Parthenocarpy regulation gene and use thereof

TR202608022T4Active Publication Date: 2026-06-22NAT AGRI & FOOD RES ORG +1
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
TR202608022
Authority / Receiving Office
TR · TR
Patent Type
Patents
Current Assignee / Owner
Priority Date
2014-01-17
Filing Date
2015-01-19
Publication Date
2026-06-22
Estimated Expiration
2035-01-19

AI Technical Summary

Technical Problem

The IAA synthesis mechanism in solanaceous plants is complex and poorly understood, leading to unstable phenotypic expression of parthenocarpy, making it difficult to evaluate and requiring significant manpower and time for emasculation and fruit set evaluation.

Method used

A method for evaluating parthenocarpy by inhibiting the expression of specific parthenocarpy regulatory genes or their encoded polypeptides, using nucleotides and polypeptides with defined sequences or sequence identities, and hybridizing conditions to assess parthenocarpy regulatory activity.

Benefits of technology

Enables efficient evaluation and production of parthenocarpic plants by using genes or polypeptides as indicators, reducing the need for manual labor and time in evaluating parthenocarpy.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

The present invention relates to a plant exhibiting parthenocarpy identical to that of a plant of the Solanaceae family or a plant of which thereis is a parthenocarpic plant, and in each of which (i) the expression of a parthenocarpy regulatory gene containing a polynucleotide cited in (1) to (4) below is inhibited or (ii) the function of a polypeptide encoded by the parthenocarpy regulatory gene is reduced or defective compared to a wild-type plant, where the function of the polypeptide refers to an activity (amino group transferase activity) to catalyze a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), and substitution, deletion, insertion and / or addition of an amino acid in the amino acid sequence of the polypeptide occurs in such a way as to cause a defect or reduction in amino group transferase activity. Figure 1
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] The present invention relates to solanaceous plant or a progeny plant thereof, each of which is a parthenocarpic plant and in each of which (i) expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (1) through (4) below, is inhibited or (ii) a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is decreased or defective, as compared with a wild type plant, wherein the function of the polypeptide refers to an activity (amino group transferase activity) for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), and wherein in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause the decrease or defect of the amino group transferase activity.Background Art

[0002] In solanaceous plants such as eggplant and tomato, in general, pollination is normally carried out after anthesis, and a fruit is enlarged after seeds are formed in the fruit. On the other hand, a trait with which a fruit is normally enlarged and matured without pollination and seed formation is called parthenocarpy. This trait is significantly advantageous in fields of agriculture, horticulture, and the like in terms of harvesting fruits without carrying out, for example, work such as pollination induction with the use of flower visiting insects or fructification induction by hormone drug application.

[0003] Conventionally, with regard to solanaceous plants, it has been known that change in amount of auxin, which is one of phytohormones, in an ovary is one of factors for inducing parthenocarpy. For example, it is known that parthenocarpy is induced by applying a synthetic auxin to an eggplant flower or the like (Non-patent Literature 1).

[0004] With regard to a synthesis mechanism, in a plant, of indole acetic acid (hereinafter, referred to as "IAA") which is one of natural auxin, there have been prior study in which Arabidopsis is used as an experimental model plant. In Arabidopsis, the existence of an IPyA pathway is known as a biosynthetic pathway. In addition, the existence of a TAM pathway, an IAM pathway, and the like is presumed. It is becoming clear that many genes are relevant to these pathways and, recently, not only a gene which encodes an enzyme that positively functions with respect to IAA synthesis but also the existence of a gene which encodes an enzyme that negatively functions have been reported. For example, Non-patent Literature 2 discloses VAS1 which catalyzes reaction to generate tryptophan by transferring an amino group from methionine to an indole pyruvic acid (IPyA) in an IPyA pathway which is one of IAA synthesis pathways of Arabidopsis. Thus, VAS1 encodes an enzyme that negatively functions with respect to IAA synthesis.

[0005] Non-patent Literature 3 discloses that parthenocarpy is induced in eggplant by placenta-specific and ovule-specific expression of iaaM which is an IAA synthesis enzyme relevant to an IAM pathway that (i) is one of the IAA synthesis pathways and (ii) exists in a bacterium. Note that an experiment in Non-patent Literature 3 was carried out with the use of a plant in which excessive expression of bacterium-derived iaaM of Pseudomonas was caused under control by a snapdragon-derived promotor.

[0006] Patent Literature 1 discloses Solanum tycopersicum plants carrying one or more of the pat-6, pat-7, pat-8 and pat-9 parthenocarpy genes, capable of producing seedless tomatoes.Citation List[Non-patent Literature]

[0007] [Non-patent Literature 1] Nothmann et al. (1975) J. Hort. Sci. 50: 23-27 [Non-patent Literature 2] Zheng et al. (2013) Nature Chem. Biol. 9: 244-246 [Non-patent Literature 3] Rotino et al., (1997) Nature Biotechnology 15: 1398-1401 [Patent Literature]

[0008] [Patent Literature 1] WO2009005343 A1Summary of InventionTechnical Problem

[0009] As disclosed in Non-patent Literatures 2 and 3, existence of genes relevant to IAA synthesis has been known. However, the IAA synthesis mechanism is a highly complicated pathway, and it is predictable that many unknown genes play significant roles in the IAA synthesis pathway. Further, clarification of functions of the unknown genes in the IAA synthesis may lead to a highly useful technique in fields of agriculture, horticulture, and the like. Depending on cultivation conditions or cultivar lines, phenotypic expression of parthenocarpy can become unstable, and therefore it is sometimes difficult to evaluate parthenocarpy if the evaluation is based only on appearance of a plant. Moreover, in order to evaluate parthenocarpy, much manpower and time are required for emasculation before anthesis, evaluation of fruit set, and the like.Solution to Problem

[0010] In order to attain the object, the present encompasses any one of the aspect defined by the claims. Any subject-matter falling outside the scope of the claims is provided for information purposes only.

[0011] As illustrative information only, it is disclosed herein: <1> A method for evaluating parthenocarpy of a plant, the method including the step of: checking whether or not expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (1) through (4) below, is inhibited in the plant; or checking whether or not a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited in the plant. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <2> A parthenocarpy regulatory gene that includes a polynucleotide recited in any of (1) through (4) below. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <3> A polypeptide recited in any of (1) through (4) below. (1) A polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polypeptide that (i) is encoded by a polynucleotide which is hybridized, under a stringent condition, with a polynucleotide that has a sequence complementary to a polynucleotide for encoding the polypeptide recited in the above (1) and (ii) has a parthenocarpy regulatory activity. <4> A plant which is a parthenocarpic plant and in which (i) expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (1) through (4) below, is inhibited or (ii) a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. Advantageous Effects of Invention

[0012] It is possible to evaluate parthenocarpy of a plant or to produce a parthenocarpic plant by using, as an indicator or a target, a gene or a polypeptide encoded by the gene.Brief Description of Drawings

[0013] Fig. 1 is a view illustrating parthenocarpy of a parthenocarpic eggplant line "PCSS" in Example 1 of the present invention. Fig. 2 is a view illustrating a linkage map of a region in which a parthenocarpy responsible gene A is located in Example 1 of the present invention. Fig. 3 is a view illustrating a correspondence between a phenotype (i.e., presence / absence of parthenocarpy) and a marker genotype in generations after crossbreeding of a parthenocarpic eggplant line PCSS and a non-parthenocarpic eggplant line TN-43 in Example 1 of the present invention. Fig. 4 is a view illustrating mRNA accumulation amounts in genes A of sites of "Nakateshinkuro" at different developing stages, in Example 1 of the present invention. Fig. 5 is a view schematically illustrating a structure of a gene A and a mutation structure of a gene A in a PCSS line, in Example 1 of the present invention. Fig. 6(a) is a view schematically illustrating a vector having a promoter sequence of a gene A, in Example 1 of the present invention. Fig. 6(b) is a view schematically illustrating a vector constructed during preparation of an RNAi induction vector, in Example 1 of the present invention. Fig. 6(c) is a view schematically illustrating a vector constructed during preparation of an RNAi induction vector, in Example 1 of the present invention. Fig. 6(d) is a view schematically illustrating an RNAi induction vector in Example 1 of the present invention. Fig. 7 is a view illustrating parthenocarpy of an eggplant transformant in Example 1 of the present invention. Fig. 8 is a view illustrating an accumulation amount of a transcript of parthenocarpic gene A in each of eggplant transformants in Example 1 of the present invention. Fig. 9 is a view illustrating an endogenous IAA concentration in a parthenocarpic eggplant line PCSS, in Example 1 of the present invention. Fig. 10 is a view illustrating an intermediate product concentration in an endogenous IAA synthesis pathway or an IAA metabolite concentration in a parthenocarpic eggplant line PCSS, in Example 1 of the present invention. Fig. 11 is a view illustrating an endogenous IAA concentration in an eggplant transformant, in Example 1 of the present invention. Fig. 12 is a view illustrating amino group transferase activity, in Example 1 of the present invention. Fig. 13(a) is a view schematically illustrating a vector constructed during preparation of an RNAi induction vector, in Example 2 of the present invention. Fig. 13(b) is a view schematically illustrating an RNAi induction vector, in Example 2 of the present invention. Fig. 13(c) is a view schematically illustrating a vector having a promoter sequence of a gene tA, in Example 2 of the present invention. Fig. 13(d) is a view schematically illustrating an RNAi induction vector, in Example 2 of the present invention. Fig. 14 is a view illustrating parthenocarpy of a tomato transformant, in Example 2 of the present invention. Fig. 15 is a view illustrating an accumulation amount of a transcript of a parthenocarpic gene tA in a tomato transformant, in Example 2 of the present invention. Fig. 16 is a view illustrating an endogenous IAA concentration in a tomato transformant, in Example 2 of the present invention. Fig. 17 is a view illustrating parthenocarpy of a pepper mutant, in Example 3 of the present invention. Fig. 18 is a view illustrating an endogenous IAA concentration in a pepper mutant, in Example 3 of the present invention. Fig. 19 is a view illustrating promoter analysis of a parthenocarpic gene A with use of a GUS (β-glucuronidase) gene, in Example 4 of the present invention. Fig. 20 is a view illustrating parthenocarpy of an eggplant transformant produced separately from the eggplant transformant of Example 1, in Example 4 of the present invention. Fig. 21 is a view illustrating an accumulation amount of a transcript of a parthenocarpic gene A and an endogenous IAA concentration in an eggplant transformant produced separately from the eggplant transformant of Example 1, in Example 4 of the present invention. Fig. 22 is a view schematically illustrating a vector for preparing an eggplant transformant, in Example 4 of the present invention. Fig. 23 is a view illustrating parthenocarpy of an eggplant transformant in a line "M3A", in Example 4 of the present invention. Fig. 24 is a view illustrating endogenous IAA concentration in an eggplant transformant in a line "M3A", in Example 4 of the present invention. Fig. 25 is a view illustrating weights of a fruit produced from a normally pollinated flower and a fruit produced from a flower whose pollination has been prevented by removing its stigma in near-isogenic lines, in Example 4 of the present invention. Fig. 26 is a view schematically illustrating an E. coli expression vector of a gene A, in Example 4 of the present invention. Fig. 27 is a view illustrating (i) a result of carrying out electrophoresis on purified protein of a protein A which has been expressed by E. coli and (ii) amino group transferase activity of the E. coli expression protein A, in Example 4 of the present invention. Detailed Description

[0014] The following description will discuss an embodiment of the present invention.[Definitions of Terms]

[0015] In this specification, "polynucleotide" can be reworded as "nucleic acid" or "nucleic acid molecule", and is intended to be a polymer of nucleotides. Moreover, "base sequence" can be reworded as "nucleic acid sequence" or "nucleotide sequence", and is intended to be a sequence of deoxyribonucleotide or a sequence of ribonucleotide, unless otherwise particularly noted.

[0016] In this specification, "polypeptide" can be reworded as "protein".

[0017] In this specification, "parthenocarpy (parthenocarpic)" is intended to be a trait of a plant whose fruit is enlarged without pollination.

[0018] In this specification, "heterozygote (heterozygous)" is intended to be a state in which different allelic genes are at corresponding gene loci on respective homologous chromosomes, and "homozygote (homozygous)" is intended to be a state in which identical allelic genes are at corresponding gene loci on respective homologous chromosomes.

[0019] In this specification, "eggplant" is a concept that encompasses, in the broad sense, cultivated species "Solanum (hereinafter, referred to as "S") melongena" and wild species "S. incanum", "S. torvum", "S. nigrum", "S. aethiopicum", "S. macrocarpon", and "S. quitoense", and is intended to be "S. melongena" in the narrow sense.

[0020] In this specification, "tomato" is a concept that encompasses, in the broad sense, cultivated species "S. lycopersicum" and wild species "S. cheesmaniae, S. chilense, S. chmielewskii, S. galapagense, S. habrochaites, S. lycopersicoides, S. neorickii, S. pennellii, S. peruvianum, and S. pimpinellifolium", and is intended to be "S. lycopersicum" in the narrow sense.

[0021] In this specification, "pepper" is a concept that encompasses, in the broad sense, cultivated species "Capsicum (hereinafter, referred to as "C") annuum", and wild species "C. pubescens", "C. baccatum", "C. chinense", and "C. frutescens", and is intended to be "C. annuum" in the narrow sense. Moreover, "pepper" is a concept that encompasses plants called by names other than "pepper", e.g., horticultural crops called "piment", "paprika", and "sweet pepper".

[0022] In this specification, "A and / or B" is a concept that includes both "A and B" and "A or B", and can be reworded as "at least one of A and B".

[0023] In this specification, a wording "polynucleotides are complementary to each other" is synonymous with "base sequences of respective polynucleotides are complementary to each other".[1. Parthenocarpy regulatory gene]

[0024] A parthenocarpy regulatory gene as disclosed herein encodes a polypeptide that has an activity (i.e., a parthenocarpy regulatory activity) to regulate at least parthenocarpy. The polypeptide "that has an activity to regulate parthenocarpy" indicates that expression of a trait, i.e., parthenocarpy is inhibited by the presence of the polypeptide, that is, parthenocarpy is negatively regulated. Moreover, in a case where expression of the parthenocarpy regulatory gene is inhibited or an activity of a polypeptide encoded by the parthenocarpy regulatory gene is inhibited, a plant shows a parthenocarpy trait or has a predisposition of the trait even though parthenocarpy is not shown.

[0025] Moreover, an example of the parthenocarpy regulatory gene encodes an amino group transferase which catalyzes reaction to synthesize tryptophan by transferring an amino group of amino acid to IPyA. In a case where the transferase has an activity, expression of parthenocarpy trait is inhibited (i.e., having parthenocarpy regulatory activity), whereas in a case where the activity of the transferase is inhibited, a plant shows a parthenocarpy trait or has a predisposition of the trait even though parthenocarpy is not shown.

[0026] The parthenocarpy regulatory gene includes any of polynucleotides described in the following (1) through (4): (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1. (2) A polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity. Note that the sequence identity of the amino acid sequence is preferably 80% or higher, more preferably 85% or higher, more preferably 90% or higher, further preferably 95% or higher, particularly preferably 96% or higher, 97% or higher, 98% or higher, or 99% or higher. For example, a mutant gene derived from eggplant and a homologous gene derived from a plant other than eggplant are encompassed in this scope. (3) A polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity. Note that the number of amino acids which are substituted, deleted, inserted, and / or added is more preferably 1 to 78, more preferably 1 to 43, more preferably 1 to 39, more preferably 1 to 19, further preferably 1 to 15, particularly preferably 1 to 11, 1 to 5, or 6.

[0027] Note that the deletion, substitution, and / or addition of amino acids can be, for example, (i) carried out by artificially introducing a mutation(s) by the use of site-directed mutagenesis such as a Kunkel method (Kunkel et al. (1985): Proc.Natl.Acad.Sci.USA, vol. 82. p488-) or (ii) derived from a naturally occurring similar mutant polypeptide. (4) A polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide described in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. Note that the stringent condition is, for example, a condition described in Reference Literature [Molecular cloning-a Laboratory manual 2nd edition (Sambrook et al., 1989)]. Specifically, the stringent condition is, for example, a condition in which the polynucleotide is hybridized by being constantly heated, at 65°C for 8 to 16 hours together with a probe, in a solution that contains 6 × SSC (composition of 1 × SSC: 0.15 M of sodium chloride, 0.015 M of sodium citrate, pH 7.0), 0.5% of SDS, 5 × Denhardt's solution, and 100 mg / mL of herring sperm DNA. Note that the polynucleotide preferably has a sequence identity of 75% or higher, more preferably has a sequence identity of 80% or higher, more preferably has a sequence identity of 85% or higher, further preferably has a sequence identity of 90% or higher, particularly preferably has a sequence identity of 95% or higher, 96% or higher, 97% or higher, 98% or higher, or 99% or higher, relative to the base sequence of the polynucleotide described in the above (1).

[0028] The parthenocarpy regulatory gene can exist in a form of RNA (e.g., mRNA) or a form of DNA (e.g., cDNA or genomic DNA). The DNA can be double-stranded or single-stranded. The base sequence represented by SEQ ID NO: 2, which is an illustrative example of the polynucleotide disclosed herein, is a full-length cDNA of a gene that encodes the polypeptide represented by SEQ ID NO: 1. The parthenocarpy regulatory gene can include an additional sequence such as a sequence of an untranslated region (UTR).

