretion from TREM2-deficient macrophages. These results indicate that activation of TREM2 / D AP 12 signaling with an agonist anti-TREM2 antibody can enhance macrophage / microglia function, which in turn could be therapeutic in conditions associated with insufficient macrophage / microglia function. Thus, in certain embodiments, the present invention includes a method of increasing survival or proliferation of myeloid cells, such as microglia, macrophages, or dendritic cells, in a patient in need thereof comprising administering to the patient an effective amount of a TREM2 agonist antigen binding protein described herein. In certain embodiments, the TREM2 agonist antigen binding protein administered to the patient is an anti-TREM2 agonist monoclonal antibody, such as the antibodies whose variable and CDR sequences are set forth in Tables 1 A, IB, 2A, 2B, 3 A, and 3B. In some embodiments, the patient in need of treatment is at risk for, suffers from, or has been diagnosed with a neurodegenerative disorder. In one embodiment, the neurodegenerative disorder is Alzheimer's disease. In some embodiments, the patient in need of treatment is at risk for, suffers from, or has been diagnosed with an autoimmune disorder. In one embodiment, the autoimmune disorder is multiple sclerosis.
[0253] The TREM2 agonist antigen binding proteins of the invention are also useful for detecting human TREM2 in biological samples and identification of cells or tissues that express human TREM2. For instance, the antigen binding proteins can be used in diagnosticassays, e.g., immunoassays to detect and / or quantify TREM2 expressed in a tissue or cell (macrophages or microglia) or presence of soluble forms of TREM2 in a bodily fluid, such as cerebrospinal fluid, blood, serum, or plasma. In addition, the TREM2 agonist antigen binding proteins described herein can be used to activate TREM2 / DAP12 signaling in myeloid cells, thereby modulating the biological activity of these cells. Such biological activities include cytokine release, phagocytosis, and microgliosis.
[0254] The TREM2 agonist antigen binding proteins described herein can be used for diagnostic purposes to detect, diagnose, or monitor conditions associated with TREM2 dysfunction, such as neurodegenerative diseases (e.g. Alzheimer's disease, Parkinson's disease), central nervous system injury (traumatic brain injury, spinal cord injury, stroke), autoimmune diseases (multiple sclerosis, rheumatoid arthritis, systemic lupus erythematosus), frontotemporal dementia, Nasu-Hakola disease, and bone disorders (e.g. osteoporosis, osteopetrosis, osteosclerosis). For instance, elevation in the level of a soluble form of TREM2 in cerebrospinal fluid has been observed in patients with multiple sclerosis (Piccio et al, Brain, Vol. 131: 3081-3091, 2008). Also provided are methods for the detection of the presence of TREM2 in a sample using classical immunohistological methods known to those of skill in the art (e.g., Tijssen, 1993, Practice and Theory of Enzyme Immunoassays, Vol 15 (Eds R.H. Burdon and P.H. van Knippenberg, Elsevier, Amsterdam); Zola, 1987, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc.); Jalkanen et al., 1985, J. Cell. Biol. 101:976-985; Jalkanen et al., 1987, J. Cell Biol. 105:3087-3096). Examples of methods useful in the detection of the presence of TREM2 include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA), using the antigen binding proteins described herein. The detection of TREM2 can be performed in vivo or in vitro.
[0255] For diagnostic applications, the antigen binding protein can be labeled with a detectable labeling group. Suitable labeling groups include, but are not limited to, the following: radioisotopes or radionuclides (e.g., ¾,14C,15N,35S, «Ύ, "Tc,mIn,1251,131I), fluorescent groups (e.g., FITC, modamine, lanthanide phosphors), enzymatic groups (e.g., horseradish peroxidase, β-galactosidase, luciferase, alkaline phosphatase), chemiluminescent groups, biotinyl groups, or predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). In some embodiments, the labeling group is coupled to theantigen binding protein via spacer arms of various lengths to reduce potential steric hindrance. Various methods for labeling proteins are known in the art and may be used.
[0256] In another embodiment, the antigen binding proteins described herein can be used to identify a cell or cells that express TREM2. In a specific embodiment, the antigen binding protein is labeled with a labeling group and the binding of the labeled antigen binding protein to TREM2 is detected. The antigen binding proteins can also be used in immunoprecipitation assays in biological samples. In a further specific embodiment, the binding of the antigen binding protein to TREM2 is detected in vivo. In a further specific embodiment, the antigen binding protein is isolated and measured using techniques known in the art. See, for example, Harlow and Lane, 1988, Antibodies: A Laboratory Manual, New York: Cold Spring Harbor (ed. 1991 and periodic supplements); John E. Coligan, ed., 1993, Current Protocols In Immunology New York: John Wiley & Sons.
[0257] The following examples, including the experiments conducted and the results achieved, are provided for illustrative purposes only and are not to be construed as limiting the scope of the appended claims.EXAMPLESExample 1. Generation of Human Anti-TREM2 AntibodiesImmunizations
[0258] Fully human antibodies to human TREM2 were generated by immunizingXenoMouse®transgenic mice. These transgenic mice carry human immunoglobulin transgenes that allow for production of antigen-specific fully human antibodies upon immunization. See, e.g., U.S. Pat. Nos. 6,114,598; 6,162,963; 6,833,268;7,049,426;7,064,244; Green et al., 1994, Nature Genetics 7: 13-21; Mendez et al, 1997, NatureGenetics 15:146-156; Green and Jakobovitis, 1998, J. Ex. Med, 188:483-495; Green, 1999, Journal of Immunological Methods 231 : 11-23; Kellerman and Green, Current Opinion in Biotechnology 13, 593-597, 2002, all of which are hereby incorporated by reference in their entireties. Animals from the XMG2-K, XMG2-KL, XMG4-K and XMG4-KL XenoMouse®strains were used for immunizations. Mice of the XenoMouse®strains XMG2-K and XMG2- KL produce fully human IgG2 antibodies with kappa light chains (XMG2-K) or both kappa and lambda light chains (XMG2-KL). Mice of the XenoMouse®strains XMG4-K and XMG4-KL produce fully human IgG4 antibodies with kappa light chains (XMG4-K) or both kappa and lambda light chains (XMG4-KL).