[0029] A method for obtaining (isolating) the parthenocarpy regulatory gene is not limited to a particular one, and can be a method which includes, for example, (i) preparing a probe which is specifically hybridized with a part of the base sequence of the parthenocarpy regulatory gene and (ii) screening a genomic DNA library or a cDNA library.

[0030] Alternatively, the method for obtaining the parthenocarpy regulatory gene can be a method which uses amplifying means such as PCR. For example, a large amount of DNA fragments each containing the parthenocarpy regulatory gene can be obtained by (i) preparing primers from respective 5' end and 3' end sequences (or complementary sequences thereof) in cDNA of the parthenocarpy regulatory gene, (ii) carrying out PCR or the like with the use of the primers and genomic DNA (or cDNA) or the like as a template, and (iii) amplifying a DNA region between the primers.

[0031] An origin of the parthenocarpy regulatory gene is not limited to a particular one, provided that the origin is a plant. The origin can be a solanaceous plant, a rosaceous plant, a cucurbitaceous plant, or the like, and the solanaceous plant is preferable. Among these, the origin is preferably a solanum plant such as eggplant or tomato, or a capsicum plant such as pepper, more preferably any of eggplant, tomato, and pepper, further preferably eggplant or tomato, particularly preferably eggplant.

[0032] Note that whether or not a candidate gene of the isolated parthenocarpy regulatory gene has an intended parthenocarpy regulatory activity can be evaluated by observing whether or not parthenocarpy of the original plant is induced by inhibiting expression of the candidate gene in the original plant.

[0033] The parthenocarpy regulatory gene disclosed herein can be used to elucidate a mechanism of parthenocarpy of a plant.

[0034] Examples of the parthenocarpy regulatory gene encompass a gene derived from S. melongena which is eggplant (SEQ ID NO: 2, SEQ ID NO: 3 (including ORF), SEQ ID NO: 4 (from a transcription start site to a transcription end site), and SEQ ID NO: 24 (a sequence from 2000 bases upstream of a transcription start site to 1000 bases downstream of a transcription end site)), a gene derived from S. lycopersicum which is tomato (SEQ ID NO: 29), a gene derived from S. pimpinellifolium which is an allied species of tomato (SEQ ID NO: 31), a gene derived from S. tuberosum phureja which is potato (diploid species) (SEQ ID NO: 33), a gene derived from Capsicum annuum which is pepper (SEQ ID NO: 35), a gene derived from Malus domestica which is apple (SEQ ID NO: 37), and the like. Moreover, the parthenocarpy regulatory gene encompasses a gene including nucleotides which have a parthenocarpy regulatory activity and have a sequence identity of 75% or higher, 80% or higher, 85% or higher, 90% or higher, 95% or higher, 96% or higher, 97% or higher, 98% or higher, or 99% or higher, relative to a base sequence of the above exemplified polynucleotide.

[0035] The parthenocarpy regulatory gene is not limited to a particular expression site and a particular developing stage at which expression occurs. For example, the parthenocarpy regulatory gene is expressed in a bud before anthesis or in an ovary at anthesis.[2. Polypeptide as parthenocarpy regulatory protein]

[0036] The polypeptide disclosed herein is a product obtained by translating the parthenocarpy regulatory gene described in the part [1. Parthenocarpy regulatory gene] above and has at least an activity to regulate parthenocarpy of a plant. As above described, the polypeptide inhibits appearance of the trait of parthenocarpy, i.e., negatively regulates parthenocarpy.

[0037] The polypeptide can be isolated from a natural resource or can be chemically synthesized. Specifically, the polypeptide encompasses a product obtained by purifying a substance isolated from a natural resource, a product obtained in chemical synthesis process, and a translated product obtained from a procaryotic host or a eucaryotic host (e.g., bacterial cell, yeast cell, higher plant cell, insect cell, or mammalian cell) by a recombination technique.

[0038] Specifically, the polypeptide is a polypeptide described in any of (1) through (4) below. Note that the polypeptide is a translated product of the parthenocarpy regulatory gene. Therefore, a meaning of the wordings such as "hybridize under a stringent condition" can be understood with reference to the descriptions in [1. Parthenocarpy regulatory gene] above. (1) A polypeptide having an amino acid sequence represented by SEQ ID NO: 1. (2) A polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity. Note that the sequence identity is preferably 80% or higher, more preferably 85% or higher, more preferably 90% or higher, further preferably 95% or higher, particularly preferably 96% or higher, 97% or higher, 98% or higher, or 99% or higher. (3) A polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity. Note that the number of amino acids which are substituted, deleted, inserted, and / or added is more preferably 1 to 78, more preferably 1 to 43, more preferably 1 to 39, more preferably 1 to 19, further preferably 1 to 15, particularly preferably 1 to 11, 1 to 5, or 6. (4) A polypeptide that (i) is encoded by a polynucleotide which is hybridized, under a stringent condition, with a polynucleotide that has a sequence complementary to a polynucleotide for encoding the polypeptide described in the above (1) and (ii) has a parthenocarpy regulatory activity.

[0039] The polypeptide may be a polypeptide constituted by peptide bonding of amino acids. Note, however, that the polypeptide is not limited to this and can contain a structure other than a polypeptide structure. The structure other than polypeptide can be a sugar chain, an isoprenoid group, and the like, but is not limited to these in particular.

[0040] Moreover, an feature of the polypeptide disclosed herein is an amino group transferase. More specifically, for example, the polypeptide of has a function as enzyme protein for catalyzing a reaction to generate tryptophan by transferring an amino group contained in amino acid to IPyA. As another example, the polypeptide has a function as an enzyme protein for catalyzing a reaction to generate tryptophan by transferring an amino group contained in methionine to IPyA.

[0041] Note that examples of the polypeptide as the parthenocarpy regulatory protein encompass a polypeptide derived from S. melongena which is eggplant (SEQ ID NO: 1), a polypeptide derived from S. lycopersicum which is tomato (SEQ ID NO: 28), a polypeptide derived from S. pimpinellifolium which is an allied species of tomato (SEQ ID NO: 30), a polypeptide derived from S. tuberosum phureja which is potato (diploid species) (SEQ ID NO: 32), a polypeptide derived from Capsicum annuum which is pepper (SEQ ID NO: 34), a polypeptide derived from Malus domestica which is apple (SEQ ID NO: 36), and the like.[3. Recombinant expression vector and transformant]

[0042] It is also disclosed herein (i) a recombinant expression vector in which the parthenocarpy regulatory gene is incorporated such that the parthenocarpy regulatory gene can be expressed and (ii) a transformant in which the recombinant expression vector or the parthenocarpy regulatory gene is introduced such that the recombinant expression vector or the parthenocarpy regulatory gene can be expressed.

[0043] A type of a vector for constituting the recombinant expression vector is not limited to a particular one, and a vector which can be expressed in a host cell can be selected as appropriate. That is, a promoter sequence is appropriately selected depending on a type of a host cell, and a vector, in which the promoter sequence and the parthenocarpy regulatory gene are incorporated in, for example, a plasmid, a phagemid, a cosmid, or the like, can be used as an expression vector.

[0044] Examples of the host cell into which an expression vector is introduced encompass a bacterial cell, a yeast cell, a fungal cell other than a yeast cell, a higher eucaryotic cell, and the like. The bacterial cell can be, for example, an E. coli cell. Examples of the higher eucaryotic cell encompass a plant cell and an animal cell. Examples of the plant cell encompass a dicotyledon cell and a monocotyledon cell. The dicotyledon cell can be, for example, a suspension cultured cell of a solanaceous plant (e.g., a tobacco BY-2 strain and a tomato Sly-1 strain), and the monocotyledon cell can be, for example, an Oc strain which is a suspension cultured cell of rice. Examples of the animal cell encompass an insect cell, an amphibian cell, a reptile cell, an avian cell, a fish cell, a mammalian cell, and the like.

[0045] The vector is preferably an expression vector. In the expression vector, the polynucleotide is functionally linked with an element (e.g., promoter) that is necessary for transcription. Moreover, according to need, the polynucleotide can be linked with an enhancer, a selection marker, a splicing signal, a poly A addition signal, a 5'-UTR sequence, and / or the like. The promoter is a DNA sequence that shows a transcription activity in a host cell, and can be appropriately selected depending on a type of host.

[0046] Examples of a promoter sequence that can work in a host cell encompass a 35S promoter of cauliflower mosaic virus, a nopaline synthetase gene promoter of Agrobacterium, a rice ubiquitin gene promoter, and the like.

[0047] It is possible to use a sequence of a promoter region in the polynucleotide as a recombinant expression promoter.

[0048] In the expression vector, the polynucleotide can be functionally linked with a proper terminator (e.g., a NOS terminator or a 35S terminator of cauliflower mosaic virus), according to need. A type of the proper terminator can be selected as appropriate in accordance with a type of a host cell, provided that the terminator is a sequence that can terminate transcription of a gene that is transcribed by the above described promoter. The enhancer is used to enhance expression efficiency of an intended gene, and can be, for example, an omega sequence of tobacco mosaic virus.

[0049] The recombinant expression vector can further contain a selection marker. The selection marker can be, for example, a resistance gene for a drug such as ampicillin, kanamycin, tetracycline, chloramphenicol, neomycin, hygromycin, or spectinomycin.

[0050] In the recombinant expression vector, the polynucleotide disclosed herein can be bound with a suitable tag sequence for protein purification or a suitable spacer sequence, according to need.

[0051] The transformant encompasses an organism, as well as a cell, a tissue, and an organ in which the recombinant expression vector or the parthenocarpy regulatory gene is introduced such that the recombinant expression vector or the parthenocarpy regulatory gene can be expressed. A species of the transformant is not limited to a particular one and can be, for example, a microorganism such as E. coli, a plant, an animal, or the like.[4. Method for evaluating parthenocarpy of plant]

[0052] A method for evaluating parthenocarpy includes a step of checking (i) whether or not expression of the parthenocarpy regulatory gene is inhibited in a plant or (ii) whether or not a function of a polypeptide encoded by the parthenocarpy regulatory gene is inhibited in the plant. Here, the "parthenocarpy regulatory gene" indicates the parthenocarpy regulatory gene described in [1. Parthenocarpy regulatory gene] above, and the "polypeptide encoded by the parthenocarpy regulatory gene" indicates the polypeptide described in [2. Polypeptide as parthenocarpy regulatory protein] above. Note that the inhibition of expression of the parthenocarpy regulatory gene encompasses inhibition of gene transcription and inhibition of translation into a protein.

[0053] Moreover, the case where "expression of the parthenocarpy regulatory gene is inhibited" encompasses both (i) a case where expression of a functional parthenocarpic gene which exists is inhibited and (ii) a case where a parthenocarpic gene itself which can be expressed does not have a function or only has an incomplete function. Among these, an example case where the parthenocarpic gene does not have a function can be a case where a mutant parthenocarpic gene whose function is deficient is expressed.

[0054] Further, the case where "a function of a polypeptide encoded by the parthenocarpy regulatory gene is inhibited" encompasses both (i) a case where an expression level of a polypeptide which has an activity and exists is controlled and (ii) a case where a polypeptide itself which is expressed does not have an activity or only has an incomplete function.

[0055] Moreover, in the checking step, it is preferable to select, as a candidate plant whose parthenocarpy is regulated, (i) a plant in which expression of the parthenocarpy regulatory gene is determined to be inhibited or (ii) a plant in which the function of the polypeptide encoded by the parthenocarpy regulatory gene is determined to be inhibited.

[0056] A method for carrying out the checking step is not limited to a particular one and can be, for example, a genetic method, a biochemical method, and the like. Among these, examples of the genetic method encompass measurement of an expression level of a parthenocarpy regulatory gene, analysis of a base sequence of a parthenocarpy regulatory gene, analysis with use of a marker sequence, and the like. Examples of the biochemical method encompass analysis of an amino acid sequence of a polypeptide, measurement of an activity of a polypeptide, quantitative determination of a metabolic reaction product to which a polypeptide relates, and the like. The following descriptions 1) through 6) will discuss details of these methods. Note that, among these methods, the method of 1) or 2) is preferable in view of easiness in working.1) Measurement of expression level of parthenocarpy regulatory gene

[0057] An expression level of the parthenocarpy regulatory gene in a target plant is measured and, if necessary, compared with a standard expression level, and thus whether or not expression of the parthenocarpy regulatory gene is inhibited is checked. The expression level of the gene can be measured by, for example, (i) measuring an amount of a transcript with a method such as quantitative RT-PCR or Northern hybridization or (ii) measuring an amount of a translated product with a method such as quantitative Western blotting. The standard expression level indicates, for example, an expression level of the parthenocarpy regulatory gene in a conspecific plant that does not show parthenocarpy (e.g., an individual having the parthenocarpy regulatory gene as a homozygote). Note that, in a case where transcription or translation of the parthenocarpy regulatory gene is substantially completely inhibited with the use of a method such as gene disruption or RNAi, the comparison with the standard expression level may be unnecessary.

[0058] With regard to the expression level of the parthenocarpy regulatory gene, it is preferable to measure a particular site-specific expression level at a particular developing stage. The particular site can be an ovary or an entire flower bud, and the developing stage can be a stage before anthesis or a stage at anthesis.2) Analysis of base sequence of parthenocarpy regulatory gene

[0059] A base sequence of a parthenocarpy regulatory gene (genomic DNA, mRNA, or cDNA) of a target plant is analyzed. Then, in a case where a mutation(s) that influences a function of the polypeptide encoded by the parthenocarpy regulatory gene is found as a result of the analysis, it is determined that the function of the polypeptide is inhibited. The mutation(s) that influences the function of the polypeptide can be, for example, deletion of several tens to several thousands of base pairs of nucleotides including a coding region of the parthenocarpy regulatory gene, preferably deletion of at least 4000 bp to 5000 bp nucleotides.

[0060] Another example of the mutation(s) that influences the function of the polypeptide can be duplication of several tens to several thousands of base pairs of nucleotides including a coding region of the parthenocarpy regulatory gene, preferably duplication of at least 200 bp to 300 bp of nucleotides.

[0061] Another example of the mutation(s) that influences the function of the polypeptide can be a mutation on the parthenocarpy regulatory gene which mutation causes a socalled nonsense mutation or frame-shift mutation. Such a mutation can be caused by 1 bp or more of mutation in the coding region.

[0062] Moreover, those mutations occur, for example, in one region or in a plurality of regions. In a case where the mutations occur in the plurality of regions, the above described different types of mutations can occur in respective mutation regions. Note that such a mutation(s) may occur in at least one of two parthenocarpy regulatory genes (i.e., a pair of parthenocarpy regulatory genes) in a homologous chromosome, and it is preferable that the mutation(s) occurs in both the two parthenocarpy regulatory genes (i.e., recessive homozygote).3) Analysis using marker sequence

[0063] In a case where a marker sequence that shows a linkage with the mutation(s) on the parthenocarpy regulatory gene is utilized, the base sequence of the parthenocarpy regulatory gene can be directly or indirectly checked. The marker sequence is, for example, located within approximately 20 cM (i.e., approximately 20 cM to 0 cM), preferably located within approximately 10 cM, more preferably located within approximately 1 cM, further preferably located within approximately 0.1 cM, from a location of the parthenocarpy regulatory gene. Note that it is of course possible to use the mutation(s) on the parthenocarpy regulatory gene as a marker sequence.4) Analysis of amino acid sequence of polypeptide

[0064] A polypeptide encoded by the parthenocarpy regulatory gene is isolated from a target plant, and an amino acid sequence of the polypeptide is analyzed. Then, in a case where a mutation(s) (e.g., generation of a truncated body that causes deletion of several tens or more of amino acids), which influences a function of the polypeptide, is found as a result of the analysis, it is determined that the function of the polypeptide is inhibited.5) Measurement of activity of polypeptide

[0065] From a target plant, a polypeptide encoded by the parthenocarpy regulatory gene is isolated. Alternatively, a clone of the parthenocarpy regulatory gene in the target plant is introduced into an expression vector and then the expression vector is introduced into a host cell, and thus a polypeptide is transiently expressed. The host cell expressing the polypeptide is cultured, the polypeptide is extracted and purified from the host cell, and the polypeptide is then used to check presence / absence of an amino group transferase activity that catalyzes tryptophan synthesis in which IPyA and amino acid are used as substrates. In a case where the amino group transferase activity does not exist or is lower than a normal plant, it is determined that the function of the polypeptide is inhibited. In an aspect, presence / absence of an amino group transferase activity that catalyzes tryptophan synthesis in which IPyA and methionine are used as substrates is checked, and in a case where the amino group transferase activity does not exist or is lower than a normal plant, it is determined that the function of the polypeptide is inhibited.

[0066] As an expression vector for expressing the above peptide, the expression vector described in [3. Recombinant expression vector and transformant] is suitably used.

[0067] Moreover, as a host cell, the host cell described in [3. Recombinant expression vector and transformant] is suitably used.

[0068] The methods of synthesis, extraction, and purification of a polypeptide are not limited to particular ones, and known methods can be suitably used. Examples of the method for synthesizing the polypeptide encompass (i) a method in which a polypeptide is transiently expressed in a leaf of tobacco or the like via Agrobacterium and (ii) a method in which a polypeptide is expressed by transforming an expression vector of a polypeptide into E. coli and culturing the E. coli.

[0069] The method for measuring an amino group transferase activity that catalyzes tryptophan synthesis in which IPyA and amino acid are used as substrates can be, for example, a method in which a reaction solution is prepared by incubating a mixture of (i) the polypeptide obtained by the above described method, (ii) an amino acid mixed solution (Arg, Gln, Cys, Asp, Gly, Met, Phe, and Glu), and (iii) IPyA, and then the reaction solution is purified and subjected to LC / MS / MS analysis. In another aspect, a method is employed in which a reaction solution is prepared by incubating a mixture of the polypeptide obtained by the above described method, methionine (e.g., L-Met), and IPyA, and then the reaction solution is purified and subjected to LC / MS / MS analysis. Moreover, it is preferable to carry out checking of 6) below in addition to the analysis of 4) or 5) in order to check, in the parthenocarpy evaluating method disclosed herein, whether or not a function of the polypeptide is inhibited.6) Measurement of amounts of endogenous indole acetic acid (IAA) and an endogenous indole pyruvic acid (IPyA)

[0070] From a target plant, a solution is extracted which contains at least one of endogenous indole acetic acid (IAA) and an endogenous indole pyruvic acid (IPyA), and an amount of at least one of these substances is checked. Then, in a case where the amount of the substances is significantly larger than that of a normal plant as a result of the checking, it is determined that a function of the polypeptide is inhibited. Note that the significantly larger amount of substances is not limited to a particular one, and is preferably an amount (concentration) which is twice or more, more preferably three times or more.

[0071] Moreover, the amount of at least one of the substances is preferably a site-specific amount checked at a particular developing stage. The particular site can be an ovary or an entire flower bud, and the developing stage can be a stage before anthesis or a stage at anthesis. That is, it is more preferable to measure a concentration of IAA or IPyA that is a precursor of IAA in an ovary or a flower bud before anthesis or at anthesis.

[0072] Examples of the method for measuring the amount of the substance encompass measurement with the use of a mass spectrometer, measurement with the use of HPLC, ELISA, and the like. Among these, in view of excellent sensitivity and accuracy, the measuring method with the use of a mass spectrometer is preferable. The mass spectrometer used in the measurement can be LC / MS / MS, GC / MS, or the like.

[0073] A type of a plant to which the evaluating method disclosed herein is applied is not limited to a particular one, and the plant can be a solanaceous plant, a rosaceous plant, a cucurbitaceous plant, or the like, and the solanaceous plant is preferable. Among these, the plant is preferably a solanum plant such as eggplant or tomato or a capsicum plant such as pepper, more preferably any of eggplant, tomato, and pepper, further preferably eggplant or tomato, particularly preferably eggplant. Moreover, examples of a plant to which the evaluating method is applied encompass a breeding material (parental plant, i.e., pollen parent or seed parent) and offspring obtained by breeding. Note that the term "breeding" indicates a concept that encompasses (i) a method utilizing crossing and (ii) a genetic engineering method.

[0074] The phenotypic expression of parthenocarpy sometimes becomes unstable depending on a cultivation condition or a cultivar line and therefore it is often difficult to carry out evaluation based only on appearance of a plant. Moreover, a plant in which the parthenocarpy regulatory gene is heterozygous is worth using as a breeding material or the like but, in particular, when the parthenocarpy regulatory gene is heterozygous, it is sometimes impossible to clearly evaluate only from appearance whether or not the parthenocarpy can be shown. The method for evaluating the parthenocarpy is carried out at a gene level, and therefore trait evaluation can be carried out without making genes homozygous. For example, this makes it possible to significantly improve efficiency in breeding selection. Further, the parthenocarpy regulatory gene has been identified, and it is therefore possible to segregate, with the use of a gene engineering technique or the like, linkage with an unfavorable trait which has naturally cosegregated with the parthenocarpy regulatory gene.[5. Method for producing parthenocarpy-regulated plant, and produced plant]

[0075] A form (hereinafter, referred to as "form 1") of a method disclosed herein for producing a parthenocarpy-regulated plant is a method that includes a step of selecting a parthenocarpy-regulated plant by carrying out the evaluating method described in [4. Method for evaluating parthenocarpy of plant] above.

[0076] Alternatively, another form (hereinafter, referred to as "form 2") of the method disclosed herein for producing a parthenocarpy-regulated plant is a method that includes a step of inhibiting expression of the parthenocarpy regulatory gene in the plant or a step of inhibiting a function of a polypeptide encoded by the parthenocarpy regulatory gene in the plant. Here, the "parthenocarpy regulatory gene" is the one described in [1. Parthenocarpy regulatory gene] above, and the "polypeptide encoded by the parthenocarpy regulatory gene" is the one described in [2. Polypeptide as parthenocarpy regulatory protein] above.

[0077] Note that, in the form 2, it is preferable to inhibit expression of the parthenocarpy regulatory gene by disrupting the parthenocarpy regulatory gene or introducing, to the plant, a polynucleotide that inhibits expression of the parthenocarpy regulatory gene. Note that the wording "inhibit expression of the parthenocarpy regulatory gene" encompasses (i) inhibition of transcription of a gene and (ii) inhibition of translation into protein. The method for inhibiting expression of the parthenocarpy regulatory gene by disrupting the parthenocarpy regulatory gene or introducing, to the plant, a polynucleotide that inhibits expression of the parthenocarpy regulatory gene can be, for example, a genetic engineering method.

[0078] A method for disrupting the parthenocarpy regulatory gene is not limited to a particular one. For example, as the genetic engineering method, it is possible to employ (i) a method in which specific gene disruption is carried out by the use of homologous recombination, (ii) a method in which gene mutation induction is carried out by EMS (ethyl methane sulfonate) treatment, (iii) a method in which a termination codon is introduced to a midway of the parthenocarpy regulatory gene by use of site-directed mutagenesis, or (iv) a method in which a part of a gene is physically disrupted by irradiating the part of the gene with a heavy ion beam or the like.

[0079] Moreover, the method for introducing, to the plant, a polynucleotide that inhibits expression of the parthenocarpy regulatory gene is not limited to a particular one and can be, for example, a method such as RNA interference or antisense RNA. A method for introducing, to the plant, an expression cassette (e.g., vector) containing the polynucleotide is not limited to a particular one, and it is possible to employ, as appropriate, a method using polyethyleneglycol, electroporation, a method via Agrobacterium, or a method using a particle gun. Note that the expression cassette containing the polynucleotide can be introduced to a plant cell, a callus, a plant tissue, or a plant individual.

[0080] Note that expression of the parthenocarpy regulatory gene can be inhibited by introducing a mutation(s), which inhibits gene expression, to an expression adjusting sequence (e.g., a promoter sequence or an enhancer sequence) that regulates expression of the parthenocarpy regulatory gene.

[0081] The present invention also provides a parthenocarpy-regulated plant, which has been produced by the above described production method. The term "parthenocarpy-regulated plant" indicates a concept that encompasses (i) a plant in which the trait of parthenocarpy is shown and (ii) a plant in which the trait of parthenocarpy is not shown but which has a predisposition of the parthenocarpy.

[0082] A type of a plant which is produced by the method disclosed herein is a solanaceous plant. Among these, the plant is preferably a solanum plant such as eggplant or tomato or a capsicum plant such as pepper, more preferably any of eggplant, tomato, and pepper, further preferably eggplant or tomato, particularly preferably eggplant.

[0083] An aspect of the plant produced by the method disclosed herein encompasses a plant which shows parthenocarpy due to the parthenocarpy regulatory gene of the present invention having gene mutation identical with that of a plant (eggplant) specified by an accession number of FERM BP-22257 described in [6. Parthenocarpy-regulated plant] below or a progeny plant thereof.

[0084] Another aspect of the plant produced by the method disclosed herein encompasses a plant (i) in which the parthenocarpy regulatory gene of the present invention has gene mutation and (ii) which therefore shows parthenocarpy identical with that of a plant (eggplant) specified by an accession number of FERM BP-22257 described in [6. Parthenocarpy-regulated plant] below or a progeny plant thereof.[6. Parthenocarpy-regulated plant]

[0085] The present invention provides a novel plant that shows parthenocarpy. The plant of the present invention is defined in the claims.

[0086] The plant is a solanaceous plant or a progeny plant thereof, each of which is a parthenocarpic plant and in each of which (i) expression of a parthenocarpy regulatory gene, which comprises a polynucleotide recited in any of (1) through (4) below, is inhibited or (ii) the function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is decreased or defective, as compared to the respective wild type plant, wherein the function of the polypeptide refers to an activity (amino group transferase activity) for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), and wherein in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause the decrease or defect of the amino group transferase activity, (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having the parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having the parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having the parthenocarpy regulatory activity.

[0087] In the novel parthenocarpic plant of the present invention, as a function of the polypeptide, an activity (amino group transferase activity) for catalyzing a reaction to synthesize tryptophan by transferring an amino group of the amino acids to an indole pyruvic acid (IPyA) is decreased or defective, as compared with a wild type. In another preferable example of the novel parthenocarpic plant of the present invention, as a function of the polypeptide, an activity (amino group transferase activity) for catalyzing a reaction to synthesize tryptophan by transferring an amino group of methionine to an indole pyruvic acid (IPyA) is decreased or defective, as compared with a wild type. That is, a plant is encompassed in which, in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause decrease or a defect of the amino group transferase activity. A more specific example of such a plant is a plant (eggplant) specified by the accession number of FERM BP-22257 or a progeny plant thereof (see also Examples). Note that the plant is deposited at National Institute of Technology and Evaluation (NITE) Patent Microorganisms Depositary (2-5-8 Kazusakamatari, Kisarazu-shi, Chiba, 292-0818) as the accession number of FERM BP-22257 (deposited date: September 11, 2013). A more specific example of the progeny plant can be eggplant that (i) is obtained by single-crossing or double-crossing the eggplant line specified by the accession number of FERM BP-22257 with another eggplant line or with a plant specified by the accession number of FERM BP-22257 and (ii) shows parthenocarpy due to the parthenocarpy regulatory gene of the present invention having gene mutation identical with that of the plant specified by the accession number of FERM BP-22257.

[0088] Another example of the parthenocarpic plant of the present invention can be a plant (i) which has a mutation in a base sequence of the parthenocarpy regulatory gene of the present invention as compared with a wild type, (ii) in which an accumulation amount of mRNA in the parthenocarpy regulatory gene in a non-pollinated ovary at anthesis is controlled, and (iii) which shows parthenocarpy.

[0089] Still another example of the parthenocarpic plant of the present invention can be a plant (i) which has a mutation in an amino acid sequence of the polypeptide encoded by the parthenocarpy regulatory gene of the present invention as compared with a wild type, (ii) in which, as a function of the polypeptide, an amino group transferase activity in a non-pollinated ovary at anthesis is decreased or defective, and (iii) which shows parthenocarpy. Moreover, still further specific example of the parthenocarpic plant of the present invention can be a parthenocarpic plant (i) in which the amino group transferase activity as a function of the polypeptide encoded by the parthenocarpy regulatory gene of the present invention in the non-pollinated ovary at anthesis is an activity for catalyzing a reaction to synthesize tryptophan by transferring an amino group of methionine to an indole pyruvic acid (IPyA), (ii) which has a mutation in an amino acid sequence of the polypeptide as compared with a wild type, and (iii) in which the activity for catalyzing a reaction to synthesize tryptophan by transferring an amino group of methionine to an indole pyruvic acid (IPyA) is decreased or defective.

[0090] Moreover, yet another example of the parthenocarpic plant of the present invention can be a plant (i) which has a mutation in a base sequence of the parthenocarpy regulatory gene of the present invention as compared with a wild type, (ii) in which an endogenic amount of auxin (or IAA or IPyA) in a non-pollinated ovary at anthesis is increased, and (iii) which shows parthenocarpy.

[0091] Another example of the parthenocarpic plant of the present invention encompasses a plant in which the trait of parthenocarpy is shown, among parthenocarpy-regulated plants produced by the production method described in [5. Method for producing parthenocarpy-regulated plant, and produced plant] above. A type of the parthenocarpic plant of the present invention is a solanaceous plant,. Among these, the parthenocarpic plant is preferably a solanum plant such as eggplant or tomato or a capsicum plant such as pepper, more preferably any of eggplant, tomato, and pepper, further preferably eggplant or tomato, particularly preferably eggplant. Moreover, the parthenocarpic plant of the present invention encompasses a progeny plant of the novel parthenocarpic plant. Note that the plant is a concept which encompasses a plant body itself, a part of the plant body, a seed, and the like. Further, the parthenocarpic plant of the present invention encompasses a plant that produces, from a flower which has not been pollinated, a fruit having a fruit weight that is equivalent to that of a fruit which is normally produced from a flower that has been normally pollinated under the same cultivation condition.[7. Illustrative Examples of specific aspects disclosed herein]

[0092] The present disclosure discloses any of the following <1> through <19>: <1> A method for evaluating parthenocarpy of a plant, the method including the step of: checking whether or not expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (1) through (4) below, is inhibited in the plant; or checking whether or not a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited in the plant. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <2> The method described in <1> in which, in the step of checking, (i) a sequence of the polypeptide having the parthenocarpy regulatory activity, (ii) a base sequence of the parthenocarpy regulatory gene, (iii) an expression level of the parthenocarpy regulatory gene, or (iv) an amount of a transcript of the parthenocarpy regulatory gene is checked. <3> The method described in <1> or <2> in which, in the step of checking, a plant in which the expression of the parthenocarpy regulatory gene is inhibited or a plant in which the function of the polypeptide encoded by the parthenocarpy regulatory gene is inhibited is selected as a parthenocarpic plant. <4> A method for producing a parthenocarpy-regulated plant, the method including the step of selecting a parthenocarpic plant by carrying out the evaluating method recited in any one of <1> through <3>. <5> A method for producing a parthenocarpy-regulated plant, the method including the step of: inhibiting, in a plant, expression of a parthenocarpy regulatory gene that includes a polynucleotide recited in any of (1) through (4) below; or inhibiting, in a plant, a function of a polypeptide encoded by the parthenocarpy regulatory gene. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <6> The method described in <5> in which, in the step, (i) a polynucleotide, which inhibits the expression of the parthenocarpy regulatory gene, is introduced into the plant or (ii) the parthenocarpy regulatory gene is disrupted. <7> The method described in any one of <1> through <6>, in which the plant is a solanaceous plant. <8> The method described in <7>, in which the plant is eggplant. <9> A parthenocarpy-regulated plant produced by the production method described in any one of <5> through <8>. <10> A parthenocarpy regulatory gene that includes a polynucleotide recited in any of (1) through (4) below. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <11> A polypeptide recited in any of (1) through (4) below. (1) A polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polypeptide that (i) is encoded by a polynucleotide which is hybridized, under a stringent condition, with a polynucleotide that has a sequence complementary to a polynucleotide for encoding the polypeptide recited in the above (1) and (ii) has a parthenocarpy regulatory activity. <12> A plant which is a parthenocarpic plant and in which (i) expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (1) through (4) below, is inhibited or (ii) a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited. (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having a parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <13> The plant described in <12>, in which an activity (amino group transferase activity), which is the function of the polypeptide, for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA) is decreased or defective. <14> The plant described in <13>, in which, in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause decrease or a defect of the amino group transferase activity. <15> The plant described in <13> or <14>, in which, in the reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), at least one amino acid whose amino group is to be transferred is methionine. <16> A plant described in any one of <12> through <15> and a progeny plant thereof, each of the plant and the progeny plant being a solanaceous plant. <17> The plant and the progeny plant thereof described in <16>, in which the solanaceous plant is eggplant, tomato, or pepper. <18> The plant described in <17>, in which the plant is a plant specified by an accession number of FERM BP-22257 or is a progeny plant thereof. <19> The plant described in any one of <12> through <18>, in which the plant is a plant body, a part of the plant body, or a seed of the plant body. [8. Other illustrative Examples disclosed herein]

[0093] The present disclosure discloses any of the following aspects: <t1> A method for evaluating parthenocarpy of a plant, the method including the step of: checking whether or not expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (t1) through (t4) below, is inhibited in the plant; or checking whether or not a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited in the plant. (t1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 28, (t2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, (t3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, and (t4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (t1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <t2> The method described in <t1> in which, in the step of checking, (i) a sequence of the polypeptide having the parthenocarpy regulatory activity, (ii) a base sequence of the parthenocarpy regulatory gene, (iii) an expression level of the parthenocarpy regulatory gene, or (iv) an amount of a transcript of the parthenocarpy regulatory gene is checked. <t3> The method described in <t1> or <t2> in which, in the step of checking, a plant in which the expression of the parthenocarpy regulatory gene is inhibited or a plant in which the function of the polypeptide encoded by the parthenocarpy regulatory gene is inhibited is selected as a parthenocarpic plant. <t4> A method for producing a parthenocarpy-regulated plant, the method including the step of selecting a parthenocarpic plant by carrying out the evaluating method recited in any one of <t1> through <t3>. <t5> A method for producing a parthenocarpy-regulated plant, the method including the step of: inhibiting, in a plant, expression of a parthenocarpy regulatory gene that includes a polynucleotide recited in any of (t1) through (t4) below; or inhibiting, in a plant, a function of a polypeptide encoded by the parthenocarpy regulatory gene. (t1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 28, (t2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, (t3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, and (t4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (t1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <t6> The method described in <t7> in which, in the step, (i) a polynucleotide, which inhibits the expression of the parthenocarpy regulatory gene, is introduced into the plant or (ii) the parthenocarpy regulatory gene is disrupted. <t7> The method described in any one of <t1> through <t8>, in which the plant is a solanaceous plant. <t8> The method described in <t9>, in which the plant is eggplant. <t9> A parthenocarpy-regulated plant produced by the production method described in any one of <t5> through <t8>. <t10> A parthenocarpy regulatory gene that includes a polynucleotide recited in any of (t1) through (t4) below. (t1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 28, (t2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, (t3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, and (t4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (t1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <t11> A polypeptide recited in any of (t1) through (t4) below. (t1) A polypeptide having an amino acid sequence represented by SEQ ID NO: 28, (t2) a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, (t3) a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, and (t4) a polypeptide that (i) is encoded by a polynucleotide which is hybridized, under a stringent condition, with a polynucleotide that has a sequence complementary to a polynucleotide for encoding the polypeptide recited in the above (t1) and (ii) has a parthenocarpy regulatory activity. <t12> A plant which is a parthenocarpic plant and in which (i) expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (t1) through (t4) below, is inhibited or (ii) a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited. (t1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 28, (t2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, (t3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 28 and (ii) having a parthenocarpy regulatory activity, and (t4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (t1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <t13> The plant described in <12>, in which an activity (amino group transferase activity), which is the function of the polypeptide, for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA) is decreased or defective. <t14> The plant described in <t13>, in which, in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause decrease or a defect of the amino group transferase activity. <t15> The plant described in <t13> or <t14>, in which, in the reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), at least one amino acid whose amino group is to be transferred is methionine. <t16> A plant described in any one of <t12> through <t15> and a progeny plant thereof, each of the plant and the progeny plant being a solanaceous plant. <t17> The plant and the progeny plant thereof described in <t16>, in which the solanaceous plant is eggplant, tomato, or pepper. <t18> The plant described in <t17>, in which the plant is a plant specified by an accession number of FERM BP-22257 or is a progeny plant thereof. <t19> The plant described in any one of <t12> through <t18>, in which the plant is a plant body, a part of the plant body, or a seed of the plant body.