[0259] Multiple immunogens and routes of immunization were used to produce an immune response to human TREM2 in the XenoMouse®strains. For soluble recombinant protein immunizations, mice were immunized with a soluble TREM2 protein, which was a fusion protein comprising the extracellular domain (ECD) of human TREM2 (amino acids 1-174; SEQ ID NO: 2) fused to the -terminus of a human IgGl Fc region through a Gly-Ser-Ser linker. Animals were immunized with the soluble TREM2 protein mixed with CpG oligodeoxynucleotides (CpG-ODN) or CpG-ODN and polyinosinic:polycytidylic acid (Poly I:C) and QS-21 adjuvant, 8-12 times over 4-8 weeks using subcutaneous injections. The initial boost contained 10 ug of protein while subsequent boosts contained 5 ug of protein.
[0260] The immunogen for genetic immunization was created by coating gold beads (BioRad, Hercules, California) with mouse GM-CSF, CpG-ODN, and expression vectors encoding wild-lype human TREM2 (SEQ ID NO: 1) and wild-type human DAP12 (SEQ ID NO: 3). The genetic immunogen was delivered to the epidermis of a shaved mouse abdomen using the Helios Gene Gun system according to the manufacturer's instructions (BioRad, Hercules, California). Mice were immunized with the genetic immunogen 12-16 times over 6-8 weeks.
[0261] Human TREM2-specific serum titers were monitored by live-cell FACS analysis on an Accuri or FacsCalibur (BD Biosciences) flow cytometer or by TREM2-specific EL1SA. Animals with the highest serum native titers directed against human TREM2 from four separate harvests were sacrificed and used for hybridoma generation. Table 7 below provides a description of each harvest group.Table 7. TREM2 Immunization GroupsPreparation of Monoclonal Antibodies
[0262] Animals exhibiting suitable antigen-specific serum titers were identified and lymphocytes were obtained from spleen and / or draining lymph nodes. Pooled lymphocytes (from each harvest) were dissociated from lymphoid tissue by grinding in a suitable medium (for example, Dulbecco's Modified Eagle Medium (DMEM); Invitrogen, Carlsbad, CA). B cells were selected and / or expanded using standard methods, and fused with a suitable fusion partner (e.g. non-secretory myeloma P3X63Ag8.653 cells) using conventional techniques.
[0263] For harvest 1 , fused hybridoma pools from select immune tissue harvest were plated as polyclonal wells, exhausted to generate conditioned media, and then screened for binding to the soluble human TREM2 protein (fusion protein described above). The hits from this plating were pooled and then clonally FACS-sorted to obtain one live cell per well. For harvest 3, 4 and 5, fused hybridoma pools from select immune tissue were used as a source of material for FACS-based enrichments. Specifically, hybridoma cells were thawed and cultured in DMEM selection media for 3-4 days. Media was changed to BDQY hybridoma media a day before bulk sort. Cells were washed in 10 mL sterile FACS buffer and then incubated with biotinylated soluble TREM2 protein at 2 to 5 μg / mL concentration at 1 mL reaction volume for 1 hour at 4° C. For the harvest 3 group, which was immunized with soluble TREM2 protein, this step was performed in the presence of 100 μg / mL polyclonal human IgG (Jackson ImmunoResearch) to block any binders to the Fc region. The polyclonal human IgG blocking step was omitted for harvest 4 and 5 as these harvests were from genetically-immunized animals.
[0264] After one dilution wash in 10 mL FACS buffer, 1 mL antibody cocktail containing 5 μg / mL each of Alexa Fluor 488 conjugated goat anti-human IgG (Jackson Immunoresearch) and Alexa Fluor 647 conjugated streptavidin (Jackson Immunoresearch) was added to the cells. The cells were then incubated at 4° C for 30 minutes. After the incubation, the cells were washed in 10 mL FACS buffer, resuspended in 2 mL of BDQY hybridoma media containing 5 uL of 7-AAD (BD Pharmingen, Cat: 559925), then put through a 40 micron cell strainer to remove any clumps. Cells were bulk sorted on BD FACSAria by gating on live cell population dual positive for Alexa Fluor 488 and Alexa Fluor 647 fluorescence signals.
[0265] Sorted cells were transferred into 24-well tissue culture plates and cultured for a few days before they were counted and stained again using the method described above to check for enrichment of antigen specific cells. The cells were then single cell sorted into 384-well microliter plates containing BDQY hybridoma media and cultured for up to 2 weeks before the supematants were collected for screening.Example 2. Selection of TREM2-Specific Binding Antibodies
[0266] Antibodies produced from the hybridomas described in Example 1 were screened for binding to human TREM2, agonist activity of human TREM2, and cross-reactivity to other TREM proteins. The methods and results of these screens are described below.Primary TREM2 Binding Screen
[0267] Exhausted hybridoma supernatants were tested for binding to human TREM2 by ELISA. Briefly, neutravidin plates were generated by incubating a 384 well Coining Assay Plate 3702 with neutravidin (Thermo 3100B) at 10 μg / mL (40 μL / weΙΙ) in IX PBS at 4°C overnight. The plates were washed with IX PBS using a Biotek plate washer and then blocked with 1% milk / lX PBS (90 μL / weΙΙ) at room temperature (RT) for 30 minutes. The plates were then washed again with IX PBS using the plate washer. The capture sample was biotinylated soluble human TREM2 protein (TREM2 ECD-huIgGl Fc fusion protein) and was added at 0.5 μg / mL in 1% milk / lX PBS at a volume of 40uL / well. The plates were then incubated at RT for 1 hour to immobilize the TREM2 protein to the wells of the plates.Following the incubation, the plates were again washed with IX PBS using the plate washer. ΙΟμΙ, of each hybridoma supernatant to be tested and 40 μL of 1% milk / lX PBS (1:5 dilution) were added to each well of the plates and incubated at RT for 1 hour. Again, the plates were washed with IX PBS using the plate washer. Goat anti-human kappa-HRP (Southern Biotech, 2060-05) and goat anti-human lambda-HRP (Southern Biotech, 2070-05) diluted together 1:2000 in 1% milk / lX PBS or goat anti-human IgG Fc POD diluted 1:4000 in 1% milk lX PBS was added to the plates (40 μΐ / well) and the plates were incubated at RT for 1 hour. After the plates were washed with IX PBS using the plate washer, 40 μL / weΙΙ of TMB substrate (Neogen, lot # 1501 14) was added to the plates and the plates were incubated at RT for 30 minutes. The reaction was quenched with IN hydrochloric acid (40uL / well) following the incubation period. OD readings at 450 nm were obtained with a plate reader.