[0094] The present disclosure discloses any of the following illustrative examples: <p1> A method for evaluating parthenocarpy of a plant, the method including the step of: checking whether or not expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (p1) through (p4) below, is inhibited in the plant; or checking whether or not a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited in the plant. (p1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 34, (p2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, (p3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, and (p4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (p1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <p2> The method described in <p1> in which, in the step of checking, (i) a sequence of the polypeptide having the parthenocarpy regulatory activity, (ii) a base sequence of the parthenocarpy regulatory gene, (iii) an expression level of the parthenocarpy regulatory gene, or (iv) an amount of a transcript of the parthenocarpy regulatory gene is checked. <p3> The method described in <p1> or <p2> in which, in the step of checking, a plant in which the expression of the parthenocarpy regulatory gene is inhibited or a plant in which the function of the polypeptide encoded by the parthenocarpy regulatory gene is inhibited is selected as a parthenocarpic plant. <p4> A method for producing a parthenocarpy-regulated plant, the method including the step of selecting a parthenocarpic plant by carrying out the evaluating method recited in any one of <p1> through <p3>. <p5> A method for producing a parthenocarpy-regulated plant, the method including the step of: inhibiting, in a plant, expression of a parthenocarpy regulatory gene that includes a polynucleotide recited in any of (p1) through (p4) below; or inhibiting, in a plant, a function of a polypeptide encoded by the parthenocarpy regulatory gene. (p1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 34, (p2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, (p3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, and (p4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (p1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <p6> The method described in <p7> in which, in the step, (i) a polynucleotide, which inhibits the expression of the parthenocarpy regulatory gene, is introduced into the plant or (ii) the parthenocarpy regulatory gene is disrupted. <p7> The method described in any one of <p1> through <p8>, in which the plant is a solanaceous plant. <p8> The method described in <p9>, in which the plant is eggplant. <p9> A parthenocarpy-regulated plant produced by the production method described in any one of <p5> through <p8>. <p10> A parthenocarpy regulatory gene that includes a polynucleotide recited in any of (p1) through (p4) below. (p1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 34, (p2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, (p3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, and (p4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (p1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <p11> A polypeptide recited in any of (p1) through (p4) below. (p1) A polypeptide having an amino acid sequence represented by SEQ ID NO: 34, (p2) a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, (p3) a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, and (p4) a polypeptide that (i) is encoded by a polynucleotide which is hybridized, under a stringent condition, with a polynucleotide that has a sequence complementary to a polynucleotide for encoding the polypeptide recited in the above (p1) and (ii) has a parthenocarpy regulatory activity. <p12> A plant which is a parthenocarpic plant and in which (i) expression of a parthenocarpy regulatory gene, which includes a polynucleotide recited in any of (p1) through (p4) below, is inhibited or (ii) a function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is inhibited. (p1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 34, (p2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, (p3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 34 and (ii) having a parthenocarpy regulatory activity, and (p4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (p1), under a stringent condition and (ii) encodes a polypeptide having a parthenocarpy regulatory activity. <p13> The plant described in <12>, in which an activity (amino group transferase activity), which is the function of the polypeptide, for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA) is decreased or defective. <p14> The plant described in <p13>, in which, in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause decrease or a defect of the amino group transferase activity. <p15> The plant described in <p13> or <p14>, in which, in the reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), at least one amino acid whose amino group is to be transferred is methionine. <p16> A plant described in any one of <p12> through <p15> and a progeny plant thereof, each of the plant and the progeny plant being a solanaceous plant. <p17> The plant and the progeny plant thereof described in <p16>, in which the solanaceous plant is eggplant, tomato, or pepper. <p18> The plant described in <p17>, in which the plant is a plant specified by an accession number of FERM BP-22257 or is a progeny plant thereof. <p19> The plant described in any one of <p12> through <p18>, in which the plant is a plant body, a part of the plant body, or a seed of the plant body. [Examples of the invention][Example 1: Eggplant-derived parthenocarpy gene A](1. Identification and analysis of eggplant-derived parthenocarpy responsible gene A)<Discovery of parthenocarpic eggplant line "PCSS">

[0095] The following description will be given with reference to Fig. 1. Fig. 1 is a view illustrating parthenocarpy of a parthenocarpic eggplant line "PCSS" in accordance with Example 1 of the present invention. (a) of Fig. 1 illustrates a fruit of eggplant, in a parthenocarpic eggplant line "PCSS," whose stigma was cut off in a bud stage before anthesis so that pollination was prevented. (b) of Fig. 1 illustrates (i) a fruit (left) of eggplant in the parthenocarpic eggplant line "PCSS" and (ii) a fruit (right) of eggplant "Senryo-nigo," which is of a common non-parthenocarpic cultivar. Each stigma of the eggplant in the parthenocarpic eggplant line "PCSS" and the eggplant "Senryo-nigo" was cut off in a bud stage before anthesis so that pollination was prevented.

[0096] The line PCSS is a selfed fixed line of parthenocarpic eggplant (Solanum melongena). This line was found in the process of breed improvement carried out with the use of crossbreed progeny between breeding mother plant lines "line 1" and "line 2" of eggplant which was bred uniquely by the inventors.

[0097] In a case where the stigma was cut off in the bud stage before the anthesis so that the pollination was prevented, the fruit of the eggplant "Senryo-nigo," which is of a common non-parthenocarpic cultivar, was hardly enlarged (see (b) of Fig. 1), whereas the fruit of the eggplant in the line PCSS was normally enlarged ((a) and (b) of Fig. 1).

[0098] A subsequent analysis clarified the following: (1) neither of the "line 1" nor the "line 2," each of which was used as a parent line for breeding, had parthenocarpy; (2) out of a great number of selfed sib lines obtained from crossbreed progeny between those two lines, no line had parthenocarpy, except for the line PCSS; (3) among selfed progeny of the line PCSS, all individuals had parthenocarpy; and (4) among crossbreed progeny between the line PCSS and a non-parthenocarpic line, individuals having parthenocarpy similar to that of the line PCSS appeared at a given frequency.

[0099] In view of the above results, it was concluded that the parthenocarpy of the line PCSS was attributed to a novel genetic mutation caused by a natural mutation in the process of cross breeding. As such, the line PCSS was registered with the accession number "FERM BP-22257" as a parthenocarpic eggplant line.<Detailed mapping of parthenocarpy>

[0100] The first filial generation obtained by crossbreeding the parthenocarpic eggplant line PCSS with a non-parthenocarpic eggplant line TN-43 (bred by TAKII & CO., LTD.) was selfed so as to obtain the second filial generation (F2). 93 individuals in this F2 generation were cultivated, and evaluated in terms of parthenocarpy. As a result, out of the 93 individuals, 23 individuals had parthenocarpy, whereas 70 individuals had non-parthenocarpy. As such, a segregation ratio was approximately 1:3. This suggested that the parthenocarpy of the line PCSS was under the control of a single recessive gene. Genomic DNA was extracted from those F2 individuals, and marker genotypes of the genomic DNA were determined with the use of 64 DNA markers distributed over an entire eggplant genome (Reference Literature: Fukuoka et al. (2012) Theor. Appl. Genet. 125: 47-56). A chromosomal location, on a marker linkage map, of a gene responsible for the parthenocarpy was calculated with the use of Mapmaker / EXP (Reference Literature: Lander et al., 1987, Genomics 1: 174-181) in accordance with information on the marker genotypes, and the chromosomal location of the gene was deduced. Fig. 2 illustrates a linkage map of a region in which a parthenocarpy responsible gene A was deduced to be located. As illustrated in Fig. 2, it was deduced that the gene was located in a region of approximately 20 cM, sandwiched between two DNA markers SOL7214 and eme07D02, of the third chromosome.

[0101] Further, by direct comparison between the marker genotypes and phenotypes, determination of the region in which the gene was located was attempted. A result of the determination is illustrated in Fig. 3. Fig. 3 is a view illustrating correspondence between phenotypes and marker genotypes of each generation after crossbreeding of the parthenocarpic eggplant line PCSS with the non-parthenocarpic eggplant line TN-43. (a) of Fig. 3 is a view illustrating correspondence between phenotypes and marker genotypes of a F2 generation.

[0102] As illustrated in (a) of Fig. 3, an individual 24 and an individual 44 did not have parthenocarpy and an individual 30 and an individual 45 had parthenocarpy. This revealed that the gene was located in a region sandwiched between est_smfl28j21 and eme07D02. Note here that it is reported that, in a vicinity of this region which is present in the third linkage group of eggplant, order of arrangement of genes is highly-conserved, as compared with a tomato chromosome (synteny) (Reference Literatures: Wu et al. (2009) Theor. Appl. Genet. 118: 927-935, Fukuoka et al. (2012) Theor. Appl. Genet. 125: 47-56). In view of this, new DNA markers were developed with the use of a tomato genomic sequence so as to narrow down the chromosomal location of the gene. Out of two DNA markers which defined respective ends of the region in which the gene was deduced to be located, est_smfl28j21 was developed based on an eggplant expressed sequence SmFL28J21 (Reference Literature: Fukuoka et al. (2010) Gene 450: 76-84), and was found, by BLASTN search with respect to a tomato complete genomic sequence (SL2.40ch, Reference Literature: The Tomato Genome Consortium (2012) Nature 485: 635-641), to have an extremely high sequence identity with a predicted gene Solyc03g118430.2.1 that was present in a region from nucleotide number 61358472 to nucleotide number 61373773 of a tomato third chromosome. On the other hand, eme07D02 is a genomic SSR marker that uses repeat sequences scattered on an eggplant genome. Since it had been difficult to correctly predict correspondence between eme07D02 and the tomato genomic sequence, development of a marker was advanced in accordance with a sequence of SOL8369 located outside eme07D02 (i.e., opposite to est_smfl28j21). The eggplant expressed sequence SmFL14B23, derived from SOL8369, had an extremely high sequence identity with a predicted gene Solyc03g123840.2.1 predicted in a region from nucleotide number 64597421 to nucleotide number 64602015 of the tomato third chromosome. That is, it was deduced that the region in which the gene responsible for the parthenocarpy of the line PCSS was located corresponded, according to the tomato genome, to a region of approximately 3.24 Mb from nucleotide number 61358472 to nucleotide number 64602015 of the third chromosome in the tomato genome. Furthermore, with the use of uniquely deciphered eggplant EST sequences (43,250 sequences in total) as query sequences, BLAST search was carried out with respect to the tomato genomic sequence so as to check a sequence identity. As a result, 427 eggplant ESTs were found which corresponded to the predicted gene present in the region of 3.24 Mb on the tomato genome. In view of this, a PCR primer was designed in accordance with the 427 eggplant EST sequences, then genomic DNA of each of the line PCSS and the line TN-43 were amplified, and polymorphism of the genomic DNA was checked. It was thus possible to arrange nine SNP markers and one SSR marker between est_smfl28j21 and SOL8369. With the use of those markers, phenotypes (i.e., presence / absence of parthenocarpy) and marker genotypes of each individual in a F3 generation and subsequent generations were compared. First, in regard to a region sandwiched between est_smfl28j21 and SOL8369, F2 individuals which had a PCSS-derived region so as to become heterozygous and a TN-43-derived region were selfed, and an individual having recombination between the two regions was selected among progeny of the F2 individuals with the use of DNA markers. The individual was then further selfed so as to breed a recombinant homozygous line. The recombinant homozygous line was studied in terms of the presence / absence of parthenocarpy, and development of new SNP markers were repeated so as to identify a recombinant part. Results are illustrated in (b) of Fig. 3. (b) of Fig. 3 is a view illustrating correspondence between the phenotypes and the marker genotypes of the F3 generation and the subsequent generations. As illustrated in (b) of Fig. 3, a possible genomic region in which the gene responsible for the parthenocarpy was present could be narrowed down over generations, that is, the possible genomic region was narrowed down to a region sandwiched between ec3110A and ec3077F in the F3 generation, to a region sandwiched between SSR03 and ec3087X in a F5 generation which region was located on an inner side of the region sandwiched between ec3110A and ec3077F, and to a region sandwiched between SSR03 and PaSeq128 in a F8 generation which region was located on an inner side of the region sandwiched between SSR03 and ec3087X.(2. Isolation of parthenocarpy responsible gene A)<Isolation and sequence determination of full-length cDNA of gene A>

[0103] By screening of a BAC library of eggplant (line AE-P03, bred by incorporated administrative agency National Agriculture and Food Research Organization) with use of a PCR primer which amplifies PaSeq123, a BAC clone 08K19 including such a region was isolated. A shotgun library of this clone was created, and a base sequence was determined in regard to a full length of insert. As a result, it was revealed that, according to the line AE-P03, a physical distance between SSR03 and PaSeq128 was 31,484 bp. In a case where base sequences of both of the line PCSS and the line TN-43 in the region were determined, it was revealed that the line PCSS had a characteristic structure mutation which was not found in the line TN-43 and the line AE-P03. In a case where a structure of the structure mutation was analyzed in more detail, it was revealed that the line PCSS had deletion of 4558 bp and duplication of 227 bp in a region between SSR03 and PaSeq123.

[0104] With respect to the region sandwiched between SSR03 and PaSeq128, a structural gene was predicted by a gene prediction program GenScan (Reference Literature: Burge, C. and Karlin, S. (1997) J. Mol. Biol. 268: 78-94) with use of a wild type (AE-P03) sequence. As a result, presence of four structural genes was suggested. It was deduced that one (gene A) of the four structural genes was present in a part in which the structure mutation, specific to the line PCSS, occurred and that, according to the line PCSS, a gene region including a protein-encoding region was partially deleted due to deletion of the 4558 bp.

[0105] In view of this, full-length cDNA of the gene A was cloned by the RACE method so as to confirm that the gene predicted by the gene prediction program was actually present. Cloning was carried out the with use of (i) PCR primers designed in accordance with a base sequence of such a predicted gene and (ii) as a material, total RNA extracted from a bud of non-parthenocarpic eggplant "Nakateshinkuro," which is of standard cultivar.

[0106] First, total RNA was extracted, by the Trizol method, from an ovary taken out of a bud of eggplant "Nakateshinkuro" approximately 3 days before anthesis, and cDNA was synthesized with use of the SMARTer RACE cDNA amplification kit (Takara Bio Inc.). With use of (i) the cDNA as a template and (ii) polynucleotides represented by SEQ ID NO: 39 and SEQ ID NO: 40 as gene-specific primers, amplification of cDNA including a transcription start site and a translation start site of mRNA was attempted by the Nested-5'-RACE method. Resultant amplified products were cloned into an E. coli expression vector, and sequences of amplified products in clones were determined by the Sanger's method. For the purpose of eliminating an effect of a sequence mutation that is caused at a low frequency by PCR, such base sequences of the clones were independently determined. As a result, a sequence of 394 bp at a 5'-end of full-length cDNA was obtained. Similarly, amplification of cDNA including a translation end site and a polyadenylation site was attempted by a Nested-3'-RACE method with use of polynucleotides represented by SEQ ID NO: 41 and SEQ ID NO: 42 as gene-specific primers. Then, (i) cloning of the amplified product into an E. coli vector and (ii) determination of sequences were attempted. As a result, a sequence of 1247 bp at a 3' end of full-length cDNA was obtained. Thereafter, a sequence of 1625 bp which sequence was represented by SEQ ID NO: 2 was obtained by combining the sequence at the 5'-end with the sequence at the 3' end in accordance with overlap of those two sequences. The sequence thus obtained was determined as a full-length cDNA sequence of the parthenocarpy responsible gene A.<Analysis of expression level of gene A at each site of plant body in each developing stage>

[0107] Based on this result, DNA fragments each including the whole of protein codes of the gene A was cloned by PCR with use of the polynucleotides represented by SEQ ID NO: 43 and 44 as primers. As a template of the PCR, cDNA was used which was synthesized from total RNA of eggplant "Nakateshinkuro" with use of the Transcriptor First Strand cDNA Synthesis kit (Roche Diagnostics K.K.). Amplified fragments thus obtained were digested by enzymes Xmal and Sacl, and inserted into an Xmal-Sacl site of a cloning vector pUC19 (Takara Bio Inc.). In regard to clones thus obtained, base sequences of such inserted fragments were determined, and a clone was selected which did not have a mutation as compared with a full-length cDNA sequence represented by SEQ ID NO: 2. A sequence of the clone is represented by SEQ ID NO: 3.

[0108] Further, RNA was extracted from ovaries, taken out of buds before anthesis (buds at respective 6 stages, i.e., buds having respective lengths of 4 mm, 8 mm, 10 mm, and 14 mm and buds being 5 days and 2 days before anthesis) and of flowers at anthesis, and developing unripe fruits (at 3 stages of 3 days, 7 days, and 14 days after anthesis) of eggplant "Nakateshinkuro." With use of such RNA as a template, cDNA was synthesized with use of the Superscript VILO cDNA synthesis kit (Life Technologies Corporation). With use of this cDNA as a template, an mRNA accumulation amount of the gene A was measured by quantitative PCR with use of oligonucleotides represented by SEQ ID NO: 45 and SEQ ID NO: 46 as primers. Eggplant constitutive expression gene 20F01A, which was found uniquely by the inventors, was used as an internal standard gene for standardizing a quantitative value. An experiment was carried out with the use of primer pairs represented by SEQ ID NO: 47 and SEQ ID NO: 48 as primers for amplifying the internal standard gene. Furthermore, mRNA accumulation amounts were similarly measured in regard to an aboveground part and a root of a germ (28 days after seeding), a matured leaf and a stem of a plant body 3 months after the seeding, and anthers and petals of a bud (having a bud length of 14 mm) before anthesis and a flower at anthesis of eggplant cultivar "Nakateshinkuro." Results of such quantitative determination are illustrated in Fig. 4. Fig. 4 illustrates mRNA accumulation amounts of the gene A of sites of "Nakateshinkuro" at different developing stages. As is clear from Fig. 4, it was clarified that expression of the gene A was increased in the ovaries as the buds developed, then was at the highest level at anthesis, and was decreased as the fruits developed. As a result, it was confirmed that the gene A was a gene which was expressed in expression patterns specific to development stages of a flower of general non-parthenocarpic eggplant.<Detailed analysis of structure of gene A and mutation of line PCSS>

[0109] It was clarified by comparison between full-length cDNA and a genomic DNA sequence that the gene A was made up of nine exons and eight introns and had 6528 bp between a transcription start site and a transcription end site. This sequence is represented by SEQ ID NO: 4. Further, sequences from the first to ninth exons of the gene A are represented by SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, respectively. Moreover, sequences from the first to eighth introns are represented by SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, and SEQ ID NO: 20, respectively. In addition, 2000 bases upstream of the transcription start site and 1000 bases downstream of the transcription end site are represented by SEQ ID NO: 22 and SEQ ID NO: 23, respectively. Those sequences are integrated, and resultant sequence of 9528 bases from the 2000 bases upstream of the transcription start site of the gene A to the 1000 bases downstream of the transcription end site of the gene A are represented by SEQ ID NO: 24 as a gene A region. The number of the first base of the sequence is "1" and the number of the last base of the sequence is "9528."

[0110] In a case where correspondence between (i) the gene A and (ii) a deletion region and a duplication region of the line PCSS was checked, a region (a sequence represented by SEQ ID NO: 25) corresponding to bases from nucleotide number 3963 of SEQ ID NO: 24 to nucleotide number 8520 of SEQ ID NO: 24 was deleted in such a mutant type gene A region of the line PCSS. This region is a region of 4,558 base pairs including (i) all bases from the 45th base in the fourth intron to the translation end site in the ninth exon and (ii) a subsequent untranslated region of 235 bases on a 3' end side. Moreover, it was clarified that a sequence (SEQ ID NO: 26) of 227 base pairs corresponding to bases from nucleotide number 8599 of SEQ ID NO: 24 to nucleotide number 8825 of SEQ ID NO: 24 was duplicated and inserted instead of the region of 4,558 base pairs which region was deleted.

[0111] Moreover, a region of a wild type gene which region ranged from a start site of the fourth exon to 1000 base pairs downstream of a transcription end site, that is, a sequence of 5670 bases from nucleotide number 3859 to nucleotide number 9528 of SEQ ID NO: 24 became, in the line PCSS, a sequence having a structure represented by SEQ ID NO: 27 and having a length of 1339 bases. Based on results of the foregoing analysis, a schematic diagram illustrating a structure of the gene A and a mutation structure of the gene A of the PSCC was created as illustrated in Fig. 5.

[0112] As is clear from Fig. 5, it was clarified that the gene A of the line PCSS had a great structure mutation as compared with the wild type gene. Therefore, it was strongly suggested that normal mRNA and a normal protein were not produced and accordingly a function of the gene A was completely lost. In view of this, assuming that this deletion mutation was attributed to parthenocarpy, the following experiments were carried out.<Search of gene A deletion mutation in eggplant germplasm line>

[0113] PCR was carried out with the use of (i) as a template, total DNA roughly extracted from a plant by the Edwards method (Reference Literature: Edwards et al. (1991) Nucl. Acids Res. 19: 1349), which is a DNA extraction method well-known in this technical field and (ii) four primers represented by SEQ ID NOs: 49 through 52. According to a deletion type, a clear band of approximately 1 kbp was amplified. According to a wild type, a clear band of approximately 700 bp was amplified. Presence and absence of this deletion and a heterozygote could be each clearly determined. With use of this primer set, 269 items in eggplant germplasm lines collected from all over the world (out of 269 items, 48 items were allied wild species or unidentified) were checked in terms of the presence and absence of the deletion. As a result, a line having such deletion was not found at all. In view of this, it was concluded that the deletion mutation was a natural mutation which newly occurred in the foregoing breeding process.<Analysis of deduced amino acid sequence of gene A product and search for homologous sequence>

[0114] A deduced amino acid sequence of a protein (hereinafter, referred to as a protein A) encoded by the gene A is represented by SEQ ID NO: 1. In a case where this amino acid sequence was analyzed by carrying out BLAST search (http: / / blast.ncbi.nlm.nih.gov) through a RefSeq database, it was clarified that the amino acid sequence had a given level of sequence identity with an amino acid sequence of a pyridoxal-5'-phosphoric acid (PLP)-dependent amino group transferase (including a deduced sequence by genome decipherment study) which has been reported in various species. In view of this, genes each of which was expected, by sequence identity search, to encode a protein having a high sequence identity with the protein A were obtained from gene databases of (i) tomato, (ii) S. pimpinellifolium, which is a tomato allied species, (iii) S. tuberosum phureja, which is potato, (iv) Capsicum annuum, which is pepper, and (v) Malus x domestica, which is apple.

[0115] Sequences having the highest sequence identity with the gene A were as follows. That is, in a case of tomato, Solyc03g120450.1.1 (data set name: ITAG2.30, http: / / solgenomics.net) had the highest sequence identity with the gene A. In a case of tomato allied species S. pimpinellifolium, a homologous part (data set name: S. pimpinellifolium WGS Contigs, web site: http: / / solgenomics.net) had the highest sequence identity with the gene A. In a case of potato, Sotub03g036610.1.1 (data set name: Potato ITAG Release 1, web site: http: / / solgenomics.net) had the highest sequence identity with the gene A. In a case of pepper, TC19330 (data set name: DFCI Pepper Gene Index ver. 4.0, reference literature: Quackenbuch et al., 2001, Nucl. Acid. Res. 29: 159-164, web site: http: / / compbio.dfci.harvard.edu / tgi / plant.html) had the highest sequence identity with the gene A. In a case of apple, MDP0000310976 (data set name: Malus x domestica Genome v1.0, reference literature: Velasco et al., 2010, Nature Genetics 42: 833-839, web site: http: / / www.rosaceae.org) had the highest sequence identity with the gene A. A base sequence of a coding region of a tomato-derived gene is represented by SEQ ID NO: 29, and a deduced amino acid sequence of the tomato-derived gene is represented by SEQ ID NO: 28. A base sequence of a coding region of a tomato allied species S. pimpinellifolium-derived gene is represented by SEQ ID NO: 31, and a deduced amino acid sequence of the tomato allied species S. pimpinellifolium-derived gene is represented by SEQ ID NO: 30. A base sequence of a coding region of a potato-derived gene is represented by SEQ ID NO: 33, and a deduced amino acid sequence of the potato-derived gene is represented by SEQ ID NO: 32. A base sequence of a coding region of pepper-derived gene is represented by SEQ ID NO: 35, and a deduced amino acid sequence of the pepper-derived gene is represented by SEQ ID NO: 34. A base sequence of a coding region of an apple-derived gene is represented by SEQ ID NO: 37, and a deduced amino acid sequence of the apple-derived gene is represented by SEQ ID NO: 36.

[0116] The sequence identity of each of the deduced amino acid sequences with the protein A of eggplant was as follows. That is, in the case of the tomato-derived gene, the deduced amino acid sequence had 94.9% sequence identity with the protein A. In the case of the tomato allied species S. pimpinellifolium-derived gene, the deduced amino acid sequence had 94.9% sequence identity with the protein A. In the case of the potato-derived gene, the deduced amino acid sequence had 95.7% sequence identity with the protein A. In the case of the pepper-derived gene, the deduced amino acid sequence had 90.1% sequence identity with the protein A. In the case of the apple-derived gene, the deduced amino acid sequence had 80.5% sequence identity with the protein A. According to Arabidopsis, no deduced amino acid sequence had 70% or more sequence identity with the protein A.<Analysis of structure of gene A transcript in PCSS>

[0117] A structure of a transcript of the mutant type gene A was analyzed by the Nested-5'-RACE method and the Nested-3'-RACE method with the use of (i) total RNA extracted from an ovary of the line PCSS and (ii) primers represented by SEQ ID NO: 39 through SEQ ID NO: 42 as with the case of the foregoing methods. As a result, the followings are clarified. That is, a splicing site between the fourth exon and the fourth intron was normal, but an end site of the fourth intron was downstream of a transcription end site of a normal type gene. Accordingly, a PCSS-type transcript was completely different from the normal type gene product in terms of sequences at and subsequent to the fourth exon on a 3' end side. Furthermore, the PCSS-type transcript had a large number of translation termination codons whose reading frames had not been changed. A deduced amino acid sequence of a protein translated from the PCSS-type transcript is represented by SEQ ID NO: 38. (Note that the entire sequence of the amino acid sequence represented by SEQ ID NO: 38 is MGSFGMLARRAVLTDTPVMVQIQELIRGNKDCISLAQGVVYWQPPAQALEKVKEIIWE PSVSRYGADEGLPELREALMQKLGHENNLHKSSVMVTAGANQVNEGVQLKVNCLGN YMPLHTYYEERKFSNLSFN*AYGSNYKISSYCP*KIHGCMHCTTAKAAGSETRSADRF QHGNPQGEEQESSTYFLCGEEMPASA*GCHKSMLQHFKWRLP*RYQSPKEEEDHSS WKQLNKCV*SDHFSRL*SVSISSQVTTKE*P*SQLLRQEVP*TTRKDKRNQRFSKKRHS *ESYL*CGTININKVGRHRH*F*SKGSTTMQSICL*YI*EFTGCGAN*KAAIKFHGNAPARY HTKYAGNPCRLDCGGKLVFIPN. The sign "*" in the sequence indicates a translation termination signal given by a termination codon.) This results strongly suggested that, according to the line PCSS, (i) the transcript of the gene A was greatly different in structure from that of the normal type gene, (ii) a mutant type protein A translated from the transcript of the gene A structurally had a great deficit as compared with a normal type protein, and (iii) a function of the protein A was therefore completely lost.<Isolation of promotor of gene A>

[0118] It was possible to obtain a sequence of an upstream region of the full-length cDNA sequence of the gene A from a sequence of the BAC clone 08K19. It was deduced that a genomic sequence of the upstream region was a promotor region related to control of expression of the gene A. In view of this, PCR primers (SEQ ID NO: 53 and SEQ ID NO: 54) which amplify the promotor region were synthesized, PCR was carried out with use of (i) the PCR primers and (ii) as a template, genomic DNA of eggplant cultivar "Nakateshinkuro", and then a fragment of 2173 base pairs represented by SEQ ID NO: 55 was amplified. The fragment included, at its 3' end side, (i) a 5'-end-side untranslated region of 197 base pairs of the full-length cDNA sequence and (ii) a protein coding region of 26 base pairs. Since KOD-plus-NEO (Toyobo Co., Ltd.), which is a heat resisting DNA polymerase having strong 3'-5' exonuclease activity, was used in the PCR, both ends of a resultant amplified fragment were flush ends. Next, a resultant PCR product was digested by Xmal, which is isoschizomer of Smal, to prepare a fragment whose 5' end was a flush end and whose 3' end was a 5' protruding type sticky end due to Xmal. Meanwhile, pUC198AA-CGN was digested by Hindlll, caused to have flush ends with use of a KOD DNA polymerase (Toyobo Co., Ltd.), and then further digested by Xmal. Note that pUC198AA-CGN is a vector obtained by introducing pBI221 (DDBJ / GenBank / EMBL Accession No. AF502128) CaMV35S promotor::GUS::NOS terminator cassette to a Hindlll-EcoRI site of a cloning vector pUC198AA (reference literature: Kuroda et al., 2010, Biosci. Biotechnol. Biochem. 74: 2348-2351). A CaMV35S promotor fragment was thus cut out from pUC198AA-CGN, and the foregoing amplified fragment was inserted to the part of pUC198AA-CGN from which part the CaMV35S promotor fragment had been removed. A resultant recombinant plasmid was transformed into E. coli, and the recombinant plasmid was extracted from a resultant colony. A base sequence of the recombinant plasmid was checked to select a clone which did not have a sequence mutation caused by PCR amplification. The promotor region (hereinafter, referred to as a promotor A) of the gene A was thus cloned, and was used for the following recombinant plasmid construction. A structure of a resultant vector (hereinafter, referred to pUC198AA-PgeneAGN) is illustrated in (a) of Fig. 6. Note that, in schematic views of vectors in Fig. 6, the promotor A region is shown as Pgene_A. Further, in schematic views of vectors in Figs. 6 and 13, a NOS terminator region is shown as Tnos, a NOS promotor is shown as Pnos, and a CaMV35S promotor region is shown as P35S.(3. Production of parthenocarpic eggplant transformant by mutation of gene A)<Construction of vector for inducing RNAi (RNA interference) of gene A>

[0119] A DNA fragment, represented by SEQ ID NO: 58, of 522 bp was obtained with the use of (i) cDNA, represented by SEQ ID NO: 3, of the gene A as a template and (ii) primers respectively represented by SEQ ID NO: 56 and SEQ ID NO: 57. This fragment had (i) an Xmal recognition site and a Hindlll recognition site at its 5' end and (ii) a Sacl recognition site and an XhiO recognition site at its 3' end. The fragment was inserted into a cloning vector pTY262 (DDBJ / GenBank / EMBL Accession No. AB736152) to construct a RNAi-induction chimeric gene for the gene A. This pTY262 vector has an expression cassette including a CaMV35S promotor and a NOS terminator. In the pTY262 vector, cloning sites of an exogenous sequence are arranged so as to sandwich the first intron of a tomato tubulin gene.