[0268] The primary ELISA screen identified 2,523 antibodies that were positive for TREM2 binding from the four separate harvests groups. These identified antibodies were advanced to the functional assay screens.TREM2 Functional Assay Screens
[0269] The antibodies that tested positive for TREM2 binding in the ELISA assay were evaluated for agonist activity of human TREM2 in a cell-based phospho-Syk (pSyk) signaling assay. Human TREM2, which is a transmembrane glycoprotein, couples with the adaptor protein, DAP12, for signaling and function through the recruitment of tyrosine kinases ζ-chain associate protein 70 (ZAP70) and spleen tyrosine kinase (Syk)(Colonna, Nature Reviews Immunology, Vol. 3: 445-453, 2003). The phosphorylated form of Syk is indicative of activation of TREM2 / D AP 12 signaling. Thus, a cell-based AlphaLISA (Perkins Elmer) assay to detect phosphorylated forms of Syk in response to TREM2 / DAP12 modulation was developed. The assay employs a rabbit-anti-pSyk antibody, a biotinylated mouse anti-total Syk antibody, acceptor beads conjugated to anti-rabbit IgG antibodies, and donor beads coated with streptavidin. Phosphorylated forms of Syk present in cell lysates are bound by both the rabbit-anti-pSyk antibody and the mouse anti-total Syk antibody. The acceptor beads, which are conjugated to an anti-rabbit IgG antibody, bind to the rabbit anti- pSyk antibody, and the streptavidin-coated donor beads bind to the biotinylated mouse anti- total Syk antibody. Excitation of the donor beads at a wavelength of 680 nm results in the release of singlet oxygen, which in turn produces an amplified fluorescent signal in the acceptor beads, thereby producing an emission at 615 nm The emission at 615 nm is not detected if the donor and acceptor beads are not located within close proximity to each other (i.e. acceptor bead is not recruited to the complex because Syk is not phosphorylated and thus, not bound by the rabbit anti-pSyk antibody). Thus, the amount of light emitted at 615 nm is proportional to the amount of phosphorylated Syk present in the cell lysate, which in turn is indicative of activation of TREM2 / DAP12 signaling by the anti-TREM2 antibody.
[0270] HEK293T cells stably expressing human TREM2 and human DAP12 (G13 cell line) were plated in growth media at 40,000 cells per well (in 90 or 80 μΙ_) in tissue culture treated 96-half area well plates or 50,000 cells per well (in 200 uL) in poly-D-lysine-coated plates. The cells were incubated overnight at 37°C and 5% CO2. Anti-human TREM2 antibodies were added either at a single concentration (for initial single point screening) or a range of concentrations (for potency testing). After incubation of cells and antibody at room temperature for 30 to 40 minutes, culture media was completely removed. The cells were lysed with 20 μΐ. (for 40,000 cells) or 25 μΙ_ (for 50,000 cells) of lysis buffer containing protease / phosphatases inhibitors on ice for 45 to 60 minutes. The cell lysate (5 μΐ,) was transferred to appropriate wells of a 384-well white assay plate containing a 15 μΐ, mixture of rabbit anti-pSyk antibody (final concentration: 1 nM), biotinylated mouse anti-Syk antibodies(final concentration: 1 nM) and acceptor beads conjugated to anti-rabbit IgG antibodies (final concentration: 10 μg / mL). The assay plates were then incubated on ice for 2 hours. Donor beads coated with streptavidin (5 μL) were subsequently added to the wells (final concentration: 40 μg / mL) and the assay plates were incubated at room temperature for 1 hour in the dark. The AlphaLISA signal (counts) was measured by EnVision Multilabel Reader. The antibody agonist activity was reported as fold over control (S / B): S / B= Sample pSyk signal (counts)ZBasal pSyk signal (isotype control pSyk signal counts).
[0271] Antibodies from the hybridoma supernatant, that tested positive for TREM2 binding were initially tested at a single concentration in the pSyk assay. For this single point screening, exhausted hybridoma supernatant (ESN) containing anti-huTREM2 antibody was added to the cells either based on volume (10 μL for harvest 1, 1:10 dilution) or concentration (20 μL of ESN that was previously normalized to 10 μg / mL for harvest 3, 4 and 5, 1:5 dilution). Of the 2,523 antibodies positive for TREM2 binding from the four separate harvests, 140 antibodies exhibited activity in the pSyk assay at a single concentration. These antibodies were advanced for potency screening.
[0272] Potency screening was initially performed on unpurified, quantitated clonal hybridoma-derived anti-TREM2 antibodies and later on purified hybridoma-derived and / or recombinant monoclonal antibodies. For harvest 1, the anti-TREM2 antibodies were serially titrated at 3-fold from 100 μg / mL to 0.005 μg / mL and 10 μL of each dilution was added to the cells (final antibody concentrations from 10 μg / mL to 0.0005 μg / mL, 66.67 nM to 0.003 nM). For potency screening of harvest 3, 4, and 5, the culture medium was completely removed from the cells. The anti-TREM2 antibodies were serially titrated at 3 fold from 2 μg / mL to 0.003 μg / mL in growth media and 50 μL of each dilution was added to the cells (final antibody concentration from 13.33 nM to 0.02 nM). The EC50 values for each anti- TREM2 antibody was determined by a four-parameter logistic fit model of GraphPad Prism Version 6.07 from the 10-point dose response curves.
[0273] Of the 140 antibodies screened for potency, 93 antibodies were selected for further screening and characterization. Figure 1 A shows the dose-response curves for the top agonist anti-TREM2 antibodies from harvest 1, whereas Figure IB shows the dose-response curves for the top agonist anti-TREM2 antibodies from harvests 3, 4, and 5. EC50 values for the top 18 antibodies from all four harvests are provided in Table 8 below. As evident from the low nanomolar or subnanomolar EC50 values, the majority of the anti-TREM2 antibodies are potent agonists of TREM2 / D AP 12 signaling. Several of the antibodies are more potent andproduce a greater level of maximum activation of TREM2 / DAP12 signaling than a commercially available rat anti-human / mouse TREM2 antibody (mAbl7291; Rat IgG2b Clone #237920, R&D Systems), which had an EC50 value of 0.50 nM and an Emax of 13.8 in this assay. Importantly, the agonist activity of the anti-TREM2 antibodies was observed in the absence of a cross-linking agent (e.g. protein G, protein A, or anti-human secondary antibody) or immobilization of the antibodies (e.g. plate-bound antibodies), suggesting the antibodies can effectively engage and activate human TREM2 in a soluble, monomelic form For many agonist antibodies, cross-linking of their Fc regions is required to cluster the antibodies to activate effectively the target receptor. See, e.g., Natoni et al., British Journal of Haematology, Vol. 139: 568-577, 2007; Vonderheide and Glennie, Clin. Cancer Res., Vol. 19: 1035-1043, 2013. Such a cross-linking requirement to achieve agonist activity for other TREM2 antibodies has been observed. See, e.g., U.S. Patent No. 8,981,061 and WO2016 / 023019. The TREM2 antibodies described herein have an advantage over these other TREM2 antibodies in that they are cross-linking independent agonists of human TREM2 (e.g. they do not require cross-linking or oligomerization via their Fc domains for agonistic activity).Selectivity and Cross-Reactivity of TREM2 Antibodies
[0274] The anti-TREM2 antibodies demonstrating agonist activity in the potency screen were further evaluated for cross-reactivity to mouse and cynomologus TREM2 as well as cross- reactivity to human TREM1 protein. For the species cross-reactivity screen, HEK293 cells were transfected with expression vectors comprising either mouse TREM2 and mouse DAP 12 cDNA or cynomolgus TREM2 and cynomolgus DAP12 cDNA, Gibco™ Opti- MEM® media (Gibco, Cat. No. 31985088) and 293Fectin™ reagent (Invitrogen, Cat. No. 12347019) following the protocol set out by the manufacturer. TREMl cross-reactivity was assessed using a cell line stably expressing human TREM1 / DAP12. Hybridoma supernatants were screened for the presence of monoclonal antibodies binding to human TREMl, mouse TREM2 or cynomolgus TREM2 by incubating the supernatants on each of the transfected cells for 1 hour, followed by wash steps. The cells were then incubated with a goat anti- human Fc antibody conjugated to Alexa Fluor 647 (Jackson Immunochemicals 109-605-098) for 15 minutes. The binding was detected by FACS using the Accuri FACS machine with Intellicyt autosampler. Irrelevant isotype control antibodies were included in the FACS analysis. The data was reported as geomean (GM) fold over irrelevant control antibodybinding. Of the 93 antibodies from the four harvests screened for cross-reactivity, 50 antibodies were cross-reactive with cynomolgus TREM2 and 9 antibodies were cross-reactive with mouse TREM2. None of the tested antibodies were cross-reactive with human TREM1. The data from all screens for the top 18 anti-TREM2 monoclonal antibodies from all four harvests are summarized in Table 8 below.Table 8. Summary Data for Top Anti-TREM2 Monoclonal Antibodies from HybridomaScreenExample 3. Sequencing of Human Anti-TR£M2 Agonist Antibodies
[0275] RNA (total or mRNA) was purified from wells containing the TREM2 agonist antibody-producing hybridoma cells using a Qiagen RNeasy mini or the Invitrogen mRNA catcher plus kit. Purified RNA was used to amplify the antibody heavy and light chain variable region (V) genes using cDNA synthesis via reverse transcription, followed by a polymerase chain reaction (RT-PCR). The fully human antibody gamma heavy chain was obtained using the Qiagen One Step Reverse Transcriptase PCR kit (Qiagen). This kit was used to generate the first strand cDNA from the RNA template and then to amplify the variable region of the gamma heavy chain using multiplex PCR. The 5' gamma chain- specific primer annealed to the signal sequence of the antibody heavy chain, while the 3' primer annealed to a region of the gamma constant domain. The fully human kappa light chain was obtained using the Qiagen One Step Reverse Transcriptase PCR kit (Qiagen). This kit was used to generate the first strand cDNA from the RNA template and then to amplify the variable region of the kappa light chain using multiplex PCR. The 5' kappa light chain- specific primer annealed to the signal sequence of the antibody light chain while the 3' primer annealed to a region of the kappa constant domain. The fully human lambda light chain was obtained using the Qiagen One Step Reverse Transcriptase PCR kit (Qiagen). This kit was used to generate the first strand cDNA from the RNA template and then to amplify the variable region of the lambda light chain using multiplex PCR. The 5' lambda light chain-specific primer annealed to the signal sequence of light chain while the 3' primer annealed to a region of the lambda constant domain.
[0276] The amplified cDNA was purified enzymatically using exonuclease I and alkaline phosphatase and the purified PCR product was sequenced directly. Amino acid sequences were deduced from the corresponding nucleic acid sequences bioinformatically. Two additional, independent RT-PCR amplification and sequencing cycles were completed for each hybridoma sample in order to confirm that any mutations observed were not a consequence of the PCR. Amino acid sequences for the light chain variable regions and associated CDRs for exemplary antibodies are provided in Table 1 A, whereas amino acid sequences for the heavy chain variable regions and associated CDRs for the antibodies are provided in Table IB. Table 6 provides nucleic acid sequences encoding the light and heavy chain variable regions of the exemplary antibodies.