[0120] First, the fragment of 522 bp (SEQ ID NO: 58) was digested by Hindlll and Sacl, and then inserted ahead of the NOS terminator. Next, a resultant vector was digested by Xhol, caused to have blunt ends with use of a KOD DNA polymerase (Toyobo Co., Ltd.), and then digested by Xmal. The fragment of 522 bp was digested by Sacl, similarly caused to have flush ends with use of a KOD DNA polymerase (Toyobo Co., Ltd.), and then digested by Xmal. The fragment of 522 bp was then inserted ahead of the CaMV35S promotor of the foregoing linear vector. A resultant RNAi-induction chimeric gene had a structure in which the substantially entire fragment of 522 bp represented by SEQ ID NO: 58 was arranged in an inverted repeat sequence into which the first intron of the tomato tubulin gene was inserted. Expression of the RNAi-induction chimeric gene was induced by the CaMV35S promotor which induces constitutive expression of general plants (see (b) of Fig. 6). Note that, in the schematic view of the vectors in Fig. 6, the DNA fragment of 522 bp of the gene A is shown as RNAi-A. Note also that, in the schematic views of the vectors in Figs. 6 and 13, a region of the first intron of a tomato tubulin gene is shown as TUA6_intron. The entire inverted repeat sequence of this vector pTY262-CgeneA-RNAiN was then (i) digested by a restriction enzyme Kpnl, (ii) caused to have flush ends, (iii) cut by a Sacl process, and (iv) inserted into a site from which a GUS gene of the vector pUC198AA-PgeneAGN was cut by a Smal process and a Sacl process. An RNAi-induction chimeric gene was thus constructed. A resultant RNAi-induction chimeric gene pUC198AA-PgeneA-RNAiN had an inverted repeat sequence identical, in structure, to that of the vector pTY262-CgeneA-RNAiN. Expression of the RNAi-induction chimeric gene pUC198AA-PgeneA-RNAiN was induced by the promotor A (see (c) of Fig. 6). This chimeric gene was cut by a restriction enzyme Ascl, and inserted to an Ascl recognition site of a binary vector pZK3BGFP which had been uniquely constructed by introducing a CaMV35S promotor::sGFP::NOS terminator expression cassette (Reference Literature: Chiu et al., 1993, Curr. Biol. 6: 325-330) to a binary vector pZK3 (Reference Literature: Kuroda et al., 2010, Biosci. Biotechnol. Biochem. 74: 2348-2351). A binary vector pZK3BGFP-PgeneA-RNAiN was thus constructed (see (d) of Fig. 6).< Production of eggplant transformant by RNAi>

[0121] An eggplant transformant was produced to which the binary vector for RNAi interference was introduced. A concrete method of producing the eggplant transformant was as follows. First, with the Agrobacterium method (Reference Literature: Billings, S et al., 1997, J Amer. Hort. Sci 122: 158-162), a cotyledon of eggplant cultivar "Nakateshinkuro" was infected with Agrobacterium having a binary vector, cultured on a kanamycin-containing medium, and selected. A redifferentiated plant was thus obtained. Whether or not gene transfer of the redifferentiated plant succeeded was evaluated by fluorescence expression by a marker gene GFP and checking by PCR of a transgene, and a transgenic plant at the original generation of transformation was obtained. Furthermore, among the first selfed generation of the transgenic plant, (i) an individual having a transgene as a homozygote and (ii) an individual having no transgene due to genetic segregation were each selected by quantitative PCR.<Study of parthenocarpy of eggplant transformant>

[0122] An individual (12012-1_homozygote) which was of the eggplant transformant and had been selected as above was cultivated, and its parthenocarpy was checked by observing growth (enlargement) from an ovary, whose stigma had been removed before anthesis, to a fruit. Concurrently, (i) an original cultivar "Nakateshinkuro" (control) which was a non-transformant and (ii) an individual (12012-1_null) which had been derived from a transformant but lost a transgene by genetic segregation were cultivated and observed, as controls, in terms of growth (enlargement) of a fruit which had been subjected to similar treatment and normal open pollination. Fig. 7 show results of this. As shown in Fig. 7, even in the case where pollination had been prevented by removing the stigma before anthesis, the fruit of the individual 12012-1_homozygote which was a transformant having a transgene as a homozygote showed evident growth (enlargement), and thus showed parthenocarpy ((a) of Fig. 7). Moreover, it was confirmed that no seeds were formed in the individual 12012-1_homozygote because the 12012-1_homozygote was not pollinated ((d) of Fig. 7). On the other hand, in the individual 12012-1_null ((b) of Fig. 7), the fruit was hardly enlarged, as with the control ((c) of Fig. 7). With regard to the individual 12012-1_null and the control, (e) and (f) of Fig. 7 respectively show states of fruits which were insufficiently enlarged due to non-pollination.

[0123] All RNAs were extracted, at anthesis, from ovaries of the eggplant transformant (individual 12012-1_homozygote), the non-transformant (control) of the original cultivar "Nakateshinkuro", and the individual (12012-1_null) which had lost a transgene, and cDNA was synthesized with the use of Superscript VILO cDNA synthesis kit (Life Technologies Corporation), while using all the RNAs as templates. While using the obtained cDNA as a template, an mRNA accumulation amount of the gene A was measured by quantitative PCR with the use of, as primers, oligonucleotides represented by SEQ ID NO: 45 and SEQ ID NO: 46, respectively. Fig. 8 shows results of this. As shown in Fig. 8, in the transformant (12012-1_homozygote), expression of the gene A in the ovary at anthesis was greatly inhibited. Moreover, the individual 12012-1_null which had lost the transgene and did not show parthenocarpy at all had a gene A expression level which was substantially identical with that of the control (non-transformant), as with the growth (enlargement) state of the fruit.

[0124] From the above results, it was clarified that parthenocarpy was induced in eggplant by inhibiting expression of the gene A.(4. Quantitative determination of indole acetic acid (IAA) concentration and IAA metabolite concentration in parthenocarpic eggplant line PCSS)<Quantitative determination of indole acetic acid (IAA) concentration and IAA metabolite concentration in parthenocarpic eggplant line PCSS, by LC / MS / MS analysis>

[0125] In order to quantitatively determine an IAA amount and an IAA metabolite amount in the parthenocarpic eggplant line PCSS, LC / MS / MS analysis was carried out on the line PCSS serving as an experimental material.

[0126] In a case where LC / MS / MS analysis is carried out on an auxin metabolite or the like while using Arabidopsis as a material, an extract is extracted from a plant body with the use of a sodium phosphate buffer. It is said that the auxin metabolite or the like can be analyzed while using a solution, in which the extract is purified by an OASIS HLB column (Nihon Waters K.K.), as a sample (Reference Literature: Novak et al., 2012, Plant Journal. 72: 523-536). However, in a case where an ovary of eggplant was used, it was highly difficult to carry out, with the use of LC / MS / MS, analysis on a sample obtained by the above purification method, due to influence of ion suppression by impurities. Under the circumstances, an eluate by the OASIS HLB was segregated into (i) a mixed fraction of an acidic substance and a neutral substance and (ii) a basic substance fraction by an OASIS MCX column (Nihon Waters K.K.). Further, the obtained mixed fraction of an acidic substance and a neutral substance was segregated into the acidic substance and the neutral substance by an OASIS WAX column (Nihon Waters K.K.), and samples thus obtained were subjected to LC / MS / MS analysis. By using the samples purified by the purification method, it was possible to carry out LC / MS / MS analysis on indole acetic acid (IAA) which was an active substance contained in each of the samples. Moreover, by this analyzing method, it was possible to carry out LC / MS / MS analysis on a small amount of a sample that was obtained from one ovary of eggplant. Meanwhile, an indole pyruvic acid (IPyA) which is a precursor of IAA was a highly unstable substance, and therefore an extract was derivatized by cysteamine, and analyzed after purification by the OASIS HLB. The purified substance thus obtained was analyzed by LC / MS / MS (mass spectrometer) (3200 QTRAP, AB SCIEX). Segregation by an HPLC of LC / MS / MS was carried out by a Shim-pack XR-ODS column (Shimadzu Corporation) and the segregated substance was ionized by ESI (electron spray ionization) and introduced to MS / MS. Then, detection of molecular ions and fragment ions generated in a MRM (Multiple Reaction Monitoring) mode was carried out.

[0127] With regard to ovaries and anthers of buds (of approximately 5 days before anthesis, before petal coloring and approximately 2 days before anthesis, at petal coloring) of the parthenocarpic eggplant line PCSS and an ovary, an anther, an internode, and a shoot apex of the line PCSS at anthesis, endogenous IAA concentrations were measured by carrying out quantitative analysis by the above described method. Moreover, for comparison, a selfed line NP of non-parthenocarpic eggplant was similarly measured as a control. The selfed line NP of the non-parthenocarpic eggplant was a non-parthenocarpic line bred by a crossing combination identical with that of the line PCSS. Fig. 9 shows measurement results. As shown in Fig. 9, no difference in endogenous IAA amount between the line PCSS and the line NP was seen at the shoot apex and the internode.

[0128] Meanwhile, in the ovary and the anther, endogenous IAA concentrations which were approximately 2.6 to 4.6 times higher than those of the line NP were observed in the line PCSS at all the measured developing stages (i.e., before petal coloring, at petal coloring, and at anthesis).

[0129] Further, an ovary of the line PCSS at anthesis was analyzed in terms of IAA metabolite and the like by a similar method. Fig. 10 shows results of this. It was clarified that IPyA and IAA were accumulated in the line PCSS with a notably high concentration, as compared with the line NP. Meanwhile, the line PCSS and the line NP were not notably different from each other in terms of accumulation of IAM, TAM, oxIAA, IAAsp, and IAGlu each of which was an intermediate product in another IAA synthesis pathway or a metabolite of IAA.<Quantitative determination of indole acetic acid (IAA) concentration in gene A inhibited transgenic eggplant line 12012-1_homozygote, by LC / MS / MS analysis>

[0130] Next, IAA was extracted from an ovary of a gene A inhibited transgenic eggplant line 12012-1_homozygote, and quantitative analysis was carried out with a method similar to that in the case where the line PCSS was used. Fig. 11 shows results. As a result, as shown in Fig. 11, an endogenous IAA concentration, which was approximately 4 times on average higher than that of the non-transformant (cultivar "Nakateshinkuro"), was observed in an ovary of an eggplant transformant in which expression of the gene A was inhibited.

[0131] From the above results, it was suggested that the parthenocarpic gene A encoded an amino group transferase. Further, it was suggested that the amino group transferase was an amino group transferase that had an enzyme activity similar to that of VAS1 of Arabidopsis for synthesizing tryptophan while using IPyA as a ground substance. Further, it was strongly suggested that (i) the endogenous IAA concentration could be increased in a flower organ of a solanaceous product to a level at which practical parthenocarpy is induced, by inhibiting expression of the gene and (ii) consequently a solanaceous plant encompassing tomato and eggplant showed parthenocarpy.(5. Measurement of activity of protein A encoded by gene A)<Analysis of function of protein A encoded by gene A, with use of transgenic protein transiently expressed in wild species of tobacco>

[0132] A DNA fragment (SEQ ID NO: 69) made up of 24 bases was added ahead of a termination codon of a cDNA sequence of the gene A so that a reading frame would not be changed, and thus a chimeric gene was constructed from which a gene product is produced in which a Strep-tag II sequence, i.e., Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (Reference Literature: Schmidt et al., 1996, J. Mol. Biol. 255: 753-766) is added to a C end of the protein A encoded by the gene A. An expression construct was produced by replacing this gene with a GUS gene of pUC198AA-CGN, and further a transformation binary vector was produced by introducing the expression construct into a binary vector pZK3BGFP. An Agrobacterium suspension retaining the vector was injected into the inside of a leaf tissue via stomata of an unfolded leaf of Nicotiana benthamiana (which is a wild species of tobacco) so that the gene was transiently expressed in the leaf of tobacco, and thus the transgenic protein A having the Streptag sequence at the C end was synthesized. On the third day from the injection treatment, a crude protein was extracted from the treated leaf with a phosphoric acid buffer, and the transgenic protein A was purified by chromatography with the use of Strep-Tactin Sepharose column (IBA GmbH). Moreover, as a control, a GUS gene was constructed in which a Strep-tag II sequence was added to a C end of an E. coli-derived GUS gene, and a transgenic GUS protein was purified with similar procedures.

[0133] To each of solutions of the respective proteins thus obtained (2 µg / µL), an amino acid mixed solution (Arg, Gln, Cys, Asp, Gly, Met, Phe, and Glu) (concentration of each amino acid in the solution: 5 mM), pyridoxal phosphate, and IPyA (500 µM) were added, and each of the mixtures was reacted in a 50 mM sodium phosphate buffer (pH 7.4) at 30°C for 2 hours. Then, each of the reaction solutions was purified by an OASIS HLB column, and analyzed with the use of LC / MS / MS. Results are shown in Fig. 12. As shown in (a) of Fig. 12, tryptophan depending on the transgenic protein A was produced. Note that tryptophan was not detected in a case where the transgenic GUS protein was used (see (b) of Fig. 12). From this, it is clear that production of tryptophan from the leaf tissue of N. benthamiana (wild species of tobacco) from which the protein was extracted is not higher than a detection limit.

[0134] From the above results, it was confirmed that the protein A encoded by the gene A was an amino group transferase that catalyzes reaction to synthesize tryptophan by using IPyA and amino acid as substrates.[Example 2: Tomato-derived parthenocarpic gene tA](1. Identification and analysis of tomato-derived parthenocarpy responsible gene tA)<Preparation of cDNA fragment of tomato homologue of gene A of eggplant>

[0135] By carrying out BLASTP search in deduced amino acid sequence database (database name: ITAG2.30, web page http: / / www.solgenomics.net) of structural genes deduced from a genomic sequence of tomato (Reference Literature: The Tomato Genome Consortium 2012, Nature 485: 635-641) while setting a deduced amino acid sequence of the protein A as a query sequence, a tomato homologue gene tA was obtained which was deduced to encode a protein that has a sequence identity of 95% relative to the gene A. The tomato homologue gene tA had a base sequence that was the sequence represented by SEQ ID NO: 29 described in <Analysis of deduced amino acid sequence of gene A product and search for homologous sequence> above. Based on the base sequence, a pair of primers (SEQ ID NO: 59 and SEQ ID NO: 60) for amplifying a part of the base sequence was synthesized. From all RNAs extracted from a flower and a bud of a tomato cultivar "Shugyoku", cDNA was synthesized with the use of a transcriptor first strand cDNA synthesis kit (Roche Diagnostics K.K.) While using the cDNA as a template, PCR was carried out with the use of the pair of primers, and thus a DNA fragment of 523 bp represented by SEQ ID NO: 61 was obtained. In the fragment, (i) a recognition site for a restricted enzyme Xmal and a restricted enzyme Clal are added to a 5' end of a cDNA-derived sequence of 496 bp and (ii) a recognition site for a restricted enzyme Sacl and a restricted enzyme Xhol are added to a 3' end of the cDNA-derived sequence. The fragment was treated by Clal and Sacl and then introduced into pTY262, and the above described fragment was treated by Xhol and Xmal and then introduced into a plasmid of the pTY262. Thus, an RNAi-induction chimeric gene having an inverted repeat sequence structure was constructed. Absence of mutation of the base sequence of the introduced fragment was confirmed by sequencing, and thus a clone having a correct sequence was selected. A structure of this vector pTY262-Cgene_tA-RNAiN is illustrated in Fig. 13(a). The vector pTY262-Cgene_tA-RNAiN is further treated by Ascl, and an expression cassette of a cut-out gene tA was inserted into an Ascl site of pZK3BGFP. A structure of a binary vector pZK3BGFP-CtARNAiN thus obtained is illustrated in Fig. 13(b). Note that, in the schematic views of vectors in Fig. 13, the DNA fragment of 523 bp in the gene tA is indicated by "RNAi-tA".<Isolation of promoter of tomato homologue gene tA>

[0136] With reference to a tomato genomic sequence, 1908 base pairs of a genomic fragment (SEQ ID NO: 62) including 1870 bp in a part upstream of a translation start site of the gene tA and 29 bp of a protein coding region downstream of the translation start site was amplified from a genomic DNA of the tomato cultivar "Shugyoku" with the use of a pair of primers represented by SEQ ID NO: 63 and SEQ ID NO: 64. KOD-plus-NEO (Toyobo Co., Ltd.) which is heat resisting DNA polymerase having a strong 3'-5' exonuclease activity was used in PCR reaction, and therefore both ends of the amplified fragment were flush ends. Moreover, the fragment had an Xmal recognition site derived from the primer (SEQ ID NO: 64) at the 3' end. A cloning vector pHSG398 (Takara Bio Inc.) was (i) treated by a restricted enzyme BamHI, (ii) made to have flush ends with the use of KOD DNA polymerase (Toyobo Co., Ltd.), (iii) mixed with the above fragment, (iv) treated by a restricted enzyme Xmal, and then (v) ligated with the use of T4 DNA ligase (Promega Corporation), and (vi) introduced into E. coli. Thus, a promoter region (hereinafter, referred to as "promoter tA") of the tomato homologue gene tA was cloned. Further, a clone pHSG398-PtA having no mutation was selected by sequencing. Fig. 13(c) illustrates a structure of the clone pHSG398-PtA. Note that, in the schematic views of vectors in Fig. 13, a region of the promoter tA is indicated by "Pgene_tA". Further, the pHSG398-PtA was treated by Smal and Xbal and a promoter tA fragment was cut out. Then, an expression cassette in a structure of a plasmid pTY262-Pgene_tA-RNAiN, in which the cut out promoter tA fragment was replaced with a CaMV35S promoter of the pTY262-Cgene_tA-RNAiN, was inserted into an Ascl site of pZK3BGFP. A structure of the binary vector pZK3BGFP-PtARNAiN thus obtained is illustrated in Fig. 13(d).<Production of tomato transformant in which expression of gene tA is inhibited, by RNAi>

[0137] With the use of the binary vectors pZK3BGFP-PtARNAiN and pZK3BGFP-CtARNAiN constructed by the above procedures, a tomato transformant was produced with an Agrobacterium method. Specifically, with the use of the Agrobacterium method (Reference Literature: Sun et al., 2006, Plant Cell Physiol. 47: 426-431), a cotyledon of a tomato cultivar "Ailsa Craig" was infected with Agrobacterium having a binary vector, and cultured on a kanamycin-containing medium. Then, selection was carried out and thus a redifferentiated plant was obtained. Whether or not gene transfer of the redifferentiated plant succeeded was evaluated by fluorescence expression by a marker gene GFP and checking by PCR of a transgene, and a transgenic plant at the original generation of transformation was obtained.<Study of parthenocarpy of tomato transformant>

[0138] An individual of the tomato transformant obtained by the above selection was cultivated, a stigma of the individual was removed before anthesis, and parthenocarpy of the individual was checked. Moreover, a non-transformant (control) of a tomato original cultivar "Ailsa Craig" was concurrently cultivated, and a stigma thereof was similarly removed. Thus, the non-transformant was used as a control. Further, with regard to the tomato transformant, an enlargement / maturation state of a fruit which had been subjected to normal open pollination was observed. Fig. 14 shows results of this. As shown in Fig. 14, an enlarged fruit was not formed at all from the tomato cultivar "Ailsa Craig" i.e., the non-transformant from which the stigma had been removed. On the other hand, with regard to the transformant (individual No. 1220-4) in which expression of the gene tA was inhibited by RNAi induction with the use of the CaMV35S promoter, the stigma-removed fruit was enlarged similarly to a fruit which had been subjected to open pollination and had formed seeds, and thus a ripe fruit having no seed was obtained. Moreover, also with regard to the case (individual No. 0716-18) where a gene tA promoter was used, the stigma-removed fruit was enlarged (i.e., grew) and thus became a ripe fruit. The above clarified that parthenocarpy can be given to tomato by artificially inducing inhibition of expression of the gene tA.

[0139] All RNAs were extracted from flower buds of the tomato transformant (individual No. 1220-4) and the non-transformant (control) of the original cultivar "Ailsa Craig" before anthesis, and cDNA was synthesized with the use of Superscript VILO cDNA synthesis kit (Life Technologies Corporation), while using all the RNAs as templates. While using the obtained cDNA as a template, an mRNA accumulation amount of the gene tA was measured by quantitative PCR with the use of, as primers, oligonucleotides represented by SEQ ID NO: 65 and SEQ ID NO: 66. In order to standardize quantitative values, quantitative determination of an internal standard gene was also carried out while similarly using the cDNA as a template. As the internal standard gene, a tomato gene Solyc04g049180.2.1 (data set name: ITAG2.30, website: http: / / solgenomics.net) was used. This gene is a gene which was found by the inventors to be constitutively expressed in tomato. Further, as the primers for amplifying the internal standard gene, primers represented by SEQ ID NO: 67 and SEQ ID NO: 68 were used. Fig. 15 shows results of this. As shown in Fig. 15, it was confirmed that, in the transformant, expression of the gene tA in the flower bud before anthesis was greatly inhibited, as compared with the non-transformant of the original cultivar Ailsa Craig.<Quantitative determination of indole acetic acid (IAA) concentration in gene tA inhibited transgenic tomato line 1220-4, by LC / MS / MS analysis>

[0140] Next, IAA was extracted from a flower bud of a gene tA inhibited transformant 1220-4 of tomato, and quantitative analysis was carried out. Note that extraction, purification, and analysis of IAA were carried out with methods similar to those in the case of eggplant in Example 1 above. Fig. 16 shows results of this. In the inhibited transformant, an endogenous IAA concentration which was approximately 3 times higher than that of the non-transformant (cultivar "Ailsa Craig") was observed.

[0141] From the above result, it was clarified that parthenocarpy was induced also in tomato by inhibiting expression of the tomato gene tA which is a homologue of the eggplant parthenocarpic gene A.[Example 3: Pepper-derived parthenocarpy responsible gene pA](1. Identification and analysis of pepper-derived parthenocarpy responsible gene pA)<Production of gene pA function deficient mutant by EMS treatment>

[0142] As described in <Analysis of deduced amino acid sequence of gene A product and search for homologous sequence> of Example 1 above, TC19330 (data set name: DFCI Pepper Gene Index ver. 4.0, Reference Literature: Quackenbuch et al. (2001) Nucl. Acid. Res. 29: 159-164, website http: / / compbio.dfci.harvard.edu / tgi / plant.html) was found as a pepper homologue gene (SEQ ID NO: 35) which has the highest sequence identity relative to the gene A. Hereinafter, this gene is referred to as "gene pA". Mutation induction treatment was carried out by immersing a seed (cultivar "Maor") of pepper (Capsicum annuum) in an aqueous solution of EMS (ethyl methane sulfonate) which is a generally used chemical mutagen, and thus artificial mutation of the gene pA was induced. Then, screening of the mutant was carried out. The screening was carried out with the key-point method (Reference Literature: Rigola et al., 2009, PLoS One 4: e4761.) In the Key Point method, seeds at the original generation of mutation induction treatment are sown and, with the use of a DNA sample extracted from a budded plant body, a sample in which genomic DNA from a plurality of samples were multidimensionally mixed was analyzed by a second generation sequencer so as to detect a mutation, and thus an individual having a mutation in a coding region of the gene pA is searched. As a result, a mutant 1 and a mutant 2 were found each of which had a so-called nonsense mutation (i.e., a termination codon with an unchanged reading frame was caused) in the coding region of the gene pA. As compared with a wild type sequence of SEQ ID NO: 35, 125th base in the mutant 1 was mutated from G to A, and 42nd codon was mutated from Trp-encoding TGG to a termination codon TAG. Moreover, in the mutant 2, 127th base was mutated from C to T, and 43rd codon was mutated from Gln-encoding CAA to a termination codon TAA. Therefore, in the mutant 1 and the mutant 2, mutation was caused in the gene pA which encodes a protein made of 394 amino acids represented by SEQ ID NO: 34, and it seemed that an incomplete protein was produced which was made of 41 amino acids or 42 amino acids on the N end side.<Study of parthenocarpy of pepper gene pA function deficient mutant>

[0143] Each of the mutant 1 and the mutant 2, i.e., obtained induced mutations at the original generation had the mutant gene as a heterozygote, and therefore seeds of their selfed second generations were obtained and analysis was carried out on the seeds thus obtained. In the selfed second generation, an individual showing a wild type homozygote in a mutation site and an individual showing a mutant type homozygote were cultivated. An anther of each of the individuals was removed before anthesis, and parthenocarpy of the individuals was checked. Concurrently, a gene pA function deficient mutant of pepper showing a mutant type homozygote in a mutation site and an individual showing a wild type homozygote, which mutant and individual had been subjected to normal open pollination, were also cultivated, and used as controls by carrying out similar treatment and observing a maturation state of a fruit. Fig. 17 shows results of this. As shown in Fig. 17, in the selfed second generation of the mutant 1 and the mutant 2, the individual which had the wild type homozygote and had been subjected to emasculation produced a fruit which was not enlarged at all, as with general pepper. On the other hand, each of the individuals, which had been obtained from the respective selfed second generations of the mutant 1 and the mutant 2 and had the mutant type homozygote, produced a fruit which was clearly observed to be enlarged even in the case where pollination had been prevented by emasculation.

[0144] Moreover, with regard to the individual having the mutant type homozygote, seeds were not formed at all in the enlarged fruit produced from the emasculated flower. On the other hand, with regard to the individuals having any of the wild type homozygote and the mutant type homozygote, enlarged fruits having normal seeds were produced from flowers which had been self-pollinated.

[0145] From this, it was confirmed that the enlarged fruit produced from the individual having the mutant homozygote was formed due to parthenocarpy.

[0146] From the above results, it was clarified that evident parthenocarpy was induced also in pepper by deficiency of the function of the pepper gene pA which is a homologue of the eggplant parthenocarpic gene A. Moreover, it was shown that the plant body showing parthenocarpy could be obtained by screening (i) an individual in which the gene A has a mutation or (ii) an individual in which a homologue gene of the gene A has a mutation.(3. Quantitative determination of endogenous IAA concentration of pepper-derived gene pA mutant)

[0147] From the selfed second generation of the pepper mutant 1, individuals 355-1P and 355-8P, and individuals 355-1W and 355-8W were selected and cultivated. Each of the individuals 355-1P and 355-8P showed parthenocarpy, and its nonsense mutation site found in the gene pA was a mutant type homozygote. Each of the individuals 355-1W and 355-8W did not show parthenocarpy, and its nonsense mutation site found in the gene pA was a wild type homozygote. Here, the individuals 355-1P and 355-1Wwere sib individuals derived from selfed first generation individuals of the same mutant 1, and the individuals 355-8P and 355-8W were sib individuals derived from selfed first generation individuals of the same mutant 1. Similarly, from the selfed second generation of the pepper mutant 2, an individual 356-3P and an individual 356-2W were selected and cultivated. The individual 356-3P showed parthenocarpy, and its nonsense mutation site found in the gene pA was a mutant type homozygote. The individual 356-2W did not show parthenocarpy, and its nonsense mutation site found in the gene pA was a wild type homozygote. Here, the individuals 356-3P and 356-2W were derived from different selfed first generation individuals of the mutant 2. Buds immediately before anthesis were picked from the respective individuals, and endogenous IAA concentrations in ovaries were measured. Fig. 18 shows results of this. As shown in Fig. 18, it was clarified that, in the gene pA mutant type individuals, endogenous IAA was accumulated at a notably higher concentration than in the wild type individuals. With regard to the mutant 1, the mutant type homozygous individuals (355-1P and 355-8P) showed increase in amount of endogenous IAA which was approximately three times greater than that of the respective wild type homozygotes (355-1W and 355-8W) which were sib individuals. With regard to the mutant 2, the mutant homozygote (356-3P) showed increase in amount of endogenous IAA which was approximately 1.8 times greater than that of the wild type homozygote (356-2W). From these, it was clarified that, even in a parthenocarpic line induced by a nonsense mutation of the pepper gene pA which was a homologue of the eggplant parthenocarpic gene A, the endogenous IAA content in the ovary was notably increased as with the case of eggplant, and the gene pA regulated parthenocarpy of pepper based on a physiological function identical with that of the eggplant gene A.[Example 4: Detailed analysis of eggplant parthenocarpic gene A](1. Promoter analysis of parthenocarpic gene A with use of GUS (β-glucuronidase) gene)

[0148] A binary vector pZK3BGFP-PgeneAGN was constructed by inserting an expression cassette PgeneAGN illustrated in Fig. 6(a) into an Ascl recognition site of a binary vector pZK3BGFP, and the binary vector pZK3BGFP-PgeneAGN was then introduced into an eggplant cultivar "Nakateshinkuro" with the Agrobacterium method. Thus, a transgenic plant was obtained. Further, an individual having a transgene as a homozygote was selected from individuals in the selfed first generation of the transformant. A flower produced from the selected individual (12023-3_homozygote) of the eggplant transformant was picked 2 days before anthesis, and an activity of a reporter gene (GUS) was histochemically detected in accordance with a method of Kosugi et al. (Reference Literature: Kosugi et al. (1990) Plant Sci. 70: 133-40) while using X-Gluc as a ground substance. As a result, as shown in Fig. 19, an evident activity of GUS was seen in an entire ovary tissue, an anther, a style, and a petal base. Here, as an artificial application of auxin, auxin is known to induce enlargement of a fruit. Moreover, as above described, the gene A seems to have a function negatively affects biosynthesis of IAA. In consideration of these, the fact that the gene A is expressed in the entire ovary tissue strongly suggests that (i) the gene A has a function to inhibit enlargement of a fruit by keeping an IAA concentration low in the ovary tissue and (ii) deficiency of the function to inhibit enlargement of a fruit, which deficiency is due to a defect of the gene A, causes induction of parthenocarpy.(2. Study of parthenocarpy of eggplant transformant produced separately from eggplant transformant of Example 1)

[0149] With a method similar to the method described in <Production of eggplant transformant by RNAi> of Example 1 above, transformants 12012-4_homozygote and 12014-10_homozygote, in which expression of the gene A was inhibited, were newly produced and bred in an experimental system independent from the eggplant transformant (12012-1_homozygote) obtained in Example 1. Moreover, sib individuals 12012-4_null and 12014-10_null, each of which had lost a transgene by genetic segregation, were produced and bred. Parthenocarpy of these transformants was studied with a method similar to the method described in <Study of parthenocarpy of eggplant transformant> of Example 1 above. That is, all the transformants were (i) concurrently cultivated, (ii) treated in the same manner, (iii) observed in terms of enlargement / growth of fruits, and (iv) compared with each other. Fig. 20 shows results. As shown in (a) and (c) of Fig. 20, even in a case where pollination was prevented by removing a stigma before anthesis, fruits produced from the gene-transferred two individuals showed parthenocarpy, and seeds were not formed inside the fruits. On the other hand, as shown in (b) and (d) of Fig. 20, with regard to each of the two null lines 12012-4_null and 12014-10_null which had lost a transgene, no enlarged fruit was formed from a flower organ whose stigma had been removed before anthesis. From the above results, it was confirmed that evident parthenocarpy was induced in three different transformant lines which had been produced and bred by independent different transformation events, in addition to the results of the transformants in Example 1.

[0150] Moreover, with a method similar to the method described in <Study of parthenocarpy of eggplant transformant> in Example 1, an mRNA accumulation amount of the gene A was measured in each of two transformants 12012-4_homozygote and 12014-10_homozygote newly obtained in Example 4. (a) of Fig. 21 shows results. As shown in (a) of Fig. 21, in the transformants 12012-4_homozygote and 12014-10_homozygote each of which showed parthenocarpy, expression of the gene A in an ovary at anthesis was greatly inhibited, i.e., the expression of the gene A was approximately 1 / 4 to 1 / 6 as compared with those in two null lines each of which had lost a transgene.

[0151] Further, in the transformant 12012-4_homozygote, an endogenous IAA amount in an ovary at anthesis was measured. The measurement was carried out with a method similar to the method described in (4. Quantitative determination of indole acetic acid (IAA) concentration and IAA metabolite concentration in parthenocarpic eggplant line PCSS) of Example 1. (b) of Fig. 21 showed results. As shown in (b) of Fig. 21, in the transformant 12012-4_homozygote which had a transgene as a homozygote and in which expression of the gene A was inhibited, notable increase in IAA concentration was confirmed which was more than three times of that in the sib line 12012-4_null which had lost a transgene and in which expression of the gene A was not inhibited. The above results further strongly suggested that parthenocarpy is induced in a solanaceous plant by inhibiting expression of a gene function of the parthenocarpic gene A.(3. Complementation test on function of gene A by introducing wild type gene A)<Production of parthenocarpic eggplant line "M3A">

[0152] From F5 generation of a line PCSS and a non-parthenocarpic eggplant line TN-45 which had been bred by procedures described in <Detailed mapping of parthenocarpy> of Example 1 and Fig. 3, P34F3_497_55_139 was selected, and its selfed progeny was named "line M3A". In the "line M3A", genotypes of 96 single nucleotide polymorphism markers (Reference Literature: Hirakawa et al. (2014) DNA Res. 21: 649-660) distributed in an entire genome were all homozygosis. Moreover, by PCR with the use of four primers represented by the respective SEQ ID NO: 49 through SEQ ID NO: 52 above, it was confirmed that the "line M3A" had, in homozygosis, a gene which was a mutant type of the gene A derived from the line PCSS (not illustrated). From above, the "line M3A" was determined to be a genetically pure line.

[0153] With the use of the "line M3A", an eggplant transformant was produced, and detailed functional analysis of the gene A was carried out as below.<Production of eggplant transformant in line M3A>

[0154] A sequence including a part of a promoter region, a first exon, and a first intron of the gene A in a genome of an eggplant cultivar "Nakateshinkuro" was amplified by carrying out PCR while using (i) primers represented by SEQ ID NO: 70 and SEQ ID NO: 71 and (ii) a genomic DNA of "Nakateshinkuro" as a template, and thus a fragment including 2313 base pairs represented by SEQ ID NO: 72 was obtained. This fragment had (i) a recognition site of a restricted enzyme Xbal at a part from 3rd base to 8th base from a 5' end and (ii) a recognition site of a restricted enzyme Xmal at a part from 3rd base to 8th base from a 3' end. Note that this fragment has a recognition site of a restricted enzyme Bsml on a first exon at 14th base downstream of a translation start site. The fragment was inserted into an Xbal-Xmal site of a plasmid vector pHSG398 (Takara Bio Inc.), and cloning was carried out. A base sequence of a clone thus obtained was confirmed so as to select a clone pHSG398-PgeneAex1int1 which (i) did not have a mutation derived from PCR amplification in the base sequence and (ii) had an intended base sequence. The clone pHSG398-PgeneAex1int1 was completely digested by a restricted enzyme Xbal and smoothed with the use of Blunting high kit (Toyobo Co., Ltd.), and further completely digested by Xmal. Thus, an intended cloned fragment was cut out. Meanwhile, pUC198AA-CGN described in <Isolation of promoter of gene A> of Example 1 was completely digested by a restricted enzyme Hindlll and similarly smoothed, and further completely digested by Xmal. Thus, a CaMV35S promoter was cut out, and the fragment cut out from pHSG398-PgeneAex1int1 was inserted into the part from which the CaMV35S promoter had been cut out. A clone thus obtained was completely digested by Bsml and Sacl, and a fragment was cut out which included (i) a part downstream of a Bsml recognition site of a first exon of the gene A, (ii) a part of a first intron, and (iii) a GUS gene derived from pUC198AA-CGN. Another fragment was prepared by digesting, by Bsml and Sacl, a clone including an entire protein code of the gene A obtained with a method similar to the method described in <Analysis of expression level of gene A at each site of plant body in each developing stage> of Example 1, and this another fragment was inserted into the part from which the above fragment had been cut out. A clone obtained by the above method had an expression cassette of a wild type gene A (configured by (i) a cDNA sequence including an entire code of the gene A from a promoter region of the gene A via a translation start site and (ii) a NOS terminator sequence derived from pUC198-CGN). The expression cassette was cut out by a restricted enzyme Ascl and inserted into an Ascl recognition site of a binary vector pZK3BGFP, and thus a binary vector pZK3BGFP-PgeneA-ORFgeneAN was constructed. A structure of the binary vector pZK3BGFP-PgeneA-ORFgeneAN is shown in Fig. 22. This binary vector was introduced into the "line M3A" with a method similar to the method described in <Production of eggplant transformant by RNAi> of Example 1, and thus a transformation individual 13011-3 was produced. Further, from a selfed first generation of the transformation individual 13011-3, an individual 13011-3_homozygote having a transgene A as a homozygote and an individual 13011-3_null which had lost a transgene A by genetic segregation were selected.<Study of parthenocarpy of transformant of line M3A>

[0155] The individuals obtained by the above selection were cultivated concurrently with the original line "M3A" which was a non-transformant serving as a control. With a method similar to the method described in <Study of parthenocarpy of eggplant transformant> of Example 1, pollination was prevented by removing a stigma of a flower before anthesis, and parthenocarpy was evaluated by observing enlargement of the fruit after that. Fig. 23 shows results. As shown in (a) of Fig. 23, the original line M3A which was the non-transformant showed evident parthenocarpy whereas, as shown in (b) of Fig. 23, fruit enlargement of the individual 13011-3_homozygote was notably inhibited by the removal of stigma before anthesis, and parthenocarpy which the original line M3A had was lost. Meanwhile, as shown in (c) of Fig. 23, the individual 13011-3_null which had lost a transgene showed evident parthenocarpy, as with the line M3A which was an original line. Moreover, it was confirmed that the observed fruit enlargement was caused by parthenocarpy, from the fact that no seeds were formed inside the fruits.<Quantitative determination of endogenous indole acetic acid (IAA) amount in transformant of line M3A>

[0156] In order to quantitatively determine an endogenous IAA amount in a transformant of the line M3A, an endogenous IAA concentration in an ovary approximately two days before anthesis was measured. The measurement was carried out with a method similar to the method described in (4. Quantitative determination of indole acetic acid (IAA) concentration and IAA metabolite concentration in parthenocarpic eggplant line PCSS) of Example 1. Fig. 24 shows results. As shown in Fig. 24, notable decrease in endogenous IAA concentration was observed in the individual 13011-3_homozygote, as compared with the original line M3A. Moreover, it was clarified in the individual 13011-3_null, which had lost a transgene, that the endogenous IAA concentration was restored to a concentration substantially equal to that of the line M3A.

[0157] From the above results, it was clarified that (i) non-parthenocarpy similar to that of a wild type was restored and (ii) a high endogenous IAA concentration which is characteristically seen in an ovary of a parthenocarpic line was notably decreased because parthenocarpy of the line M3A was lost by expressing a wild type normal gene A by a gene A promoter. As such, parthenocarpy derived from the line PCSS was lost and a trait of the wild type was restored by expression of the wild type gene A, and this further clearly showed that deficiency of the function of the gene A was the cause of parthenocarpy of the line PCSS.(4. Detailed test of eggplant parthenocarpy with use of near-isogenic line)<Measurement of fruit weight with use of near-isogenic line>

[0158] Individuals P43F3_316_7_31_F_E10_10 and P43F3_316_7_31_F_E10_04 in F8 generation which were bred by the procedures described in <Detailed mapping of parthenocarpy> of Example 1 and Fig. 3 were two individuals among sib individuals obtained by selfing of a single F7 generation individual P43F3_316_7_31_F_E10. With regard to the sib individuals, genotypes of 96 single nucleotide polymorphism markers distributed over an entire genome were checked as with the method described in <Production of parthenocarpic eggplant line "M3A"> in Example 4, and a "line 039" and a "line 089", in each of which all checked marker gene loci were fixed in an allelic genotype identical with that of the other line, were bred. Further, the line 039 had, as a homozygote, a mutant type of the gene A derived from the line PCSS, and the line 089 had, as a homozygote, a wild type of the gene A derived from the line TN-43. Therefore, both the lines seemed to be near-isogenic lines in which only the gene A was the mutant type or the wild type and the other genomic regions ware fixed to substantially identical genomic backgrounds. The line 039 and the line 089 were concurrently cultivated, and each of the line 039 and the line 089 was subjected to normal open pollination and stigma removal before anthesis. Fruits were harvested 30 days after anthesis, and weights of the fruits were measured. Fig. 25 shows results. As illustrated in Fig. 25, in the line 039 having a mutant type gene A identical with that of the line PCSS, normally enlarged fruits having weights of approximately 300 g were produced from both a flower which had been normally pollinated and a flower whose pollination had been prevented by removing the stigma. On the other hand, in the line 089, a normally enlarged fruit having a weight (approximately 300 g) equivalent to those of the line 039 was produced from a flower which had been normally pollinated but, from a flower whose pollination had been prevented by removing the stigma, only a fruit which was defectively enlarged and had a weight of 50 g or less was produced, and a normally enlarged fruit was not produced at all. Here, as above described, the line 089 was a near-isogenic line of the line 039, i.e., the line 089 had a genomic background identical with that of the line 039 but the gene A was not a mutant type but was a wild type. From the above results, it was shown that expression of parthenocarpy was controlled by only a difference between having a mutant type gene A as a homozygote and having a wild type gene A as a homozygote, and was not influenced by other genetic factors. Further, it was clearly shown that, in the case of having the mutant type gene A as a homozygote, a normally enlarged fruit having a weight equivalent to that in the case of normal pollination was produced even though pollination had been prevented.(5. Measurement of activity of gene A protein expressed by E. coli)<Construction of vector for expressing gene A by E. coli>

[0159] SEQ ID NO: 3 represents 1,185 bases from nucleotide number 82 to nucleotide number 1266 in a cDNA sequence of the gene A, and the 1,185 bases include a code sequence of a gene A product represented by SEQ ID NO: 1 and a termination codon. A sequence (SEQ ID NO: 69) including 24 bases for encoding a Strep-tagll sequence was inserted ahead of the termination codon of the sequence of the 1,185 bases while maintaining a reading frame as with the method described in (5. Measurement of activity of protein A encoded by gene A) <Analysis of function of protein A encoded by gene A, with use of transgenic protein> of Example 1, and thus sequence data (SEQ ID NO: 73) was prepared. The sequence in the sequence data (i.e., input sequence data) was converted by the use of an optimization program "GENEius" (Eurofins Genomics K.K.) so as to have a codon usage that was optimal for expressing the gene A by E. coli. A DNA sequence thus converted is represented by SEQ ID NO: 74. A deduced amino acid sequence encoded by the sequence of SEQ ID NO: 74 is identical with a sequence in which the Strep-tagll sequence is added to the C end of the deduced amino acid sequence of the gene A product represented by SEQ ID NO: 1. Further, for cloning operation, a sequence of 16 bp represented by SEQ ID NO: 75 was added to a 5' end of a sequence represented by SEQ ID NO: 74, and a sequence of 17 bp represented by SEQ ID NO: 76 was added to a 3' end of the sequence represented by SEQ ID NO: 74. Thus, a DNA fragment whose full length was 1,242 bp was synthesized by outsourcing (Eurofins Genomics K.K.). The DNA fragment (SEQ ID NO: 77) was mixed with an E. coli expression vector pPAL7 (Bio-Rad Laboratories, Inc.), which had been treated by restricted enzymes BamHI and Notl, so that the DNA fragment (SEQ ID NO: 77) was inserted into the E. coli expression vector pPAL7 by In-Fusion cloning (Clontech Laboratories, Inc.) utilizing homology of ends of both the fragments. Fig. 26 shows a structure of a recombinant vector pPAL7-geneA_strep_ec thus obtained. In a cell of E. coli into which the vector has been introduced, expression of a downstream gene is induced by a T7 / lac promoter, and a gene A product (protein A) is produced which has a Profinity eXact tag at its N end and a Strep-tag II tag at its C end.<Expression of protein A in E. coli>

[0160] The vector obtained with the above method was transformed into an E. coli BL21 (DE3) strain, and an obtained clone was cultured at 20°C for 16 hours in an LB medium containing 0.3 mM of IPTG. After that, harvest was carried out, and a crude protein was extracted with the use of a B-PER protein extracting solution (Thermo Fisher Scientific Inc.). (a) and (b) of Fig. 27 show fractions during purification of a protein after extraction of the crude protein. (a) of Fig. 27 shows a result of electrophoresis carried out with the use of TGX Stain Free gel (Bio-Rad Laboratories, Inc.). (b) of Fig. 27 shows a result of Western blotting carried out, with the use of a Strep-tag II antibody, on a gel identical with the gel shown in (a) of Fig. 27. In the following descriptions, annotations on lane numbers are common to (a) of Fig. 27 and (b) of Fig. 27. First, the crude protein was segregated into an insoluble fraction and a soluble fraction. A lane 1 indicates a result of the soluble fraction in the extracted crude protein. A lane 2 indicates a result of the insoluble fraction. Next, the soluble fraction was passed through a Profinity eXact Mini Spin column (Bio-Rad Laboratories, Inc.) (column in which functional ligand is subtilisin protease), and then the column was washed twice with a wash buffer. A lane 3 indicates a result of a fraction which passed through the column without being bonded to the column. A lane 4 indicates a result of a column wash fraction of the first washing. A lane 5 indicates a result of a column wash fraction of the second washing. Next, by eluting the soluble fraction with the use of an eluate containing sodium fluoride, a Profinity eXact tag which was a prodomain of subtilisin protease was cut off, and a protein A which was an intended protein was eluted from the column. A lane 6 indicates a result of the eluted fraction containing the protein A. Here, the protein A thus obtained had, at its N end, a spacer sequence including 7 amino acid residues derived from pPAL7 and represented by SEQ ID NO: 78. As indicated by the lane 6 in (a) and (b) of Fig. 27, the obtained purified protein was detected as a substantially single band by both (i) fluorescence detection on all proteins by electrophoresis with the use of TGX Stain Free gel (Bio-Rad Laboratories, Inc.) ((a) of Fig. 27) and (ii) detection by transgenic-protein-specific Western blotting with the use of a Strep-tag II antibody ((b) of Fig. 27). From these, the obtained purified protein was confirmed to have been purified with high purity.

[0161] Moreover, as a control, a vector structure including an E. coli-derived GUS gene instead of the gene A was prepared. That is, as with the gene A, the E. coli-derived GUS gene was incorporated into pPAL7 so as to be expressed while a Profinity eXact tag is fused to its N end and a Strep-tag II tag is fused to its C end, and a transgenic protein was prepared with similar procedures. A GUS protein which was thus obtained and in which the Profinity eXact tag was cut off had, at the N end, a spacer sequence including 7 amino acid residues represented by SEQ ID NO: 78, as with the case of the protein A. The transgenic GUS protein obtained with the method was also confirmed, by gel electrophoresis and Western blotting, to have been purified with high purity (not illustrated), as with the case of the protein A.<Measurement of activity of E. coli expression protein A>

[0162] To solutions of the transgenic protein A and the transgenic GUS protein obtained above (each of which was 0.5 µg / µL), L-methionine (50 mM), pyridoxal phosphate, and IPyA (1 mM) were added and the mixture was reacted at 37°C for one hour in 50 mM of a potassium phosphate buffer (pH 8.5). Then, the reaction solution was purified by an OASIS HLB column, and analyzed with the use of LC / MS / MS. As a result, as shown in (c) of Fig. 27, it was clarified that the transgenic protein A had an activity to produce 9.7 ng of tryptophan per hour for each microgram by transamination from methionine to IPyA. On the other hand, in the control experiment in which the transgenic GUS protein was used instead of the transgenic protein A, an activity to produce tryptophan was not higher than a detection limit (N.D.) This strongly suggests that (i) production of tryptophan is dependent on the transgenic protein A and (ii) the spacer sequence at the N end and the Strep-tag II sequence at the C end are irrelevant to tryptophan synthesis activity in which IPyA included in the transgenic protein A is used as a ground substance, i.e., the spacer sequence at the N end and the Strep-tag II sequence at the C end do not influence the tryptophan synthesis activity.

[0163] In addition to the results described in (5. Measurement of activity of protein A encoded by gene A) of Example 1, the above results further proved that the protein A encoded by the gene A was an amino group transferase and had an activity to synthesize tryptophan while using, as a ground substance, IPyA which was a precursor of IAA. Moreover, in this case, it was shown that the protein A could at least catalyze transamination from methionine to IPyA.

[0164] Based on the above results, the following conclusions can be obtained:

[0165] Parthenocarpy of the eggplant line PCSS is caused by deletion mutation of the gene A. The gene A is a gene for encoding amino group transferase that synthesizes tryptophan while using, as a ground substance, IPyA which is a precursor of IAA. Here, the amino group transferase catalyzes reaction to synthesize tryptophan by transferring an amino group of amino acid into an indole pyruvic acid (IPyA). The gene A of the present invention can at least catalyze reaction to synthesize tryptophan by transferring an amino group of methionine into an indole pyruvic acid (IPyA). Further, expression is increased as an ovary of a bud before anthesis develops, and an amount of endogeny of IAA is notably increased due to deficiency of the function of the gene. From these, it seems that the gene A serves to inhibit the endogenous IAA content in the ovary to a certain amount or less. This deficiency of the function of the gene A causes increase in accumulation amount of IAA in the ovary around anthesis, and this increase in accumulation amount of IAA triggers parthenocarpy that is at a practical level in terms of agricultural production. The increase in endogenous IAA amount is not observed in a stem (internode) or at a shoot apex but is specifically observed in an ovary or an anther.

[0166] Further, as with eggplant, parthenocarpy can be induced in tomato by inhibiting, by RNAi induction, expression and a function of the tomato homologue gene tA that has 90% or higher of sequence identity of an amino acid sequence to the gene A. Moreover, as with eggplant and tomato, parthenocarpy can be induced in pepper by function deficient mutation caused by EMS treatment in the pepper homologue gene pA that has 90% or higher of sequence identity of an amino acid sequence to the gene A. Further, with regard to tomato and pepper, it has been found that, as with the case of eggplant, the amount of endogeny of IAA is notably increased by deficiency of the function of each of the tomato homologue gene tA and the pepper homologue gene pA. As such, it is concluded that the tomato gene tA and the pepper gene pA induce parthenocarpy by mechanisms similar to that of the eggplant gene A.Industrial Applicability

[0167] According to the present invention, it is possible to obtain a new cultivar plant having parthenocarpy. Moreover, the present invention can be used in fields such as agriculture and horticulture.[Accession number]

[0168] FERM BP-22257

Claims

1. A solanaceous plant or a progeny plant thereof, each of which is a parthenocarpic plant and in each of which (i) expression of a parthenocarpy regulatory gene, which comprises a polynucleotide recited in any of (1) through (4) below, is inhibited or (ii) the function of a polypeptide, which is encoded by the parthenocarpy regulatory gene, is decreased or defective, as compared to the respective wild type plant, wherein the function of the polypeptide refers to an activity (amino group transferase activity) for catalyzing a reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), and wherein in the amino acid sequence of the polypeptide, substitution, deletion, insertion, and / or addition of an amino acid occur(s) so as to cause the decrease or defect of the amino group transferase activity, (1) A polynucleotide that encodes a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (2) a polynucleotide that encodes a polypeptide (i) having a sequence identity of 75% or higher relative to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having the parthenocarpy regulatory activity, (3) a polynucleotide that encodes a polypeptide (i) having an amino acid sequence in which 1 to 98 amino acids are substituted in, deleted from, inserted into, and / or added to the amino acid sequence represented by SEQ ID NO: 1 and (ii) having the parthenocarpy regulatory activity, and (4) a polynucleotide that (i) is hybridized with a polynucleotide, which has a sequence complementary to the polynucleotide recited in the above (1), under a stringent condition and (ii) encodes a polypeptide having the parthenocarpy regulatory activity.

2. The solanaceous plant or the progeny plant thereof according to claim 1, wherein the expression of a parthenocarpy regulatory gene which comprises a polynucleotide recited in any of (1) through (4) above, is inhibited by a mutation on the expression adjusting sequence or the base sequence of the partenocarpy regulatory gene.

3. The plant according to claim 1 or 2, wherein: in the reaction to synthesize tryptophan by transferring an amino group of an amino acid to an indole pyruvic acid (IPyA), at least one amino acid whose amino group is to be transferred is methionine.

4. The plant according to any one of claims 1 to 3, wherein: the solanaceous plant is eggplant, tomato, or pepper.

5. The plant according to any one of claims 1 to 4, wherein said plant is a plant body, a part of the plant body, or a seed of the plant body.

6. The plant according to any one of claims 1 to 5, wherein the sequence identity relative to SEQ ID NO: 1 is 85% or higher.

7. The plant according to any one of claims 1 to 6, wherein the sequence identity relative to SEQ ID NO: 1 is 90% or higher.

8. The plant according to any one of claims 1 to 7, wherein in the amino acid sequence of the polypeptide, the substitution, deletion, insertion, and / or addition of an amino acid, which cause(s) decrease or a defect of the amino group transferase activity, result(s) from a termination codon at one of the amino acids at positions 42 or 43, and wherein the plant is pepper.