[0277] The derived amino acid sequences for each light and heavy chain variable region were then analyzed to determine the germline sequence origin of the antibodies and to identify deviations from the germline sequence. A comparison of each of the light chain and heavy chain variable region sequences to their original germline sequences are shown in Figures 2A-4B. The identity of the germline genes is indicated next to each antibody clone number. The amino acid sequences corresponding to CDRs of the sequenced antibodies were aligned and these alignments were used to group the clones by similarity.Example 4. Epitope Binning Analysis of Agonist Anti-TREM2 Antibodies
[0278] Epitope bins of a subset of agonist anti-human TREM2 antibodies were determined using anti-human Fc (Kinetic) sensors (18-5090) on an Octet®HTX instrument (Pall ForteBio). Each of sixteen different anti-TREM2 antibodies produced from hybridomas were quantitated and loaded onto one of the anti-human Fc sensors at 5 μg / mL for 2 minutes ("Load Antibody"). The sensor was then blocked with 100 μg / mL of an irrelevant human IgG2 antibody for 5 minutes. A recombinant soluble human TREM2 protein (human TREM2 extracellular domain (amino acids 1 -174) coupled to a Flag / His tag (human TREM2 ECD-FlagHis)) was added to the sensor at 4 for 5 minutes to allow binding of the soluble TREM2 protein to the load antibody. Next, each of the sixteen different anti-TREM2 antibodies ("Sandwich Antibody") was added to the sensor at 5 μg mL and allowed to bind for 5 minutes. All assay buffers contained 10 mM Tris (pH 7.6), 0.1 % Triton X-100, 150 mMNaCl, 1 mM CaCh, and 1 mg / mL BSA. The assay was conducted at 25° C.Experimental kinetic results were fit to a 1:1 binding model.
[0279] If the load antibody and the sandwich antibody bind to a similar epitope on human TREM2, then the addition of the sandwich antibody to the sensor will not produce a binding event However, if addition of the sandwich antibody produces a binding event, then the sandwich antibody binds to a different epitope on human TREM2 than the load antibody and the two antibodies are categorized into different epitope bins. Figure 5 depicts binding data from a sensor loaded with the 6E7 antibody and exposed to either the 5E3 antibody or the 6E7 antibody as the sandwich antibody. As expected, an increase in binding was observed with the addition of the soluble human TREM2 protein indicating that the 6E7 antibody specifically bound an epitope on human TREM2. No further binding was observed when 6E7 was added as the sandwich antibody as the sensor-immobilized 6E7 antibody was already bound to this particular epitope on human TREM2. However, when the 5E3 antibody wasadded as the sandwich antibody, an increase in binding was observed, indicating that the SE3 antibody binds to a different epitope on human TREM2 than the 6E7 antibody.
[0280] A summary of the epitope binning data for sixteen different anti-TREM2 antibodies is shown below in Table 9. Based on the binding data, the antibodies could be grouped into four distinct epitope bins. Antibodies 10E3, 13E7, 24F4, 4C5, 4G10, 32E3, and 6E7 appear to share a similar epitope (bin A), which is different than the epitope bound by antibodies 16B8, 26A10, 26C10, 26F2, 33B12, and 5E3 (bin B). Antibodies 24A10 and 24G6 share a similar epitope on human TREM2 (bin C), whereas antibody 25F12 has a distinct binding epitope (bin D) from any of the other tested antibodies.Table 9. Summary of Epitope Binning AnalysisExample 5. Binding Affinity Determination of Agonist Anti-TRE 2 Antibodies
[0281] To quantitate the binding affinity of agonist antibodies for human TREM2, association and dissociation rate constants as well as the equilibrium dissociation constant were determined using anti-human Fc (Kinetic) sensors on an Octet®HTX instrument (Pall ForteBio). Agonist anti-TREM2 antibodies were made up in DMEM null media, 250 μL at 10 μg mL. The, 250uL of assay buffer (10 mM Tris (pH 7.6), 0.1%Triton X-100, 150 mM NaCl, ImM CaCh, and 1 mg / mL BSA) was added to the antibody solutions to a final volume of 500 uL and final antibody concentration of 5 μg / mL. The anti-human Fc sensor was pre- incubated in 200 uL of the assay buffer for a minimum of 10 minutes. The sensor was then regenerated for 5 seconds in 10 mM glycine pH 1.5. Test agonist anti-TREM2 antibodies were loaded onto the sensor for 2 minutes, and baseline measurements were taken for 2 minutes. The antibody-loaded sensor was bound to recombinant soluble human TREM2protein (human TREM2 extracellular domain (amino acids 1-174) coupled to a Flag / His tag (human TREM2 ECD-FlagHis)) or recombinant soluble cynomolgus TREM2 protein (cynomolgus TREM2 extracellular domain coupled to a Flag / His tag) in a 2-fold serial dilution series starting at 100 nM with a 6-point dilution series. The recombinant TREM2 proteins were allowed to associate with the antibody-loaded sensor for 10 minutes, and then dissociation was measured for 10 minutes. The assay was conducted at 25° C. Experimental kinetic results were globally fit to a 1 :1 binding model in order to determine the association and dissociation rate constants as well as the equilibrium dissociation constant. Table 10 provides the results of the assay for human TREM2 for select antibodies and Table 11 provides the results of the assay for cynomolgus TREM2 for select antibodies.Table 10. Binding Affinity for Human TREM2Table 11. Binding Affinity for Cyno TREM2Example 6. Agonist Activity of Anti-TREM2 Antibodies in THP-1 Cells
[0282] Select anti-TREM2 antibodies were evaluated for their ability to activate humanTREM2 / DAP12 signaling in THP-1 cells. The THP-1 cell line is a human leukemia monocytic cell line, which is commonly used as an in vitro model of human monocyte and macrophage function (Chanput etai, International Immunopharmacology, Vol. 23: 37-45,2014).
[0283] Suspension THP-1 cells (lxlO6cells / mL) were differentiated by incubation in growth media (RPMI, 10% FBS (heat inactivated, 1% Glutamax, 1% Hepes, 1% Pen / Strep) containing 20 nM Phorbol 12-myristate 13-acetate (PMA) at 37°C 15% CO2 for 72 hours. After 72 hours stimulation, the cells attached to the surface of tissue culture-treated dishes. PMA was gently washed off with PBS, and replenished in fresh growth media containing 10 ng / mL IL-4. The cells were continually incubated at 37°C 15% CO2 for another 72 hours. On day 6 (end of cell differentiation), the cells were harvested with non-enzymatic cell dissociation buffer or cell stripper and were plated in growth media at 100,000 cells per well into tissue culture-treated 96 - well plates. The cells were incubated overnight at 37°C 15% CO2.
[0284] On the following day, the cells were treated with anti-human TREM2 antibodies for 10 minutes at room temperature, and the media was subsequently removed. The cells were lysed with 30 μΐ lysis buffer for 45 to 60 minutes on ice. The cell lysate (5 μΐ.) was transferred into 384 well plates for determination of phosphorylated Syk (pSyk) levels using the AlphaLISA assay described in Example 2. The EC50 for each anti-TREM2 antibody was determined from a dose-response curve by a four-...
Claims
CLAIMSWhat is claimed:
1. An isolated agonist antigen binding protein that specifically binds to human TREM2, wherein the agonist antigen binding protein increases TREM2-mediated pSyk levels with an EC50 less than 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay.
2. The isolated agonist antigen binding protein of claim 1, wherein the agonist antigen binding protein increases TREM2-mediated pSyk levels with an EC50 less than 300 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay.
3. The isolated agonist antigen binding protein of claim 1 , wherein the agonist antigen binding protein increases TREM2-mediated pSyk levels with an EC50 from about 150 pM to about 500 pM in the absence of a cross-linking agent as measured by a cell-based pSyk assay.
4. The isolated agonist antigen binding protein of any one of claims 1 to 3, wherein the agonist antigen binding protein specifically binds to human TREM2 with a KD less than 50 nM.
5. The isolated agonist antigen binding protein of any one of claims 1 to 3, wherein the agonist antigen binding protein specifically binds to human TREM2 with a KD less than 10 nM.
6. The isolated agonist antigen binding protein of any one of claims 1 to 5, wherein the agonist antigen binding protein does not specifically bind to human TREMl.
7. The isolated agonist antigen binding protein of any one of claims 1 to 6, wherein the agonist antigen binding protein competes with a reference antibody for binding to human TREM2, wherein the reference antibody comprises:(a) a light chain variable region comprising the sequence of SEQ ID NO: 61 and a heavy chain variable region comprising the sequence of SEQ ID NO: 124;(b) a light chain variable region comprising the sequence of SEQ ID NO: 62 and a heavy chain variable region comprising the sequence of SEQ ID NO: 125;(c) a light chain variable region comprising the sequence of SEQ ID NO: 52 and a heavy chain variable region comprising the sequence of SEQ ID NO: 115; or(d) a light chain variable region comprising the sequence of SEQ ID NO: 56 and a heavy chain variable region comprising the sequence of SEQ ID NO: 119.
8. An isolated agonist antigen binding protein that specifically binds to human TREM2, wherein the agonist antigen binding protein comprises a light chain variable region comprising complementarity determining regions CDRL1, CDRL2, and CDRL3 and a heavy chain variable region comprising complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein CDRL1 comprises a sequence selected from SEQ ID NOs: 5-18 or a variant thereof having one, two, three or four amino acid substitutions; CDRL2 comprises a sequence selected from SEQ ID NOs: 19-30 or a variant thereof having one, two, three or four amino acid substitutions; CDRL3 comprises a sequence selected from SEQ ID NOs: 31- 45 or a variant thereof having one, two, three or four amino acid substitutions; CDRH1 comprises a sequence selected from SEQ ID NOs: 77-86 or a variant thereof having one, two, three or four amino acid substitutions; CDRH2 comprises a sequence selected from SEQ ID NOs: 87-94 or a variant thereof having one, two, three or four amino acid substitutions; and CDRH3 comprises a sequence selected from SEQ ID NOs: 95-109 or a variant thereof having one, two, three or four amino acid substitutions.
9. The isolated agonist antigen binding protein of claim 8, wherein CDRL1 comprises a sequence selected from SEQ ID NOs: 5-18; CDRL2 comprises a sequence selected from SEQ ID NOs: 19-30; CDRL3 comprises a sequence selected from SEQ ID NOs: 31-45; CDRH1 comprises a sequence selected from SEQ ID NOs: 77-86; CDRH2 comprises a sequence selected from SEQ ID NOs: 87-94; and CDRH3 comprises a sequence selected from SEQ ID NOs: 95-109.
10. The isolated agonist antigen binding protein of claim 8 or 9, wherein the light chain variable region comprises (i) a sequence that is at least 90% identical to a sequence selectedfrom SEQ ID NOs: 46-63, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 46-63, or (iii) a sequence selected from SEQ ID NOs: 46-63.
11. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 54 or the sequence of SEQ ID NO:54 with a mutation at one or more amino acid positions 64, 79, 80, 85, 94, and / or 100.
12. The isolated agonist antigen binding protein of claim 11, wherein the mutation is V64G, V64A, Q79E, Q79D, S80P, S80A, F85V, F85L, F85A, F85D, F85I, F85L, F85M, F85T, W94F, W94Y, W94S, W94T, W94A, W94H, W94I, W94Q, P100R, P100Q, P100G, or combinations thereof.
13. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 55 or the sequence of SEQ ID NO:55 with a mutation at one or more amino acid positions 64, 79, 80, 94, and / or 100.
14. The isolated agonist antigen binding protein of claim 13, wherein the mutation is V64G, V64A, Q79E, Q79D, S80P, S80A, W94F, W94Y, W94S, W94T, W94A, W94H, W941, W94Q, P100R, P100Q, P100G, or combinations thereof.
15. The isolated agonist antigen binding protein of claim 14, wherein the mutation is V64G, V64A, Q79E, S80P, S80A, W94Y, W94S, P100R, P100Q, or combinations thereof.
16. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 60 or the sequence of SEQ ID NO: 60 with a mutation at one or more amino acid positions 60, 92, and / or 93.
17. The isolated agonist antigen binding protein of claim 16, wherein the mutation is L60S, L60P, L60D, L60A, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof.
18. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 61 or the sequence of SEQ ID NO:61 with a mutation at one or more amino acid positions 56, 57, 92, and / or 93.
19. The isolated agonist antigen binding protein of claim 18, wherein the mutation is N56S, N56T, N56Q, N56E, G57A, G57V, D92E, D92Q, D92T, D92N, S93A, S93N, S93Q, S93V, or combinations thereof.
20. The isolated agonist antigen binding protein of claim 19, wherein the mutation is N56S, N56Q, G57A, D92E, D92Q, S93A, or combinations thereof.
21. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 62 or the sequence of SEQ ID NO:62 with a mutation at amino acid position 36, 46, 61 and / or 100.
22. The isolated agonist antigen binding protein of claim 21, wherein the mutation is F36Y, S46L, S46R, S46V, S46F, K61R, P100Q, P100G, P100R or combinations thereof.
23. The isolated agonist antigen binding protein of claim 22, wherein the mutation is F36Y, K61R, P100Q, or combinations thereof.
24. The isolated agonist antigen binding protein of claim 10, wherein the light chain variable region comprises the sequence of SEQ ID NO: 52 or the sequence of SEQ ID NO: 52 with a mutation at amino acid position 91.
25. The isolated agonist antigen binding protein of claim 24, wherein the mutation is F91V, F91I, F91T, F91L, or F91D.
26. The isolated agonist antigen binding protein of claim 25, wherein the mutation is F91V.
27. The isolated agonist antigen binding protein of any one of claim 8 to 26, wherein the heavy chain variable region comprises (i) a sequence that is at least 90% identical to asequence selected from SEQ ID NOs: 110-126, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 110-126, or (in) a sequence selected from SEQ ID NOs: 110-126.
28. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 117 or the sequence of SEQ ID NO:117 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104.
29. The isolated agonist antigen binding protein of claim 28, wherein the mutation is M19K, M19R, M19T, M19E, M19N, M19Q, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y, W104T, W104S, W104A, W104H, W104I, W104Q, or combinations thereof.
30. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 118 or the sequence of SEQ ID NO:118 with a mutation at one or more amino acid positions 19, 55, 56, 57, 58, and / or 104.
31. The isolated agonist antigen binding protein of claim 30, wherein the mutation is M19K, M19R, M19T, M19E, M19N, M19Q, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, W104F, W104Y, W104T, W104S, W104A, W104H, W104I, W104Q, or combinations thereof.
32. The isolated agonist antigen binding protein of claim 31, wherein the mutation is M19K, D55E, S56A, D57E, T58A, W104Y, W104T, or combinations thereof.
33. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 123 or the sequence of SEQ ID NO: 123 with a mutation at one or more amino acid positions 27, 55, 56, 57, 58, 105, and / or 106.
34. The isolated agonist antigen binding protein of claim 33, wherein the mutation is H27Y, H27D, H27F, H27N, D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, SI 06V, S106T, or combinations thereof.
35. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 124 or the sequence of SEQ ID NO:124 with a mutation at one or more amino acid positions 55, 56, 57, 58, 105, and / or 106.
36. The isolated agonist antigen binding protein of claim 35, wherein the mutation is D55E, D55Q, D55N, D55T, S56A, S56Q, S56V, D57S, D57E, D57Q, T58A, T58V, D105E, D105Q, D105T, D105N, D105G, S106A, S106Q, S106V, S106T, or combinations thereof.
37. The isolated agonist antigen binding protein of claim 36, wherein the mutation is D55E, D55Q, S56A, D57E, T58A, D105E, D105N, S106A, or combinations thereof.
38. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 125 or the sequence of SEQ ID NO:125 with a mutation at one or more amino acid positions 43, 76, 85, 99, 100, and / or 116.
39. The isolated agonist antigen binding protein of claim 38, wherein the mutation is L43Q, L43K, L43H, I76T, R85S, R85G, R85N, R85D, D99E, D99Q, D99S, D99T, G100A, G100Y, G100V, T116L, T116M, T116P, T116R, or combinations thereof.
40. The isolated agonist antigen binding protein of claim 39, wherein the mutation is L43Q, I76T, R85S, D99E, G100A, G100Y, Tl 16L, or combinations thereof.
41. The isolated agonist antigen binding protein of claim 27, wherein the heavy chain variable region comprises the sequence of SEQ ID NO: 115 or the sequence of SEQ ID NO: 115 with a mutation at amino acid position 62 and / or 63.
42. The isolated agonist antigen binding protein of claim 41 , wherein the mutation is D62E, D62Q, D62T, D62N, S63A, S63Q, S63V, or combinations thereof.
43. The isolated agonist antigen binding protein of claim 42, wherein the mutation is D62E, D62Q, S63A, or combinations thereof.
44. An isolated agonist antigen binding protein that specifically binds to human TREM2, wherein the agonist antigen binding protein comprises a light chain variable region comprising complementarity determining regions CDRLl, CDRL2, and CDRL3 and a heavy chain variable region comprising complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein CDRL1 comprises the sequence of SEQ ID NO: 16, CDRL2 comprises a sequence of SEQ ID NO: 139, CDRL3 comprises a sequence of SEQ ID NO: 140, CDRH1 comprises the sequence of SEQ ID NO: 85, CDRH2 comprises a sequence of SEQ ID NO: 141, and CDRH3 comprises a sequence of SEQ ID NO: 142.
45. The isolated agonist antigen binding protein of claim 44, wherein CDRL1 comprises the sequence of SEQ ID NO: 16, CDRL2 comprises a sequence selected from SEQ ID NOs: 26 and 143-147, CDRL3 comprises a sequence selected from SEQ ID NOs: 43 and 148-152, CDRH1 comprises the sequence of SEQ ID NO: 85, CDRH2 comprises a sequence selected from SEQ ID NOs: 91 and 170-175, and CDRH3 comprises a sequence selected from SEQ ID NOs: 176-179.
46. The isolated agonist antigen binding protein of claim 44 or 45, wherein the light chain variable region comprises (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 153-162, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 153-162, or (iii) a sequence selected from SEQ ID NOs: 153- 162.
47. The isolated agonist antigen binding protein of any one of claims 44 to 46, wherein the heavy chain variable region comprises (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 180-190, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 180-190, or (iii) a sequence selected from SEQ ID NOs: 180-190.
48. An isolated agonist antigen binding protein that specifically binds to human TREM2, wherein the agonist antigen binding protein comprises a light chain variable region comprising complementarity determining regions CDRLl, CDRL2, and CDRL3 and a heavy chain variable region comprising complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein CDRLl comprises a sequence of SEQ ID NO: 284, CDRL2 comprises a sequence of SEQ ID NO: 285, CDRL3 comprises a sequence of SEQ ID NO: 286, CDRHlcomprises a sequence of SEQ ID NO: 287, CDRH2 comprises a sequence of SEQ ID NO: 288, and CDRH3 comprises a sequence of SEQ ID NO: 289.
49. The isolated agonist antigen binding protein of claim 48, wherein CDRL1 comprises a sequence selected from SEQ ID NOs: 16, 290, and 291, CDRL2 comprises a sequence selected from SEQ ID NOs: 28, 292, and 293, CDRL3 comprises a sequence selected from SEQ ID NOs: 43, 294, and 271, CDRHl comprises the sequence of SEQ ID NO: 85 or SEQ ID NO: 302, CDRH2 comprises the sequence of SEQ ID NO: 91 or SEQ ID NO: 303, and CDRH3 comprises a sequence selected from SEQ ID NOs: 107 and 304-306.
50. The isolated agonist antigen binding protein of claim 48 or 49, wherein the light chain variable region comprises (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 61 and 295-300, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 61 and 295-300, or (iii) a sequence selected from SEQ ID NOs: 61 and 295-300.
51. The isolated agonist antigen binding protein of any one of claims 48 to 50, wherein the heavy chain variable region comprises (i) a sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 124 and 307-312, (ii) a sequence that is at least 95% identical to a sequence selected from SEQ ID NOs: 124 and 307-312, or (iii) a sequence selected from SEQ ID NOs: 124 and 307-312.
52. The isolated agonist antigen binding protein of any one of claims 1 to 51, wherein the agonist antigen binding protein is a monoclonal antibody or binding fragment thereof.
53. The isolated agonist antigen binding protein of claim 52, wherein the monoclonal antibody or binding fragment thereof is a chimeric antibody or binding fragment thereof, a humanized antibody or binding fragment thereof, or a fully human antibody or binding fragment thereof.
54. The isolated agonist antigen binding protein of claim 52 or 53, wherein the monoclonal antibody is a human IgGl, IgG2, IgG3, or IgG4 antibody.
55. The isolated agonist antigen binding protein of claim 54, wherein the monoclonal antibody is a human lgG2 antibody.
56. The isolated agonist antigen binding protein of claim 55, wherein the monoclonal antibody comprises a C131S mutation according to EU numbering in its heavy chain.
57. The isolated agonist antigen binding protein of claim 55, wherein the monoclonal antibody comprises a C214S mutation according to EU numbering in its light chain and a C220S mutation according to EU numbering in its heavy chain.
58. The isolated agonist antigen binding protein of claim 54, wherein the monoclonal antibody is a human IgGl antibody.
59. The isolated agonist antigen binding protein of claim 58, wherein the monoclonal antibody is an aglycosylated human IgGl antibody.
60. The isolated agonist antigen binding protein of claim 59, wherein the monoclonal antibody comprises a mutation at amino acid position N297 according to EU numbering in its heavy chain.
61. The isolated agonist antigen binding protein of claim 60, wherein the mutation is N297G.
62. The isolated agonist antigen binding protein of claim 60 or 61 , wherein the monoclonal antibody further comprises R292C and V302C mutations according to EU numbering in its heavy chain.
63. The isolated agonist antigen binding protein of claim 52, wherein the monoclonal antibody comprises an Fc region from a human IgGl antibody and a CHI region and hinge region from a human lgG2 antibody.
64. The isolated agonist antigen binding protein of claim 63, wherein the monoclonal antibody comprises a mutation at amino acid position N297 according to EU numbering in its heavy chain.
65. The isolated agonist antigen binding protein of claim 64, wherein the mutation is N297G.
66. The isolated agonist antigen binding protein of claim 64 or 65, wherein the monoclonal antibody further comprises R292C and V302C mutations according to EU numbering in its heavy chain.
67. The isolated agonist antigen binding protein of any one of claims 63 to 66, wherein the monoclonal antibody comprises a C 13 IS mutation according to EU numbering in its heavy chain.
68. The isolated agonist antigen binding protein of any one of claims 63 to 66, wherein the monoclonal antibody comprises a C214S mutation according to EU numbering in its light chain and a C220S mutation according to EU numbering in its heavy chain.
69. An isolated agonist antigen binding protein that specifically binds to human TREM2, wherein the agonist antigen binding protein comprises a light chain comprising a light chain variable region and a heavy chain comprising a heavy chain variable region, wherein:(a) the light chain variable region have the amino acid sequence of SEQ ID NO: 326, and the heavy chain variable region have the amino acid sequence of SEQ ID NO: 327;(b) the light chain variable region have the amino acid sequence of SEQ ID NO: 328, and the heavy chain variable region have the amino acid sequence of SEQ ID NO: 329;(c) the light chain variable region have the amino acid sequence of SEQ ID NO: 330, and the heavy chain variable region have the amino acid sequence of SEQ ID NO: 331; or(d) the light chain variable region have the amino acid sequence of SEQ ID NO: 332, and the heavy chain variable region have the amino acid sequence of SEQ ID NO: 333.
70. The isolated agonist antigen binding protein of claim 69, wherein:(a) the light chain having the amino acid sequence of SEQ ID NO: 334, and the heavy chain having the amino acid sequence of SEQ ID NO: 335;(b) the light chain having the amino acid sequence of SEQ ID NO: 334, and the heavy chain having the amino acid sequence of SEQ ID NO: 336;(c) the light chain having the amino acid sequence of SEQ JD NO: 337, and the heavy chain having the amino acid sequence of SEQ ID NO: 338;(d) the light chain having the amino acid sequence of SEQ ID NO: 339, and the heavy chain having the amino acid sequence of SEQ ID NO: 340; or(e) the light chain having the amino acid sequence of SEQ ID NO: 341, and the heavy chain having the sequence amino acid of SEQ ID NO: 342.
71. A pharmaceutical composition comprising the agonist antigen binding protein of any one of claims 1 to 70 and a pharmaceutically acceptable excipient.
72. An isolated polynucleotide that encodes the agonist antigen binding protein of any one of claims 1 to 70.
73. An expression vector comprising the polynucleotide of claim 72.
74. A host cell comprising the expression vector of claim 73.
75. A method of producing an agonist antigen binding protein that specifically binds to human TREM2 comprising culturing the host cell of claim 74 under conditions that allow expression of the antigen binding protein; and recovering the antigen binding protein from the culture medium or host cell.
76. A method of increasing survival or proliferation of macrophages or microglia in a patient in need thereof comprising administering to the patient an effective amount of the agonist antigen binding protein of any one of claims 1 to 70.
77. A method of treating or preventing a condition associated with a loss of function of human TREM2 in a patient in need thereof comprising administering to the patient an effective amount of the agonist antigen binding protein of any one of claims 1 to 70.
78. The method of claim 77, wherein the condition is Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke.