Polypeptide and fusion protein and use thereof

Abstract

Provided are a polypeptide and a fusion protein, as well as use thereof. Specifically, provided are a Transmembrane activator and CAML interactor （TACI） polypeptide comprising a wild-type TACI CRD2 (cysteine-rich domain 2) or a modification sequence thereof, and a fusion protein comprising said polypeptide. Also provided is use of the polypeptide and the fusion protein.

Description

POLYPEPTIDE AND FUSION PROTEIN AND USE THEREOFFIELD OF THE INVENTION

[0001] The present disclosure belongs to the field of biotechnology and particularly relates to a novel Transmembrane activator and CAML interactor polypeptide, and a fusion protein and use thereof.BACKGROUND

[0002] Transmembrane activator and CAML interactor (TACI) , also referred to as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) or CD276, is a member of the tumor necrosis factor (TNF) receptor superfamily. The human TACI protein is a 293 amino acid polypeptide comprising an extracellular region comprising has two cysteine-rich domains (CRD1, amino acid residues 33-67 and CRD2, amino acid residues 70-104) or ligand-binding, an intracellular region (amino acid residues 187-293) and a transmembrane region (amino acid residues 166-186) . TACI is expressed preferentially by mature B lymphocytes, with minimal expression on other types of tissues and cells. TACI plays important roles in B cell activation and differentiation

[0003] APRIL (a proliferation-inducing ligand) and BAFF (B-cell activation factor of the TNF family; also called BLyS or TALL-1) are two ligands of TACI, of which APRIL and BAFF have moderate affinity for TACI. BAFF has been recognized as a critical B cell survival factor without which maturation of B cells does not occur. Since B cells play an important role in autoimmune diseases, blocking BAFF with monoclonal antibodies have shown promising clinical benefit in treating SLE patients. APRIL can stimulate the production of IgA by B cells and inhibition of APRIL function by antibodies can slow progression of IgA nephropathy.

[0004] In addition to TACI, BAFF and APRIL also share another receptor: B-cell maturation antigen (BCMA or BCM) , also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17) . APRIL binds strongly to BCMA and moderately to TACI, whereas BAFF binds weakly to BCMA and strongly to TACI. Additionally, BAFF but not APRIL binds strongly to BAFF receptor (BAFFR; also known as TNFRSF13C) .

[0005] Strategies for the prevention or the treatment of B-cell mediated conditions, such as autoimmune diseases, include administration of molecules to interfere with the signaling of either ligand alone or both BAFF and APRIL. Molecules that reportedly modulate B cell function by interfering with BAFF and / or APRIL signaling include antibodies, such as the anti-BAFF antibody  and receptor extracellular domain-Fc domain fusion proteins, such as Atacicept, a TACI-Ig fusion protein with specificity for BAFF and APRIL. However, the efficacy and safety of existing molecules demonstrate the need for improved treatment options. For example, rheumatoid arthritis clinical trials showed that dual BAFF / APRIL inhibitor Atacicept provided no significant benefit over placebo.

[0006] Therefore, there is a need to identify and develop additional methods for treating cancers and / or immunomodulatory disorders which can provide efficacy without inducing severe side effects. The present invention satisfies this and other needs. The present disclosure novel TACI molecules capable of strongly blocking BAFF and APRIL binding to their receptors with improved potency compared to wild-type TACI.SUMMARY OF THE INVENTION

[0007] The present invention provides, inter alia, TACI CRD2 variants and fusion proteins thereof, methods of making the TACI CRD2 variants and / or fusion proteins thereof, and methods of using the TACI CRD2 variants and / or fusion proteins thereof, particularly for treating diseases such as cancers or autoimmune disorders. In some embodiments, the TACI CRD2 variants are used to treat cancers or autoimmune diseases. In some embodiments, the TACI CRD2 variant fusion proteins are used to treat cancers or autoimmune disorders.

[0008] In one aspect, the present invention provides a Transmembrane Activator and CAML Interactor (TACI) polypeptide, wherein the TACI polypeptide comprising a truncated wild-type cysteine rich domain 2 (CRD2) or a variant thereof, wherein CRD2 comprising the amino acid sequence of SEQ ID NO: 03 or 108, or is a variant thereof containing one or more amino acid substitution (s) , insertion (s) and / or deletion (s) in the amino acid sequence of SEQ ID NO: 03 or 108.

[0009] In some embodiments, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) and / or deletion (s) selected from the following positions: 5-9, 11-12, 14-43, with reference to the amino acid positions of SEQ ID NO: 03.

[0010] In some embodiments, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) and / or deletion (s) selected from the following positions: 5-9, 11-12, 14-44, with reference to the amino acid positions of SEQ ID NO: 03.

[0011] In some embodiments, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) and / or deletion (s) selected from the following positions: 5-8, 11, 14, 24, 30, 31, 35, 40-44, with reference to the amino acid positions of SEQ ID NO: 03;

[0012] In some embodiments, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) , and / or deletion (s) selected from the following positions: 5-8, 40-44, with reference to the amino acid positions of SEQ ID NO: 03;

[0013] In some embodiments, the CRD2 comprising:

[0014] (a) one or more amino acid deletion (s) selected from the following positions: 5-8, 40-43; preferably, any two amino acid deletion (s) selected from the following positions: 5-8 and any one amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0015] (b) one or more amino acid insertion (s) selected from the following positions: 30, 31, 44; and one or more amino acid deletion (s) selected from the following positions: 5-6, 43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0016] (c) one or more amino acid substitution (s) selected from the following positions: 11, 14, 24, 35,41, and one or more amino acid deletion (s) selected from the following positions: 5-8, 43, with reference to the amino acid positions of SEQ ID NO: 03.

[0017] In some embodiments, the CRD2 comprising:

[0018] (a) two amino acid deletion (s) of the following positions: 5-6 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0019] (b) two amino acid deletion (s) of the following positions: 6-7 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0020] (c) two amino acid deletion (s) of the following positions: 7-8 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03;

[0021] (d) two amino acid insertion (s) of the following positions: 30-31 and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; preferably, the two amino acid insertion (s) are 30T and 31P; or

[0022] (e) two amino acid deletion (s) of the following positions: 5-6 and one amino acid insertion of position 44 with reference to the amino acid positions of SEQ ID NO: 03; preferably, one amino acid insertion of position 44 is 44P; or

[0023] (f) one amino acid substitution of L16H, L15H, F11H, Y12F, H14Y, H14L, F11Y, D18H, S24D, S24V, Y35N or L41D, with reference to the amino acid positions of SEQ ID NO: 03; or

[0024] (g) one amino acid substitution of L16H, L15H, F11H, Y12F, H14Y, H14L, F11Y, D18H, S24D, S24V, Y35N or L41D, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0025] (h) two amino acid substitutions selected from the following groups: H14Yand D18H, H14Yand S24D, H14Yand S24V, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0026] (i) three amino acid substitutions of H14Y, Y35N and L41D, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or

[0027] (j) one amino acid substitution of F11Y, and three amino acid deletions of positions: 5, 6 and 43, with reference to the amino acid positions of SEQ ID NO: 03.

[0028] In some embodiments, the TACI polypeptide binds to BAFF and / or APRIL.

[0029] In some embodiments, the TACI polypeptide has improved binding affinity to one or both of BAFF and APRIL.

[0030] In some embodiments, the TACI polypeptide binds to both BAFF and APRIL of with a KD of less than 10-9M, preferably about 10-10M to about 10-12M;

[0031] In some embodiments, the TACI polypeptide binds to both BAFF and APRIL of with a KD of less than 10-10M, preferably about 10-11M to about 10-12M

[0032] In some embodiments, the CRD comprising the sequence of Formula I:

[0033] SLSCX1X2 X3X4 X5K X6 X7D X8 X9 X10R X11CISCA X12ICGQH X13 X14PKQCA X15FCENK X16RX17 (SEQ ID NO: 01) , wherein the X1-X17 are any amino acid.

[0034] In some embodiments, the CRD2 comprising the sequence of Formula III:

[0035] SLSCX1X2X3X4 X5K X6 X7D X8 X9 X10R X11CISCA X12ICGQH X13 X14PKQCA X15FCEN X16X17X18X19 X20 (SEQ ID NO: 71) , wherein the X1-X20 are any amino acid; in some preferred embodiments, X1 is R or is absent; X2 is K or is absent; X3 is E or is absent; X4 is Q or is absent; X5 is G or is absent; X6 is F, H or Y; X7 is F or Y; X8 is H, L or Y; X9 is H, L or P; X10 is H, L or S;X11 is D or H; X12 is S, D or V; X13 is T or is absent; X14 is P or is absent; X15 is Y, N or D; X16 is K or is absent; X17 is L, D or is absent; X18 is R or is absent; X19 is S or is absent; X20 is P or is absent.

[0036] In some embodiments, the CRD comprising the sequence of Formula II:

[0037] SLSCX1X2 X3X4 X5K X6 X7D X8 X9 X10R X11-Peptide A, wherein the X1-X11 are any amino acid, Peptide A comprising or consisting of the sequence of CIPCQLRCSSNTPPLTCQRYCNASVTNSVKG or the variant thereof.

[0038] In some embodiments, in Formula I, the X1-X17 are defined as below: X1 is R or is absent; X2 is K or is absent; X3 is E or is absent; X4 is Q or is absent; X5 is G or is absent; X6 is F, H or Y; X7 is F or Y; X8 is H, L or Y; X9 is H, L or P; X10 is H, L or S; X11 is D or H; X12 is S, D or V; X13 is T or is absent; X14 is P or is absent; X15 is Y, N or D; X16 is L or D; X17 is S or is absent; preferably, X17 is absent.

[0039] In some embodiments, in Formula II, the X1-X11 are defined as below: X1 is R or is absent; X2 is K or is absent; X3 is E or is absent; X4 is Q or is absent; X5 is G or is absent; X6 is F, H or Y; X7 is F or Y; X8 is H, L or Y; X9 is H, L or P; X10 is H, L or S; X11 is D or H.

[0040] In some embodiments, in Formula I, II and III, X1-X5 are defined as below:

[0041] (a) X1 is R, X2 is K, X3 is E, X4 is Q, X5 is G; or,

[0042] (b) X1 and X2 are absent, X3 is E, X4 is Q, X5 is G; or,

[0043] (c) X1 is R, X2 and X3 are absent, X4 is Q, X5 is G; or,

[0044] (d) X1 is R, X2 is K, X3 and X4 are absent, X5 is G; or,

[0045] (e) X1 is R, X2 is K, X3 is E, X4 and X5 are absent.

[0046] In some embodiments, the CRD comprising the sequence of Formula IV:

[0047] SLSCEQGKFYDHLLRDCISCASICGQHPKQCAYFCENX21X22X23X24X25 (SEQ ID NO:113) , wherein X21-X25 are any amino acid.

[0048] In some embodiments, X21-X25 are defined as below: X21 is K or absent; X22 is L or absent; X23 is R or absent; X24 is S or absent; X25 is P or absent;

[0049] In some embodiments, (a) X21 is K; X22 is L; X23-X25 are absent; (b) X21-X25 are absent; (c) X21 is K; X22 is L; X23 is R; X24 is S; X25 is P; (d) X21 is K; X22 is L; X23 is R; X24-X25 are absent; or (e) X21 is K; X22 is L; X23 is R; X24 is S; X25 is absent.

[0050] In some embodiments, the CRD comprise or consist of the amino acid sequence selected from SEQ ID NO: 62, 63, 64, 72, 07, 04-06, 08-24, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith; preferably, the CRD comprise or consist of the amino acid sequence selected from SEQ ID NO: 62 , 63, 64, 72, 07, 09, 21, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith.

[0051] In some embodiments, the TACI polypeptide is operably linked to Fc peptide.

[0052] In some embodiments, the Fc peptide is or is derived from an IgG1 Fc, an IgG2 Fc, an IgG3 Fc, or an IgG4 Fc.

[0053] In some embodiments, the Fc peptide is or is derived from a human IgG1 Fc, a human IgG2 Fc, a human IgG3 Fc, or a human IgG4 Fc.

[0054] In some embodiments, C terminal of the peptide variant is linked to the N terminal of the Fc peptide, or N terminal of the peptide variant is linked to the C terminal of the Fc peptide, or C terminal of the peptide variant is linked to the C terminal of the Fc peptide, or N terminal of the peptide variant is linked to the N terminal of the Fc peptide.

[0055] In some embodiments, the Fc peptide comprise or consist of the amino acid sequence set forth in SEQ ID NO: 81, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith.

[0056] In some embodiments, the TACI polypeptide is operably linked to an immunoglobulin by a linker.

[0057] In some embodiments, the TACI polypeptide is operably linked to the constant domain of the immunoglobulin.

[0058] In some embodiments, N terminal of the TACI polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or N terminal of the TACI polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin, or C terminal of the TACI polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or C terminal of the TACI polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin

[0059] In some embodiments, the immunoglobulin is an antibody inhibiting BDCA2, IFNAR1, IL23, IL17, IL12p40, TNFα, MASP2 or FcRn, or an antibody inhibiting the complement, preferably, the complement is selected from: C1, C5, C3, C7, C8, C9, MASP, DAF, C4, Factor B, Factor D, Factor P, Factor H.

[0060] In some embodiments, the immunoglobulin is an antibody inhibiting IFNAR1, IL23, or C5, optionally, the immunoglobulin is selected from Anifrolumab, Guselkumab, Eculizumab, Ravulizumab, Crovalimab, or BB5.1 (BHL006) .

[0061] In another aspect, the present invention provides a fusion protein comprising the abovementioned TACI polypeptide.

[0062] In some embodiments, the TACI polypeptide is operably linked to Fc peptide by a linker; in some preferred embodiments, the Fc peptide comprise or consist of the amino acid sequence set forth in SEQ ID NO: 81, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith.

[0063] In some embodiments, C terminal of the TACI polypeptide is linked to the N terminal of the Fc peptide, or N terminal of the TACI polypeptide is linked to the C terminal of the Fc peptide, or C terminal of TACI the polypeptide is linked to the C terminal of the Fc peptide, or N terminal of the TACI polypeptide is linked to the N terminal of the Fc peptide.

[0064] In some embodiments, the TACI polypeptide is operably linked to an immunoglobulin by a linker;

[0065] In some embodiments, the TACI polypeptide is operably linked to the constant domain of the immunoglobulin;

[0066] In some embodiments, N terminal of the TACI polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or N terminal of the TACI polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin, or C terminal of the TACI polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or C terminal of the TACI polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin.

[0067] In some embodiments, the linker is selected from the group of (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GSGSGSG) n, (GSGSGSGSG) n, (GSGSGSGSGSG) n, (GGGGGS) n, (GGGGGGS) n, (GGGGGGGS) n, (GGGGGGGGS) n, (GGGGGGGGGS) n, (GGGGGGGGGGS) n, (G) n, (GSA) n, (GGSA) n, (GGGSA) n, (GGGGSA) n, (GGGGGSA) n, (GGGGGGSA) n, (GGGGGGGSA) n, (GGGGGGGGSA) n, (GGGGGGGGGSA) n, (GGGGGGGGGGSA) n, (GA) n, (GGA) n, (GGGA) n, (GGGGA) n, (GGGGGA) n, (GGGGGGA) n, (GGGGGGGA) n, (GGGGGGGGA) n, (GGGGGGGGGA) n, (GGGGGGGGGGA) n, n is an integer of 1-10, preferably, n is an integer of 1-5.

[0068] In some embodiments, the immunoglobulin is an antibody inhibiting BDCA2, IFNAR1, IL23, IL17, IL12p40, TNFα, MASP2 or FcRn, or an antibody inhibiting the complement, preferably, the complement is selected from: C1, C5, C3, C7, C8, C9, MASP, DAF, C4, Factor B, Factor D, Factor P, factor H.

[0069] In some embodiments, the fusion protein comprising a first TACI polypeptide comprise or consist of the amino acid sequence selected from SEQ ID NO: 62, 63, 64, 72, 07, 04-06, 08-24, and a second TACI polypeptide comprise or consist of the amino acid sequence selected from SEQ ID NO: 62, 63, 64, 72, 07, 04-06, 08-24; optionally, the first TACI polypeptide and the second TACI polypeptide are the same or different; in some preferred embodiments, the first TACI polypeptide and the second TACI polypeptide are the same

[0070] In some embodiments, the immunoglobulin is an antibody inhibiting IFNAR1, IL23, or C5.

[0071] In some embodiments, the immunoglobulin is selected from Anifrolumab, Guselkumab, Eculizumab, Ravulizumab, Crovalimab, or BB5.1 (BHL006) .

[0072] In some embodiments, the antibody comprises heavy chain variable region (VH) and light chain variable region (VL) , wherein:

[0073] the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO:29, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 31, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 33; and

[0074] and

[0075] the VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO:30, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 32, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 34; or,

[0076] the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO:82, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 84, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 86; and

[0077] and

[0078] the VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO:83, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 85, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 87;

[0079] or,

[0080] the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO:88, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 90, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 92; and

[0081] and

[0082] the VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO:89, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 91, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 93.

[0083] In some embodiments, the VH comprises an amino acid sequence as shown in SEQ ID NO: 25; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 26; or,

[0084] the VH comprises an amino acid sequence as shown in SEQ ID NO: 73; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 74;

[0085] or,

[0086] the VH comprises an amino acid sequence as shown in SEQ ID NO: 77; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 78.

[0087] In some embodiments, the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 27, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 28; or,

[0088] the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 75, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 76;

[0089] or,

[0090] the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 79, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 80.

[0091] In some embodiments, the fusion protein comprising of consisting of any one of the following:

[0092] a) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 65, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0093] b) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 96, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0094] c) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 101, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0095] d) the amino acid sequence set forth in SEQ ID NO: 105, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0096] e) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 35, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0097] f) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 36, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0098] g) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 37, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0099] h) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 38, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0100] i) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 39, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0101] j) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 40, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0102] k) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 41, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0103] l) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 42, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0104] m) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 43, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0105] n) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 44, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0106] o) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 45, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0107] p) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 46, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0108] q) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 47, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0109] r) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 48, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0110] s) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 49, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0111] t) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 50, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0112] u) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 51, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0113] v) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 52, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0114] w) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 53, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0115] x) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 54, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0116] y) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 55, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0117] z) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 56, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0118] a1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 66, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0119] b1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 67, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0120] c1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 68, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0121] d1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 94, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0122] e1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 97, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0123] f1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 99, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0124] g1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 99, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0125] h1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 102, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0126] i1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 103, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0127] j1) the amino acid sequence set forth in SEQ ID NO: 104, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0128] k1) the amino acid sequence set forth in SEQ ID NO: 106, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;

[0129] l1) the amino acid sequence set forth in SEQ ID NO: 107, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith..

[0130] In another aspect, the present invention provides an isolated polynucleotide or set of isolated polynucleotides comprising at least one sequence that encodes the abovementioned TACI polypeptide, or the abovementioned fusion protein.

[0131] In another aspect, the present invention provides a vector or set of vectors comprising one or more of the abovementioned polynucleotides or sets of polynucleotides

[0132] In another aspect, the present invention provides an isolated cell comprising the abovementioned polynucleotide or set of polynucleotides, or the abovementioned vector or set of vectors.

[0133] In some embodiments, the cell is a yeast cell, a bacterial cell, a hybridoma, a Chinese Hamster Ovary (CHO) cell, or a HEK293 cell.

[0134] In another aspect, the present invention provides a method of producing the abovementioned fusion protein, comprising:

[0135] (a) culturing the abovementioned cell in conditions under which the fusion protein is expressed; and

[0136] (b) recovering the fusion protein from the cell culture; and, optionally further comprising enriching for the fusion protein and / or purifying the fusion protein.

[0137] In another aspect, the present invention provides a pharmaceutical composition comprising the abovementioned TACI polypeptide, or the abovementioned fusion protein, and a pharmaceutically acceptable carrier.

[0138] In another aspect, the present invention provides a use of the abovementioned TACI polypeptide, or the abovementioned fusion protein, or the abovementioned pharmaceutical composition for the treatment of a disease or disorder in a subject or in the manufacture of a medicine.

[0139] In some embodiments, the disease or disorder is autoimmune diseases, Preferably, the disease is selected from IgA nephropathy, IgM polyneuropathy, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SLE) , lupus nephritis (LN) , Wegener's disease, inflammatory bowel disease, idiopathic thrombocytopenia Purpura (ITP) , thrombotic thrombocytopenic purpura (TTP) , autoimmune thrombocytopenia, multiple sclerosis, psoriasis, myasthenia gravis, vasculitis, diabetes, Reynauld's syndrome, Sjorgen's syndrome, glomerulonephritis, autoimmune hepatitis, autoimmune encephalomyelitis, and autoimmune thyroiditis, Membranous Nephropathy, Generalized Myasthenia Gravis, Neuromyelitis optica spectrum disorder, Acute Antibody Mediated Rejection, Chronic Antibody Mediated Rejection 72 primary Sjogren’s syndrome, Autoimmune Hemolytic Anemia, Antiphospholipid Syndrome, IgA Vasculitis, Rheumatoid Vasculitis, Anti-Synthetase Syndrome, Primary Membranous Nephropathy, Juvenile Idiopathic Arthritis (JIA) , Systemic Sclerosis, Guillain-Barre Syndrome, Autoimmune Pulmonary Alveolar Proteinosis, Hemolytic Disease Of The Fetus And Newborn (HDFN) , Acute Hemolytic Transfusion Reaction, Preventative Treatment with Adeno-Associated Virus (AAV) , Thyroid Eye Disease (TED) , Huntington’s Disease, Chronic Inflammatory Demyelinating Polyneuropathy (CIDP) , Pemphigus Vulgaris (PV) , Bullous Pemphigoid (BP) , Immune Thrombocytopenic Purpura (ITP) ; more preferably, the disease is IgA nephropathy.

[0140] In another aspect, the present invention provides a method of treatment of a subject having a disease or disorder comprising administering to the subject the abovementioned TACI polypeptide, or the abovementioned fusion protein, or the abovementioned pharmaceutical composition.

[0141] In some embodiments, the disease or disorder is autoimmune diseases, Preferably, the disease is selected from IgA nephropathy, IgM polyneuropathy, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SLE) , lupus nephritis (LN) , Wegener's disease, inflammatory bowel disease, idiopathic thrombocytopenia Purpura (ITP) , thrombotic thrombocytopenic purpura (TTP) , autoimmune thrombocytopenia, multiple sclerosis, psoriasis, myasthenia gravis, vasculitis, diabetes, Reynauld's syndrome, Sjorgen's syndrome, glomerulonephritis, autoimmune hepatitis, autoimmune encephalomyelitis, and autoimmune thyroiditis, Membranous Nephropathy, Generalized Myasthenia Gravis, Neuromyelitis optica spectrum disorder, Acute Antibody Mediated Rejection, Chronic Antibody Mediated Rejection 72 primary Sjogren’s syndrome, Autoimmune Hemolytic Anemia, Antiphospholipid Syndrome, IgA Vasculitis, Rheumatoid Vasculitis, Anti-Synthetase Syndrome, Primary Membranous Nephropathy, Juvenile Idiopathic Arthritis (JIA) , Systemic Sclerosis, Guillain-Barre Syndrome, Autoimmune Pulmonary Alveolar Proteinosis, Hemolytic Disease Of The Fetus And Newborn (HDFN) , Acute Hemolytic Transfusion Reaction, Preventative Treatment with Adeno-Associated Virus (AAV) , Thyroid Eye Disease (TED) , Huntington’s Disease, Chronic Inflammatory Demyelinating Polyneuropathy (CIDP) , Pemphigus Vulgaris (PV) , Bullous Pemphigoid (BP) , Immune Thrombocytopenic Purpura (ITP) ; more preferably, the disease is IgA nephropathy.

[0142] The obtained TACI polypeptides and the fusion proteins have a series of excellent characteristics:

[0143] Advantageous Effects of the Invention:

[0144] Compared with the prior art, the technical solutions of the invention have the following beneficial effects:

[0145] (1) Novel TACI polypeptides were identified in the present invention and these mutants can potently inhibit both BAFF and ARIL function. The inhibitory effects on BAFF mediated by molecules TACI CRD2-Mab 23-38 / 05 are stronger than TACI CRD2-Mab with the wild type TACI CRD2.

[0146] (2) Monoclonal antibody Belimumab can block BAFF function and has been approved for the treatment of SLE. Monoclonal antibodies targeting APRIL, such as Zigakibart are in clinical development for the treatment of IgA Nephropathy. Although these drugs are beneficial, they can only target either BAFF or APRIL. TACI CRD2-Mab 23-38 / 05 have dual BAFF and APRIL blocking activities; therefore, they have broader inhibition effect than Belimumab and Zigarkibart. Treatment of TACI CRD2-Mab 23-38 / 05 may lead to better clinical outcome in autoimmune patients than the reagents that can only target either BAFF or APRIL.BRIEF DESCRIPTION OF THE DRAWINGS

[0147] Figures 1A-1B: The schematic drawing depicting an antibody-TACI CRD2 fusion protein construct (A) and an Fc-TACI CRD2 fusion protein construct (B) .

[0148] Figures 2A-2D: Result of activity of TACI CRD2 wild type and variants fusion proteins in the form of anti-C5xTACI CRD2 bispecific antibodies in blocking BAFF binding to BAFFR, in comparison to Belimumab (anti-BAFF) .

[0149] Figures 3A-3C: Result of TACI CRD2 wild type and variants fusion proteins in the form of anti-C5xTACI CRD2 bispecific antibodies block APRIL binding to BCMA.

[0150] Figure 4: Result of activity of TACI CRD2-Mab 1 / 5 / 7 in inhibiting BAFF stimulation of TACI reporter cells, comparing to Belimumab (anti-BAFF) .

[0151] Figure 5: Result of activity of TACI CRD2-Mab 1 / 5 / 7 in inhibiting BAFF stimulation of BCMA reporter cells, comparing to Zigakibart (anti-APRIL) .

[0152] Figures 6A-6B: Result of activity of TACI CRD2-Mab 1 / 5 in vivo activity to block mice spleen B cells proliferation comparing to Povetacicept (TACI-Fc) .

[0153] Figures 7A-7B: Result of activity of TACI CRD2-Mab 1 / 5 in vivo activity to block mice blood B cells proliferation comparing to Povetacicept (TACI-Fc) .

[0154] Figures 8A-8C: Results of TACI CRD2-Mab 1 / 5 in vivo activity to inhibit mice circulating IgA, IgM and IgG comparing to Povetacicept (TACI-Fc) .

[0155] Figure 9: Result of activity of TACI CRD2-Mab 23 / 28 / 32 / 36 in blocking BAFF binding to BAFFR, comparing to Telitacicept (TACI-Fc) and Atacicept (TACI-Fc) .

[0156] Figures 10A-10C: Results of TACI CRD2-Mab 5 in vivo activity to inhibit CIA mice circulating IgA (A) , IgM (B) and IgG (C) comparing to Povetacicept and Telitacicept.DETAILED DESCRIPTION

[0157] DEFINITIONS

[0158] DEFINITIONS OF TERMS

[0159] To facilitate the understanding of the present disclosure, some technical and scientific terms are described below. Unless otherwise specifically defined herein, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art.

[0160] As used in the description and in the claims, the singular forms of "a" , "an" , and "the" include plural referents unless otherwise clearly indicated in the context.

[0161] Unless otherwise clearly stated in the context, throughout the description and the claims, the words "comprise" , "have" , "include" , and the like, should be construed in an inclusive sense as opposed to an exclusive or exhaustive sense.

[0162] TACI described herein is a membrane-bound receptor, and the wild-type human TACI comprises an extracellular region comprising two cysteine-rich domains, a transmembrane region, and an intracellular region. The wild-type human TACI CRD2 are set forth in SEQ ID NO: 03.

[0163] "TACI extracellular domain" and "TACI extracellular region" herein are used interchangeably.

[0164] The term "and / or" is intended to include two meanings, "and" and "or" . For example, the phrase "A, B, and / or C" is intended to encompass each of the following: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone) ; B (alone) ; and C (alone) .

[0165] The three-letter and single-letter codes for amino acids used herein are as described in J. biol. chem, 243, p3558 (1968) .

[0166] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by genetic codes and those amino acids later modified, e.g., hydroxyproline, γ-carboxyglutamic acid, and O-phosphoserine. Amino acid analogs refer to compounds that have a substantially identical chemical structure (i.e., an α carbon that binds to hydrogen, carboxyl, amino, and an R group) to naturally occurring amino acids, e.g., homoserine, norleucine, methionine sulfoxide, and methioninemethyl sulfonium. Such analogs have a modified R group (e.g., norleucine) or a modified peptide skeleton, but retain a substantially identical chemical structure to naturally occurring amino acids. Amino acid mimics refer to chemical compounds that have a structure different from the general chemical structure of amino acids, but function in a manner similar to naturally occurring amino acids.

[0167] The term "amino acid mutation" includes amino acid substitutions (also known as amino acid replacements) , deletions, insertions, and modifications. Any combination of substitutions, deletions, insertions, and modifications can be made to obtain a final construct, as long as the final construct possesses the desired properties, such as reduced binding to the Fc receptor. Amino acid sequence deletions and insertions include deletions and insertions at the amino terminus and / or the carboxyl terminus of a polypeptide chain. Specific amino acid mutations may be amino acid substitutions. In one embodiment, the amino acid mutation is a non-conservative amino acid substitution, i.e., replacement of one amino acid with another amino acid having different structural and / or chemical properties. Amino acid substitutions include replacement with non-naturally occurring amino acids or with derivatives of the 20 native amino acids (e.g., 4-hydroxyproline, 3-methylhistidine, ornithine, homoserine, and 5-hydroxylysine) . Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis, and the like. It is contemplated that methods for altering amino acid side chain groups other than genetic engineering, such as chemical modification, may also be used. Various expressions may be used herein to indicate the same amino acid mutation. Herein, the expression of "position + amino acid residue" may be used to denote an amino acid residue at a specific position. For example, 366W indicates that an amino acid residue at position 366 is W. T366W indicates that an amino acid residue at position 366 is mutated from the original T to W.

[0168] The term "antibody" is used in the broadest sense and encompasses a variety of antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies; monospecific antibodies, multispecific antibodies (e.g., bispecific antibodies) ; and full-length antibodies, and antibody fragments (or antigen-binding fragments, or antigen-binding moieties) so long as they exhibit the desired antigen-binding activity. "Native antibody" refers to a naturally occurring immunoglobulin molecule. For example, a native IgG antibody is a heterotetrameric glycoprotein of about 150,000 Daltons composed of two identical light chains and two identical heavy chains linked by a disulfide bond. From the N-terminus to the C-terminus, each heavy chain has one variable region (VH) , also known as variable heavy domain or heavy chain variable region, followed by heavy chain constant regions. Generally, a native IgG heavy chain constant region comprises three constant domains (CH1, CH2, and CH3) . Similarly, from the N-terminus to the C-terminus, each light chain has one variable region (VL) , also known as variable light domain or light chain variable domain, followed by one constant light domain (light chain constant region, CL) . The term "full-length antibody" , "intact antibody" , and "whole antibody" are used herein interchangeably and refer to an antibody having a substantially similar structure to a native antibody structure or having heavy chains in an Fc region as defined herein. In a native intact antibody, the light chain comprises light chain variable region VL and constant region CL, the VL being positioned at the amino terminus of the light chain, and the light chain constant region comprises a κ chain and a λ chain; the heavy chain comprises a variable region VH and constant regions (CH1, CH2, and CH3) , the VH being positioned at the amino terminus of the heavy chain, and the constant regions being positioned at the carboxyl terminus, wherein CH3 is closest to the carboxyl terminus of the polypeptide, and the heavy chain can be of any isotype, including IgG (including subtypes IgG1, IgG2, IgG3, and IgG4) , IgA (including subtypes IgA1 and IgA2) , IgM, and IgE.

[0169] The term antibody "variable region" or "variable domain" refers to a domain in the heavy or light chain of an antibody that is involved in the binding of the antibody to an antigen. Herein, the heavy chain variable region (VH) and light chain variable region (VL) of the antibody each comprise four conserved framework regions (FRs) and three complementarity determining regions (CDRs) . The term "complementarity determining region" or "CDR" refers to a region in the variable domain that primarily contributes to antigen binding; "framework" or "FR" refers to variable domain residues other than CDR residues. A VH comprises 3 CDR regions: HCDR1, HCDR2, and HCDR3; a VL comprises 3 CDR regions: LCDR1, LCDR2, and LCDR3. Each VH and VL is composed of three CDRs and four FRs arranged from the amino terminus (also known as N-terminus) to the carboxyl terminus (also known as C-terminus) in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.

[0170] The amino acid sequence boundaries of the CDRs can be determined by a variety of well-known schemes, for example, the "Kabat" numbering scheme (see Kabat et al. (1991) , "Sequences of Proteins of Immunological Interest" , 5thed., Public Health Service, National Institutes of Health, Bethesda, MD) , the "Chothia" numbering scheme, the "ABM" numbering scheme, the "contact" numbering scheme (see Martin, ACR. Protein Sequence and Structure Analysis of Antibody Variable Domains [J] . 2001) , and the ImMunoGenTics (IMGT) numbering scheme (Lefranc, M. P. et al., Dev. Comp. Immunol., 27, 55-77 (2003) ; Front Immunol. 2018 Oct 16; 9: 2278) , and the like. The corresponding relationships among the various numbering schemes are well known to those skilled in the art and are exemplary, as shown in Table A below.

[0171] Table A. Relationships among CDR numbering schemes

[0172] Unless otherwise stated, the "Kabat" numbering scheme is applied to the sequences of the variable regions and CDRs herein.

[0173] The term "antibody fragment" refers to a molecule different from an intact antibody, which comprises a moiety of an intact antibody that binds to an antigen to which the intact antibody binds. Examples of antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F (ab') 2 , single-domain antibodies, single-chain Fab (scFab) , diabodies, linear antibodies, single-chain antibody molecules (e.g., scFv) , and multispecific antibodies formed from antibody fragments.

[0174] The term "Fc region" or "fragment crystallizable region" is used to define the C-terminal region of the heavy chain of an antibody, including native Fc regions and modified Fc regions. In some embodiments, the Fc region comprises two subunits, which may be identical or different. In some embodiments, the Fc region of the human IgG heavy chain is defined as extending from the amino acid residue at position Cys226 or from Pro230 to its carboxyl terminus. Suitable Fc regions used for the antibodies described herein include Fc regions of human IgG1, IgG2 (IgG2A and IgG2B) , IgG3, and IgG4. In some embodiments, the boundaries of the Fc region may also be varied, for example, by deleting the C-terminal lysine of the Fc region (residue 447 according to the EU numbering scheme) or deleting the C-terminal glycine and lysine of the Fc region (residues 446 and 447 according to the EU numbering scheme) . Unless otherwise stated, the numbering scheme for the Fc region is the EU numbering scheme, also known as the EU index.

[0175] The term "chimeric antibody" refers to an antibody in which a portion of the heavy and / or light chain in the antibody is derived from a particular source or species, while the remainder of the heavy and / or light chain is derived from another different source or species.

[0176] The term "humanized antibody" is an antibody that retains the reactivity of a non-human antibody while having low immunogenicity in humans. For example, this can be achieved by retaining the non-human CDR regions and replacing the remainder of the antibody with its human counterparts (i.e., the constant regions and the framework region portion of the variable regions) .

[0177] The terms "human antibody" , "humanized antibody" , "fully human antibody" , and "complete human antibody" are used interchangeably and refer to antibodies in which the variable and constant regions are human sequences. The term encompasses antibodies that are derived from human genes but have, for example, sequences that have been altered to, e.g., reduce possible immunogenicity, increase affinity, eliminate cysteines that may cause undesired folding, or generate glycosylation sites. The term encompasses antibodies recombinantly produced in non-human cells that may confer glycosylation not characteristic of human cells. The term also encompasses antibodies that have been cultured in transgenic mice comprising some or all of the human immunoglobulin heavy and light chain loci. The meaning of the human antibody specifically excludes humanized antibodies comprising non-human antigen-binding residues.

[0178] The term "affinity" refers to the overall strength of a non-covalent interaction between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen) . Unless otherwise indicated, as used herein, binding "affinity" refers to an internal binding affinity that reflects a 1: 1 interaction between members of a binding pair (e.g., an antibody and an antigen) . The affinity of a molecule X for its ligand Y can be generally denoted by the dissociation constant (K D ) . Affinity can be determined by conventional methods known in the art, including those described herein.

[0179] The term "capable of specifically binding" , "specifically binding" , or "binding" means that an antibody is capable of binding to a certain antigen or an epitope thereof with higher affinity than to other antigens or epitopes. Generally, an antibody binds to an antigen or epitope thereof with an equilibrium dissociation constant (KD) of about 1×10-7 M or less (e.g., about 1×10-8 M or less) . In some embodiments, the KD for the binding of an antibody to an antigen is 10%or less (e.g., 1%) of the KD for the binding of the antibody to a non-specific antigen (e.g., BSA or casein) . KD may be determined using known methods, for example, by a  surface plasmon resonance assay. However, an antibody that specifically binds to an antigen or an epitope thereof may have cross-reactivity to other related antigens, e.g. to corresponding antigens from other species (homologous) , such as humans or monkeys, e.g., Macaca fascicularis (cynomolgus, cyno) , Pan troglodytes (chimpanzee, chimp) , or Callithrix jacchus (commonmarmoset, marmoset) .

[0180] The term "linker" refers to a linker unit that links two polypeptide fragments, and generally has some flexibility, such that the use of the linker does not result in the loss of the original function of the protein domain. Herein, the linkers present in the same structure may be identical or different. The linker may be a peptide linker comprising one or more amino acids, typically about 1 to 30, 2 to 24, or 3 to 15 amino acids. The linkers used herein may be identical or different.

[0181] The term "nucleic acid" is used interchangeably herein with the term "polynucleotide" and refers to deoxyribonucleotide or ribonucleotide and a polymer thereof in either single-stranded or double-stranded form. The term encompasses nucleic acids comprising known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, have similar binding properties to the reference nucleic acid, and are metabolized in a manner similar to the reference nucleotide. Examples of such analogs include, but are not limited to, phosphorothioate, phosphoramidate, methylphosphonate, chiral-methylphosphonate, 2-O-methyl ribonucleotide, and peptide-nucleic acid (PNA) .

[0182] "Isolated" nucleic acid refers to a nucleic acid molecule that has been separated from components of its natural environment. The isolated nucleic acid includes a nucleic acid molecule comprised in a cell that generally comprises the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal position different from its natural chromosomal position. An isolated nucleic acid encoding a polypeptide or a fusion protein refers to one or more nucleic acid molecules encoding the polypeptide or fusion protein, including such one or more nucleic acid molecules in a single vector or separate vectors, and such one or more nucleic acid molecules present at one or more positions in a host cell. Unless otherwise stated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, as detailed below, degenerate codon substitutions may be obtained by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed bases and / or deoxyinosine residues.

[0183] The terms "peptide" , "polypeptide" and "protein" are used interchangeably herein and refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residues are corresponding naturally occurring amino acids or artificial chemical mimics thereof, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. Unless otherwise stated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.

[0184] The term sequence "identity" refers to the degree (percentage) to which the amino acids / nucleic acids of two sequences are identical at equivalent positions, when the two sequences are optimally aligned, with gaps introduced as necessary to achieve the maximum percent sequence identity, and without considering any conservative substitutions as part of the sequence identity. To determine percent sequence identity, alignments can be accomplished by techniques known to those skilled in the art, for example, using publicly available computer software, such as BLAST, BLAST-2, ALIGN, ALIGN-2, or Megalign (DNASTAR) software. Those skilled in the art can determine parameters suitable for measuring alignment, including any algorithms required to achieve maximum alignment of the full length of the aligned sequences.

[0185] The term "fusion" or "linkage" means that components (e.g., TACI CRD2 polypeptide and Fc domain / therapeutic antibody) are linked by a covalent bond, either directly or via one or more linkers. When the linker is a peptide linker, the covalent bond is a peptide bond.

[0186] The term "vector" means a polynucleotide molecule capable of transporting another polynucleotide linked thereto. One type of vector is a "plasmid" , which refers to a circular double-stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, such as an adeno-associated viral vector (AAV or AAV2) , wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors) . Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. The term "expression vector" or "expression construct" refers to a vector that can be transformed into a host cell and comprises a nucleic acid sequence that directs and / or controls (along with the host cell) the expression of one or more heterologous coding regions operably linked thereto. Expression constructs may include, but are not limited to, sequences that affect or control transcription and translation and affect RNA splicing of a coding region operably linked thereto in the presence of intron.

[0187] The terms "host cell" , "host cell line" , and "host cell culture" are used interchangeably and refer to cells into which exogenous nucleic acids have been introduced, including progenies of such cells. Host cells include "transformants" and "transformed cells" , which include primary transformed cells and progenies derived therefrom, regardless of the number of passages. Progeny may not be exactly the same as parent cells in terms of nucleic acid content and may contain mutations. Mutant progenies that have the same function or biological activity as the cells screened or selected from the initially transformed cells are included herein. Host cells include prokaryotic and eukaryotic host cells, wherein eukaryotic host cells include, but are not limited to, mammalian cells, insect cell lines, plant cells, and fungal cells.

[0188] "Optional" or "optionally" means that the event or circumstance subsequently described may, but not necessarily, occur, and that the description includes instances where the event or circumstance occurs or does not occur.

[0189] The term "pharmaceutical composition" refers to a mixture comprising one or more of the polypeptides or TACI CRD2 fusion proteins described herein and other chemical components, for example, physiological / pharmaceutically acceptable carriers and excipients.

[0190] The term "pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical formulation that is different from the active ingredient and is not toxic to the subject. Pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers, or preservatives.

[0191] The term "subject" or "individual" includes both human and non-human animals. Non-human animals include all vertebrates (e.g., mammals and non-mammals) such as non-human primates (e.g., cynomolgus monkeys) , sheep, dogs, cows, chickens, amphibians, and reptiles. Unless indicated, the terms "patient" and "subject" are used interchangeably herein. As used herein, the term "cynomolgus monkey (cyno) " or "cynomolgus" refers to Macaca fascicularis. In certain embodiments, the individual or subject is a human.

[0192] "Administrating" or "giving" , when applied to animals, humans, experimental subjects, cells, tissue, organs, or biological fluids, refer to contact of an exogenous drug, a therapeutic agent, a diagnostic agent, or a composition with the animals, humans, subjects, cells, tissue, organs, or biological fluids.

[0193] The term "sample" refers to a collection of fluids, cells, or tissue isolated from a subject, as well as fluids, cells, or tissue present in a subject. Exemplary samples are biological fluids (such as blood; serum; serosal fluids; plasma; lymph; urine; saliva; cystic fluids; tears; excretions; sputum; mucosal secretions of secretory tissue and organs; vaginal secretions; ascites; fluids in the pleura; pericardium; peritoneum; abdominal cavity and other body cavities; fluids collected from bronchial lavage; synovial fluids; liquid solutions in contact with a subject or biological source, e.g., cell and organ culture media (including cell or organ conditioned media) ; lavage fluids; and the like) , tissue biopsy samples, fine needle punctures, surgically excised tissues, organ cultures, or cell cultures.

[0194] "Treatment" or "treat" (and grammatical variations thereof) refer to clinical intervention in an attempt to alter the natural course of the treated individual, which may be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of the treatment include, but are not limited to, preventing the occurrence or recurrence of a disease, alleviating symptoms, alleviating / reducing any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, ameliorating or alleviating the disease state, and regressing or improving prognosis. In some embodiments, the polypeptide or fusion protein of the present disclosure is used to delay the development of or slow the progression of a disease.

[0195] "Effective amount" is generally an amount sufficient to reduce the severity and / or frequency of symptoms, eliminate symptoms and / or underlying causes, prevent the appearance of symptoms and / or their underlying causes, and / or ameliorate or improve damage caused by or associated with a disease state. In some embodiments, the effective amount is a therapeutically effective amount or a prophylactically effective amount. "Therapeutically effective amount" is an amount sufficient to treat a disease state or condition, particularly a state or condition associated with the disease state, or to otherwise prevent, hinder, delay, or reverse the progression of the disease state or any other undesirable symptoms associated with the disease in any way. "Prophylactically effective amount" is an amount that, when administered to a subject, will have a predetermined prophylactic effect, e.g., preventing or delaying the onset (or recurrence) of the disease state, or reducing the likelihood of the onset (or recurrence) of the disease state or associated symptoms. A complete therapeutic or prophylactic effect does not necessarily occur after administration of one dose and may occur after administration of a series of doses. Thus, a therapeutically or prophylactically effective amount may be administered in one or more doses. "Therapeutically effective amount" and "prophylactically effective amount" may vary depending on a variety of factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic agent or combination of therapeutic agents to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic agent or combination of therapeutic agents include, for example, improved health condition of a patient.

[0196] The polypeptide or fusion protein provided herein can be identified, screened, or characterized for their physical / chemical characteristics and / or biological activities by a variety of assays known in the art. In one aspect, the polypeptide or fusion protein of the present disclosure is tested for activity, e.g., by known methods such as ELISA, western blot, and the like.

[0197] Any of the TACI CRD2 polypeptides or fusion proteins thereof (e.g., antibody fusion proteins) provided herein can be used in the treatment method. In yet another aspect, the present disclosure provides use of the TACI CRD2 polypeptide or the fusion protein thereof in the manufacture or preparation of a medicament. In some embodiments, the B cell disorder or the autoimmune disease is a disease or condition associated with TACI CRD2 expression. In some embodiments, the autoimmune disease is selected from the group consisting of: systemic lupus erythematosus, myasthenia gravis, multiple sclerosis, insulin-dependent diabetes mellitus, Crohn's disease, rheumatoid arthritis, polyarticular juvenile rheumatoid arthritis, and psoriatic arthritis; the B cell disorder is selected from the group consisting of: tumors, chronic leukocytic leukemia, multiple myeloma, non-Hodgkin's lymphoma, post-transplant lymphoproliferative disorder, and light chain gammopathy.

[0198] In yet another aspect, provided is a pharmaceutical composition comprising the polypeptide or fusion protein, e.g., for any of the above pharmaceutical uses or treatment methods. In one embodiment, the pharmaceutical composition comprises any of the polypeptides or fusion proteins provided herein and a pharmaceutically acceptable carrier. In another embodiment, the pharmaceutical composition further comprises at least one additional therapeutic agent.

[0199] The polypeptides or fusion proteins of the present disclosure can be used alone or in combination with additional agents for the treatment. For example, the antibody of the present disclosure can be co-administered with at least one additional therapeutic agent. The polypeptides or fusion proteins of the present disclosure (and any additional therapeutic agents) may be administered by any suitable means, including parenteral, intrapulmonary, and intranasal administration, and if required by local treatment, intralesional administration. Parenteral infusion includes intramuscular, intravenous, intra-arterial, intraperitoneal, or subcutaneous administration. Administration may be performed by any suitable route, e.g., by injection, such as intravenous or subcutaneous injection, depending in part on whether the administration is short-term or long-term. Various administration schedules are contemplated herein, including but not limited to, single administration or multiple administrations at multiple time points, bolus administration. In another aspect of the present disclosure, provided is an article of manufacture, which comprises materials useful for the treatment, prevention, and / or diagnosis of the above condition. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, and the like. The container may be formed from a variety of materials such as glass or plastic. The container contains a composition effective in the treatment, prevention, and / or diagnosis of a disease, either alone or in combination with another composition, and may have a sterile access port (e.g., the container may be an intravenous solution bag or vial with a stopper pierceable by a hypodermic injection needle) . At least one active agent in the composition is the TACI CRD2 polypeptide or fusion protein of the present disclosure. The label or package insert indicates that the composition is to be used to treat the selected condition. Further, the article of manufacture may comprise: (a) a first container containing a composition, wherein the composition comprises the TACI CRD2 polypeptide or fusion protein of the present disclosure; and (b) a second container containing a composition, wherein the composition comprises other cytotoxic agents or additional therapeutic agents. The article of manufacture in this embodiment of the present disclosure may further comprise a package insert indicating that the composition may be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container containing a pharmaceutically acceptable buffer. From a commercial and user standpoint, it may further contain other materials as required, including other buffers, diluents, filters, needles, and syringes. nd pulse infusion.

[0200] EXAMPLE

[0201] The present disclosure is further described below with reference to the following examples and test examples, which, however, do not limit the present disclosure. The experimental methods in the examples and test examples of the present disclosure in which specific conditions are not specified are generally performed under conventional conditions such as Antibodies: A Laboratory Manual and Molecular Cloning: A Laboratory Manual by Cold Spring Harbor Laboratory, or under conditions recommended by the manufacturers of the starting materials or commercial products. Reagents without specific origins indicated are commercially available conventional reagents.

[0202] The room temperature described in the examples is a conventional room temperature in the art, and is generally 10-30℃.

[0203] Example 1: TACI CRD2 sequence analysis and engineering

[0204] The extracellular domain of TACI CRD2 has been demonstrated to bind to APRIL with high affinity and to BAFF with relatively lower affinity. Therefore, TACI CRD2 in a form of Fc fusion protein can block APRIL and BAFF binding to their receptors and prevent APRIL and BAFF mediated signaling through their receptors on the target cells, such as B cells.

[0205] Guided by the published crystal structure of the TACI cysteine-rich CRD2 domain in complex with APRIL (PDBID 1XU2) or BAFF (PDBID 1OQD) , the amino acid residues on the native TACI CRD2 (SEQ ID NO: 03) at or near the binding interface formed with APRIL or BAFF were recognized. In the 2nd step, computer modeling was utilized to create unique mutations on TACI CRD2 by replacing wild type residues with new amino acids and the interaction affinity between TACI CRD2 mutants and BAFF or APRIL were evaluated with in silico analysis. A list of mutations was selected because they might potentially improve the binding affinity of TACI CRD2 to APRIL or BAFF, shown in Table 1 (below, SEQ ID NO: 04-24) . a list of Delta1 mutants with ending at different positions was selected, shown in Table 1 (below, SEQ ID NO: 62, 63, 64, 72)

[0206] Exemplary TACI CRD2 sequences are shown as follows:

[0207] Table 1 TACI CRD2 sequences

[0208] In Formula II, Peptide A comprising or consisting of the sequence of CIPCQLRCSSNTPPLTCQRYCNASVTNSVKG (SEQ ID NO: 148) or the variant thereof.

[0209] Example 2: Construction of TACI CRD2 antibody or Fc fusion proteins

[0210] In the first step, DNA plasmid vectors were made that encode the antibody (such as anti-C5, anti-IFNAR1, and anti-IL23) -TACI CRD2 fusion protein bispecific antibody, or Fc-TACI CRD2 fusion protein. In the plasmid, DNA sequences of the TACI CRD2 CRD variants with either wild type sequences or mutations were fused to the heavy chains of an antibody, for example anti-C5 antibody (BB5.1 (BHL006) ) , anti-IFNAR1 antibody (Anifrolumab) , anti-IL23 antibody (Guselkumab) , to construct antibody-TACI CRD2 fusion protein bispecific antibody (see Figure 1A for a schematic structural diagram) , which comprising the full human hlgG LALA-YTE Fc region with bivalent F (ab) 2 at the N-terminus as the targeting antibody arms; and DNA sequences of the TACI CRD2 CRD variants with either wild type sequences or mutations were fused to Fc sequences to construct Fc-TACI CRD2 fusion protein (see Figure 1B) , heterodimeric Fc for the bivalent linking of an TACI CRD2 WT or mutein molecule at the C-terminus through one or more flexible glycine-serine (GS) -linkers. DNA sequences were clones into PCDNA3.4 vector with a signal sequence and final plasmids were prepared and purified by Vendors Biointron or Genscripts, using their standard methods.

[0211] To produce protein, CHO cells were transfected with the plasmid vectors described above. After seven day’s culture, the cells were harvested by centrifugation and cell supernatants were collected. Subsequently, recombinant proteins were isolated from cell supernatants using protein A columns on an AKTApure25 purification system with protein elution at PBS buffer. All proteins with > 90%purify were stored in PBS pH7.4 at 4℃.

[0212] Exemplary antibody sequences:

[0213] The sequences of the anti-C5 BB5.1 (BHL006) antibody, anti-IFNAR1 antibody (Anifrolumab) , anti-IL23 antibody (Guselkumab) and Fc peptide are shown below:

[0214] >Heavy chain variable region of BB5.1 (BHL006)

[0215] >Light chain variable region of BB5.1 (BHL006)

[0216] >Heavy chain of BB5.1 (BHL006)

[0217] >Light chain of BB5.1 (BHL006)

[0218] >Heavy chain variable region of Anifrolumab

[0219] >Light chain variable region of Anifrolumab

[0220] >Heavy chain of Anifrolumab

[0221] >Light chain of Anifrolumab

[0222] >Heavy chain variable region of Guselkumab

[0223] >Light chain variable region of Guselkumab

[0224] >Heavy chain of Guselkumab

[0225] >Light chain of Guselkumab

[0226] >Human IgG1 Fc Peptide

[0227] The CDR sequences of the BB5.1 (BHL006) antibody, Anifrolumab, Guselkumab are shown in Table 2:

[0228] Note: the above CDRs are determined according to the Kabat numbering scheme.

[0229] The full-length sequences of the constructed TACI CRD2-Mab

[0230] TACI CRD2 was fused to the heavy chains of BB5.1 (BHL006) to construct antibody fusion proteins TACI CRD2-Mab (see FIG. 1A for a schematic structural diagram) . The information of the constructed TACI CRD2-Mabs are shown in Table 3.

[0231] Table 3. The information of the constructed TACI CRD2-Mab

[0232] TACI CRD2 was also fused to the heavy chains of Anifrolumab, Guselkumab to construct antibody fusion proteins TACI CRD2-Mab (see FIG. 1A for a schematic structural diagram) , TACI CRD2 was also fused to Human IgG1 Fc (crystallizable fragment) to construct fusion proteins Fc-TACI CRD2 (see FIG. 1B for a schematic structural diagram) . The information of the constructed TACI CRD2-Mabs and Fc-TACI CRD2 are shown in Table 4.

[0233] Table 4. The information of the constructed TACI CRD2-Mab

[0234] The sequences are as follows:

[0235] >Heavy chain of TACI CRD2-Mab 01

[0236] >Light chain of TACI CRD2-Mab 01

[0237] >Heavy chain of TACI CRD2-Mab 02

[0238] >Light chain of TACI CRD2-Mab 02

[0239] >Heavy chain of TACI CRD2-Mab 03

[0240] >Light chain of TACI CRD2-Mab 03

[0241] >Heavy chain of TACI CRD2-Mab 04

[0242] >Light chain of TACI CRD2-Mab 04

[0243] >Heavy chain of TACI CRD2-Mab 05

[0244] >Light chain of TACI CRD2-Mab 05

[0245] >Heavy chain of TACI CRD2-Mab 06

[0246] >Light chain of TACI CRD2-Mab 06

[0247] >Heavy chain of TACI CRD2-Mab 07

[0248] >Light chain of TACI CRD2-Mab 07

[0249] >Heavy chain of TACI CRD2-Mab 08

[0250] >Light chain of TACI CRD2-Mab 08

[0251] >Heavy chain of TACI CRD2-Mab 09

[0252] >Light chain of TACI CRD2-Mab 09

[0253] >Heavy chain of TACI CRD2-Mab 10

[0254] >Light chain of TACI CRD2-Mab 10

[0255] >Heavy chain of TACI CRD2-Mab 11

[0256] >Light chain of TACI CRD2-Mab 11

[0257] >Heavy chain of TACI CRD2-Mab 12

[0258] >Light chain of TACI CRD2-Mab 12

[0259] >Heavy chain of TACI CRD2-Mab 13

[0260] >Light chain of TACI CRD2-Mab 13

[0261] >Heavy chain of TACI CRD2-Mab 14

[0262] >Light chain of TACI CRD2-Mab 14

[0263] >Heavy chain of TACI CRD2-Mab 15

[0264] >Light chain of TACI CRD2-Mab 15

[0265] >Heavy chain of TACI CRD2-Mab 16

[0266] >Light chain of TACI CRD2-Mab 16

[0267] >Heavy chain of TACI CRD2-Mab 17

[0268] >Light chain of TACI CRD2-Mab 17

[0269] >Heavy chain of TACI CRD2-Mab 18

[0270] >Light chain of TACI CRD2-Mab 18

[0271] >Heavy chain of TACI CRD2-Mab 19

[0272] >Light chain of TACI CRD2-Mab 19

[0273] >Heavy chain of TACI CRD2-Mab 20

[0274] >Light chain of TACI CRD2-Mab 20

[0275] >Heavy chain of TACI CRD2-Mab 21

[0276] >Light chain of TACI CRD2-Mab 21

[0277] >Heavy chain of TACI CRD2-Mab 22

[0278] >Light chain of TACI CRD2-Mab 22

[0279] >Heavy chain of TACI CRD2-Mab 23

[0280] >Light chain of TACI CRD2-Mab 23

[0281] >Heavy chain of TACI CRD2-Mab 24

[0282] >Light chain of TACI CRD2-Mab 24

[0283] >Heavy chain of TACI CRD2-Mab 25

[0284] >Light chain of TACI CRD2-Mab 25

[0285] >Heavy chain of TACI CRD2-Mab 26

[0286] >Light chain of TACI CRD2-Mab 26

[0287] >Heavy chain of TACI CRD2-Mab 39

[0288] >Light chain of TACI CRD2-Mab 39

[0289] >Heavy chain of TACI CRD2-Mab 27

[0290] >Light chain of TACI CRD2-Mab 27

[0291] >Heavy chain of TACI CRD2-Mab 28

[0292] >Light chain of TACI CRD2-Mab 28

[0293] > Heavy chain of TACI CRD2-Mab 29

[0294] >Light chain of TACI CRD2-Mab 29

[0295] > Heavy chain of TACI CRD2-Mab 30

[0296] > Light chain of TACI CRD2-Mab 30

[0297] > Heavy chain of TACI CRD2-Mab 40

[0298] > Light chain of TACI CRD2-Mab 40

[0299] > Heavy chain of TACI CRD2-Mab 31

[0300] > Light chain of TACI CRD2-Mab 31

[0301] > Heavy chain of TACI CRD2-Mab 32

[0302] > Light chain of TACI CRD2-Mab 32

[0303] > Heavy chain of TACI CRD2-Mab 33

[0304] > Light chain of TACI CRD2-Mab 33

[0305] > Heavy chain of TACI CRD2-Mab 34

[0306] > Light chain of TACI CRD2-Mab 34

[0307] > Heavy chain of TACI CRD2-Mab 41

[0308] > Light chain of TACI CRD2-Mab 41

[0309] > TACI CRD2-Mab 35

[0310] > TACI CRD2-Mab 36

[0311] > TACI CRD2-Mab 37

[0312] > TACI CRD2-Mab 38

[0313] > TACI CRD2-Mab 42

[0314] Telitacicept, Atacicept, Povetacicept, Belimumab and Zigakibart are used as positive control, the sequences of which are shown as follows:

[0315] > Sequence of Telitacicept:

[0316] > Sequence of Atacicept:

[0317] > Sequence of Povetacicept:

[0318] >Heavy chain of Zigakibart:

[0319] >Light chain of Zigakibart:

[0320] >Heavy chain of Belimumab :

[0321] >Light chain of Belimumab:

[0322] Example 3: Binding Affinity of Dual BAFF / APRIL antagonists to BAFF and APRIL

[0323] The binding affinity of TACI CRD2-Mabs in the form of anti-C5-TACI CRD2 variants fusion protein bispecific antibodies to human APRIL or human BAFF recombinant protein was determined using Surface Plasmon Resonance (SPR) (BiacoreTM 8K instrument) on Protein G Series S Sensor Chip (CAT: 29179315) as shown in Table 5.

[0324] Antigens / Analytes were diluted in 1xHBS-EP+ buffer: Human APRIL / TNFSF13 Protein, His, Flag Tag, active trimer (MALS verified) (Acro Biosystems: APL-H52D1-100ug) from 2.5nM (two-fold serial dilution) ; Recombinant Human BAFF / BLyS / TNFSF13B Protein (ECD) (Sino Bio: 10056-HNCH) from 25nM (two-fold serial dilution) . Capture monoclonal antibodies were all diluted in 1xHBS-EP+ buffer. Association phases were monitored for 120 seconds at a flow rate of 30 μl / minute, and the dissociation phases for 500～1200 seconds at the same flow rate. Data was fitted and analyzed in Biacore Evaluation Software.

[0325] The result of dissociation constants (KD) are shown in Table 5, comparing Telitacicept, Belimumab and Zigakibart, TACI CRD2-Mab 05, TACI CRD2-Mab 23, TACI CRD2-Mab 24 and TACI CRD2-Mab 25 have stronger binding affinity to BAFF and APRIL.

[0326] Table 5. Binding Affinity of Dual BAFF / APRIL antagonists to BAFF and APRIL determined by Surface Plasmon Resonance (Biacore) analysis.

[0327] *CNBD –could not be determined

[0328] Example 4: BAFF blockade ELISA assay

[0329] The 96 Well, PS, Half Area, Clear,  High Binding plates (Greiner Bio-One, catalog number: 675061) were coated with 0.5 μg / ml BAFFR-Fc (Sino Biological, catalog number: 16079-H02H-50) over night at room temperature, followed by washes with 0.05% 20 in PBS. Dilute testing samples to numerous concentrations in block buffer (1%BSA in PBS) and then pre-mix with 0.5 μg / ml of recombinant human BAFF-His proteins at 1: 1 molar ratio for 30min at room temperature. Recombinant BAFF-his tag protein was purchased from vendors: ACROBiosystems, catalog number: BAF-H82Q2 and catalog number: BAF-H52D4.

[0330] Premix in a volume of 50 μl were transferred into the coated plate and were incubated for 1 hours, followed by washes and detection with 1: 3000 HRP conjugated Anti-His Antibody (AY63) , mAb (ACROBiosystems, catalog number: HISPLM535) . Color development was achieved using a TMB Substrate Kit (Thermo Scientific, catalog number: 34028) and the ELISA plates analyzed on a plate reader ( ix3 Microplate Reader, Molecular Devices LLC) .

[0331] TACI CRD2-Mab 1 / 2 / 3 / 4 were tested in this assay as shown in Figure 2A. The results showed that comparing to Belimumab (anti-BAFF) , TACI CRD2-Mab 2 / 3 / 4 have reduced BAFF blocking activities. Therefore, the engineering of TACI CRD2 is required to improve its BAFF blocking activities.

[0332] TACI CRD2-Mab 1 / 5 / 6 / 7 / 9 / 11 / 14 / 16 and 17-22 were tested in this assay as shown in Figure 2B, 2C and 2D. The results showed that comparing to Belimumab (anti-BAFF) , TACI CRD2-Mab 5 / 6 / 7 / 14 / 19 has better BAFF blocking; whereas other molecules have reduced BAFF blocking activities. Therefore, the mutations present in TACI CRD2-Mab 5 / 6 / 7 / 14 / 19 improve BAFF blocking activities, comparing to other mutations. Meanwhile, comparing to Telitacicept (TACI-Fc) and Atacicept (TACI-Fc) , TACI CRD2-Mab 1 and TACI CRD2-Mab 5 have significantly better BAFF blocking activities, and TACI CRD2-Mab 5 has better BAFF blocking activity than TACI CRD2-Mab 1.

[0333] TACI CRD2-Mab 23-38 were tested in this assay. As shown in Figure 9, comparing to Telitacicept (TACI-Fc) and Atacicept (TACI-Fc) , the mutations present in TACI CRD2-Mab 23-38 improve BAFF blocking activities.

[0334] Example 5: APRIL blockade ELISA assay

[0335] The 96 Well, PS, Half Area, Clear,  High Binding plates (Greiner Bio-One, cat log no: 675061) were coated with 0.5 μg / ml BCMA-Fc (Sino Biological, catalog number: 10620-H02H-50) over night at room temperature, followed by washes with 0.05% 20 in PBS. Dilute testing samples to numerous concentrations in block buffer (1%BSA in PBS) and then pre-mix with 0.5 μg / ml of recombinant human APRIL-His proteins at 1: 1 molar ratio for 30min at room temperature.

[0336] Recombinant human APRIL-his tag protein was purchased from vendors: ACROBiosystems, catalog number: APLH82Q8, ACROBiosystems, catalog number: APL-H52D1 and Kactusbio Inc., catalog number: APR-HM110-500UG

[0337] Premix in a volume of 50 μl were transferred to the coated plate incubate for 1 hours, followed by washes and detection with 1: 3000 HRP conjugated Anti-His Antibody (AY63) , mAb (ACROBiosystems, catalog number: HISPLM535) . Color development was achieved using a TMB Substrate Kit (Thermo Scientific, cat log no: 34028) and the ELISA plates analyzed on a plate reader ( ix3 Microplate Reader, Molecular Devices LLC) .

[0338] TACI CRD2-Mab 1 / 5 / 7 / 11 / 14 / 19 / 22 were tested in this assay as shown in Figure 3A, 3B and 3C.The results showed that comparing to TACI CRD2-Mab 1, TACI CRD2-Mab 5 / 7 / 19 have similar or better APRIL blocking activities. Meanwhile, comparing to Telitacicept (TACI-Fc) and Atacicept (TACI-Fc) , TACI CRD2-Mab 5 has significantly better APRIL blocking activity; and TACI CRD2-Mab 5 has slightly better APRIL blocking activity than TACI CRD2-Mab 1.

[0339] TACI CRD2-Mab 23-38 were tested in this assay. The results as shown in Table 6, the mutations present in TACI CRD2-Mab 23-38 improve APRIL blocking activities, comparing to other mutations.

[0340] Table 6. Result of activity of TACI CRD2 Mab 23 / 28 / 32 / 36 in blocking APRIL binding to BCMA.

[0341] Example 6: Assessment of Activity of TACI CRD2 Fusion Proteins using reporter cell lines

[0342] Activating TACI and BCMA on cell surface can lead to the activation of downstream signaling pathways. Thus, reporter cells were engineered to monitor the inhibition of TACI or BCMA mediated signaling pathway.

[0343] The NF-κB Luciferase Reporter Jurkat Cell line (purchased from BPS Bioscience, catalog number: 60651) was engineered for monitoring nuclear factor Kappa B (NF-κB) signal transduction pathways. It contains a firefly luciferase reporter driven by four copies of the NF-κB response element located upstream of the minimal TATA promoter. To express human BCMA and TACI in The NF-κB Luciferase Reporter Jurkat Cell Line, a lentivirus systems were used (Vectorbuilder, catalog number: S240808-1008kmp and S240611-1073mqk) .

[0344] The engineered BCMA and TACI reporter cell lines respond to human APRIL or BAFF stimulation. Following binding of recombinant human APRIL or BAFF to both BCMA and TACI, endogenous NK-κB transcription factors in the Jurkat cells bind to the DNA response elements controlling transcription of a firefly luciferase gene. Luciferase production was quantitated through the addition of a luciferin-containing substrate which, when oxidized, generates light that can be measured using a microplate reader.

[0345] In this experiment, recombinant human APRIL or BAFF at varying concentrations (ranging 1-10 nM) in 30 μL were incubated with fixed or titrated (ranging 40 nM-66 pM) testing articles in 30 μL. Ligands and soluble receptors were incubated for 30 minutes at 37 degrees. Fifty μL was transferred to a 96-well, white flat-bottomed plated containing 40000 Jurkat / NF-κB / TACI, cells or Jurkat / NF-κB / BCMA, cells well in 50 μL media (RPMI1640+5%fetal bovine serum [FBS] ) . Wells were mixed and plates incubated for 5 hours at 37° Celsius (C) in a humidified 5%CO2 incubation chamber. Plates were removed from the incubator and 100 μL of cell lysis and luciferase substrate solution (Bio-GloTM Luciferase Assay System, Promega, catalogue number: PAG7940) was added to each well and the plates were incubated on an orbital shaker for 10 minutes. Relative luminescence values (RLU) were determined for each test sample by measuring luminescence with an Multimode Plate Reader. Decreased RLU in the presence of test articles relative to control proteins represent blockade and inhibition of ligand signaling via the transduced TACI receptor in the Jurkat / NF-κB / TACI cells and BCMA receptors in the Jurkat / NF-κB / TACI CRD2 cells.

[0346] TACI CRD2-Mab 1 / 5 / 7 were tested on TACI reporter cells to determine if they can block BAFF stimulating of TACI. As shown in Figure 4, TACI CRD2-mab 1 / 5 / 7 have similar blocking activity compared to Belimumab (anti-BAFF) . This result suggests modifications in TACI CRD2-Mab 5 / 7 can enhance BAFF blocking activities.

[0347] TACI CRD2-Mab 1 / 5 were tested on BCMA reporter cells to determine if they can block APRIL stimulating BCMA. As shown in Figure 5, comparing Zigakibart (anti-APRIL) , TACI CRD2-mab 5 demonstrated slightly better activities. This result suggests modifications in TACI CRD2-Mab 5 can enhance APRIL blocking activities.

[0348] TACI CRD2-Mab 5 also was tested in this assay comparing to Telitacicept and Atacicept, the results as shown in Table 7-9. The results showed that comparing to Telitacicept and Atacicept, TACI CRD2-Mab 5 has significantly better APRIL blocking activities and BAFF blocking activities.

[0349] Table 7. Result of activity of TACI CRD2-Mab 5 in inhibiting BAFF stimulation of TACI reporter cells, comparing to Telitacicept and Atacicept

[0350] Table 8. Result of activity of TACI CRD2-Mab 5 in inhibiting APRIL stimulation of TACI reporter cells comparing to Atacicept (TACI-Fc)

[0351] Table 9. Result of activity of TACI CRD2-Mab 5 in inhibiting APRIL stimulation of BCMA reporter cells, comparing to Atacicept (TACI-Fc)

[0352] TACI CRD2-Mab 23-38 were tested on TACI reporter cells to determine if they can block BAFF stimulating of TACI. As shown in Table 10, comparing to Telitacicept and Atacicept, TACI CRD2-Mab 23-38 have better BAFF blocking activities. The result suggests modifications in TACI CRD2-Mab 23-38 can enhance BAFF blocking activities. Meanwhile, as shown in Table 11, comparing to TACI-CRD2-Mab 39-42, TACI CRD2-Mab 23 / 28 / 32 / 36 have better BAFF blocking activity.

[0353] Table 10. Result of activity of TACI CRD2-Mabs in inhibiting APRIL stimulation of BCMA reporter cells

[0354] Table 11. Result of activity of TACI CRD2-Mab 32 / 41 / 36 / 42 / 23 / 39 in inhibiting APRIL stimulation of BCMA reporter cells

[0355] TACI CRD2-Mab 23-38 were tested on BCMA reporter cells to determine if they can block APRIL stimulating BCMA. As shown in Table 12, comparing to Telitacicept (TACI-Fc) and Atacicept (TACI-Fc) , TACI CRD2-Mab 23-38 have better APRIL blocking activities. The result suggests modifications in TACI CRD2-Mab 23-38 can enhance APRIL blocking activities. Meanwhile, as shown in Table 13, comparing to TACI-CRD2-Mab 39-42, TACI CRD2-Mab 23 / 28 / 32 / 36 have better APRIL blocking activities

[0356] Table 12. Result of activity of TACI CRD2-Mabs in inhibiting BAFF stimulation of TACI reporter cells

[0357] Table 13. Result of activity of TACI CRD2-Mab 32 / 41 / 23 / 39 in inhibiting BAFF stimulation of TACI reporter cells

[0358] Example 7: Comparative bioactivity of Dual BAFF / APRIL antagonists to anti-IgM pre-activated Human B cells Stimulated with Human BAFF or Human APRIL.

[0359] Primary Human B cells were isolated from Human PBMC (Oklahoma Blood Institute, catalog number: 96-0115) by using EasySepTM Human B Cell Isolation Kit (STEMCELL Technologies, catalog number: 17954) and then were resuspended in cell culture medium (RPMI1640+5%fetal bovine serum [FBS] ) to a concentration of 0.5 million cells / mL. Fifty μL was transferred to a 96-well plate. Before seeding the B cells, the 96 Well Clear Polystyrene Microplate (Corning, catalog number: CLS3367-50EA) were coated with Goat Anti-Human IgM, F(ab') 2 Antibody (Low Endotoxin, Azide-free) (Cell Signaling Technology, catalog number: 96232S) at 37℃ and 5%CO2 cell culture incubator for 2 hours then washed by PBS. Uncoated wells were used as negative control. Dilute testing samples to numerous concentrations in assay medium (RPMI1640 +5%fetal bovine serum [FBS] ) and then pre-mix with 0.5 μg / ml of either recombinant human APRIL (ACROBiosystems, catalog number: APLH82Q8) or BAFF (ACROBiosystems, catalog number: BAF-H82Q2) proteins at 1: 1 molar ratio for 30min at room temperature. Premix in a volume of 50 μl were transferred to the Assay plate. Plates were incubated at 37℃ and 5%CO2 cell culture incubator for 96 hours. Equilibrate the plate and its contents at room temperature for approximately 30 minutes after stimulation. A volume of CellTiter-GloTMLuminescent Cell Viability regent (Promega, catalog number: G7572) was added to assay plate with the equal volume of cell culture medium present in each well. Read the plate on ix3 luminometer reader ( ix3 Microplate Reader, Molecular Devices LLC) .

[0360] TACI CRD2-Mab 5 and Atacicept (TACI-Fc) were tested in this assay. As shown in Table 14, TACI CRD2-Mab 5 has better APRIL blocking activity compared to Atacicept (TACI-Fc) . This result indicates that TACI CRD2 modification in TACI CRD2-Mab 5 can improve APRIL blocking activities.

[0361] Table 14. Result of activity of TACI CRD2-Mab 05 in inhibiting APRIL stimulation of Huamn B cells, comparing to Atacicept

[0362] TACI CRD2-Mab 5 and Atacicept (TACI-Fc) were tested in this assay to determine if they can block BAFF stimulating of Human B cells proliferation. As shown in Table 15, TACI CRD2-mab 5 have better BAFF blocking activity compared to Atacicept (TACI-Fc) . This result suggests modifications in TACI CRD2-Mab 5 can improve BAFF blocking activities.

[0363] Table 15. Result of activity of TACI CRD2-Mab 5 in blocking BAFF activity in Human B cells, comparing to Atacicept (TACI-Fc)

[0364] TACI CRD2-Mab 23-38 were tested in this assay to determine if they can block APRIL and BAFF stimulating of Human B cells proliferation. As shown in Table 16 and 17, the result suggests modifications in TACI CRD2-Mab 23-38 can improve APRIL and BAFF blocking activities.

[0365] Table 16. Result of activity of TACI CRD2-Mab 23 / 36 in blocking BAFF activity in Human B cells, comparing to Telitacicept

[0366] Table 17. Result of activity of TACI CRD2-Mab 36 / 42 in blocking APRIL activity in Human B cells, comparing to Telitacicept

[0367] Example 8: Assessment of the Activity of TACI CRD2-Mabs in an In Vivo Wild Type Mouse model

[0368] This Example describes the assessment of the anti-C5-TACI CRD2 fusion protein bispecific antibodies (Example 2) to affect immune response in vivo in wild type mice. The effect of Human TACI CRD2 and variants fusion protein bispecific antibodies were compared in this study.

[0369] To begin the study, 8-week old male C57BL / 6J mice were purchased from The Jackson Laboratory. Each test group has 4 mice. Mice were administered Human TACI CRD2 and variants fusion protein bispecific antibodies (at 10mg / kg) via intraperitoneal (IP) injection on Days 0, 4, 7 and 11. On Day 14, all mice were anesthetized with isoflurane and half of blood collected into serum separator tubes, another half of blood collected into heparin tubes for flow cytometry analysis. Mice were sacrificed and their spleen collected in cold PBS. Spleens were processed to single cell suspensions. Whole blood samples and spleen cells suspensions were treated by using the red blood cells (RBC) Lysis Buffer (Invitrogen, catalog number: 00-4333-57) to remove Red blood cells. Then the samples were washed three times with cold PBS then the samples stained for flow cytometry analysis. The samples spined down at 300xg for 5min. The cell pellets were resuspended in LIVE / DEADTM Fixable Near IR (780) Viability regent (1: 1000 in PBS) , for 633 nm excitation, (Invitrogen, catalog number: L34994) for 10min in room temperature. Double Wash cells with FACS buffer (PBS+2%FBS) . Prepare staining antibodies cocktail base on flow panel: anti-CD45-BV421 (1: 100, BD Biosciences, catalog number: 563890) , anti-CD3-BV605 (1: 100, BD Biosciences, catalog number: 564009) , anti-CD138-BV711 (1: 100, BD Biosciences, catalog number: 563193) , anti-CD138-BV711 (1: 100, BD Biosciences, catalog number: 563193) , anti-CD19-FITC (1: 100, BD Biosciences, catalog number: 553785) , anti-CD11b-PE (1: 100, BD Biosciences, catalog number: 557397) and anti-B220-APC (1: 100, BD Biosciences, catalog number: 553092) . Resuspend the cell pellets with staining cocktail in 100μl FACS buffer (PBS+2%FBS) for 20 min at room temperature. Samples were washed two times with 200μl FACS buffer (PBS+2%FBS) at 300xg for 5min. Cell pellets were resuspended in 100 μl FACS buffer. Data Acquisition in BD LSRFortessa and analysis in flowjo: Total B cells (CD45+, CD19+, CD3-, CD11b-) and Total T cells (CD45+, CD11b-, CD3+) .

[0370] To test the circulating Ig level of the whole blood. Whole blood samples were centrifuged for 15 min at 3,000 rpm (1500×g) at 4℃ without brake. Carefully transfer the supernatant (plasma) to a new Eppendorf tube. The circulating IgA, IgM and IgG were tested by using IgA Mouse Uncoated ELISA kit (Invitrogen, catalog number: 88-50450-88) , Mouse IgG (Total) Uncoated ELISA kit (Invitrogen, catalog number: 88-50400-88) and Mouse IgM Uncoated ELISA kit(Invitrogen, catalog number: 88-50470-88) .

[0371] TACI CRD2-Mab 1 / 5 were tested in this assay. As shown in Figure 6A-6B and Figure 7A-7B, comparing to Povetacicept (TACI-Fc) , TACI CRD2-Mab 1 / 5 have similar activities in blocking mice blood and spleen B cells proliferation in vivo. This result indicates that TACI CRD2 modification do not affect mouse B cells blocking activities both in blood and spleen.

[0372] TACI CRD2-Mab 23-38 were tested in this assay. TACI CRD2-Mab 23-38 have better activities in blocking mice blood and spleen B cells proliferation in vivo. This result indicates that TACI CRD2 modification improve mouse B cells blocking activities both in blood and spleen.

[0373] TACI CRD2-Mab 1 / 5 were tested in this assay. As shown in Table 18, Figure 8A, 8B and 8C, comparing to Povetacicept (TACI-Fc) , TACI CRD2-Mab 5 have better activities in blocking IgA, IgM and IgG in vivo. This result indicates that TACI CRD2 modification in TACI CRD2-Mab 1 can improve IgA, IgM and IgG blocking activities in vivo.

[0374] Table 18. Assessment results of the Activity of TACI-CRD2-Mab in in Vivo Wild Type Mouse model

[0375] Note: the values in the table are the average value of animals of each group, Ordinary one-way ANOVA *p < 0.05, **p < 0.01, ****p < 0.0001 compared to IgG ISO (IgG isotype control) .

[0376] TACI CRD2-Mab 23-38 were tested in this assay, and all have improved IgA, IgM and IgG blocking activities in vivo.

[0377] Example 9: Assessment of the Activity of BCMA-Mabs and TACI CRD2-Mabs in an In Vivo Collagen-induced arthritis mice model

[0378] DBA1 Mice were immunized with type II collagen emulsified in CFA on day 21. Treatment was initiated from day 28 to day 42. Ten mice per group received Telitacicept (9 mg / kg) , Povetacicept (7.6 mg / kg) , BB5.1 (17.6 mg / kg) , TACI-CRD2-Mab 05 (18.8 mg / kg) , TACI-CRD2-Mab 01 (19 mg / kg) i. p., three times / week for 2 weeks. Arthritic lesions for each paw were graded daily using a scoring system of 0–4. The total paw score was calculated for each group, and the average number of animals with disease was determined. Ordinary one-way ANOVA, *p < 0.05, **p < 0.01, ****p < 0.0001 compared to IgG ISO (IgG isotype control) .

[0379] To test the circulating Ig level of the whole blood. Whole blood samples were centrifuged for 15 min at 3,000 rpm (1500×g) at 4℃ without brake. Carefully transfer the supernatant (plasma) to a new Eppendorf tube. The circulating IgA, IgM and IgG were tested by using Mouse IgA ELISA kit ABclonal RK00162, Mouse IgM ELISA kit ABclonal RK00173, Mouse IgG ELISA kit ABclonal RK00375.

[0380] TACI CRD2-Mab 5 was tested in this assay. As shown in Table 19, Figure 10A, 10B and 10C, comparing to Povetacicept (TACI-Fc) and Telitacicept (TACI-Fc) , TACI CRD2-Mab 5 has significantly better activities in blocking IgA, IgM and IgG in vivo CIA mice model.

[0381] Table 19. Assessment results of the Activity of TACI-CRD2-Mab in in Vivo CIA mice model

[0382] Note: the values in the table are the average value of animals of each group, *p < 0.05, **p < 0.01, ****p < 0.0001.

[0383] Although specific embodiments of the invention have been described in detail, those skilled in the art will understand that various modifications and changes may be made to the details in accordance with all the published teachings, which are also included in the scope of the invention. The protection scope of the invention is defined by the appended claims and any equivalents thereof.

Claims

1.A Transmembrane activator and CAML interactor (TACI) polypeptide, wherein the TACI polypeptide comprising a truncated wild-type cysteine rich domain 2 (CRD2) or a variant thereof, wherein CRD2 comprising one or more amino acid substitution (s) , insertion (s) and / or deletion (s) selected from the following positions: 5-9, 11-12, 14-44, with reference to the amino acid positions of SEQ ID NO: 03;preferably, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) and / or deletion (s) selected from the following positions: 5-8, 11, 14, 24, 30, 31, 35, 40-44, with reference to the amino acid positions of SEQ ID NO: 03;preferably, the CRD2 comprising one or more amino acid substitution (s) , insertion (s) , and / or deletion (s) selected from the following positions: 5-8, 40-44, with reference to the amino acid positions of SEQ ID NO: 03;more preferably, the CRD2 comprising:(a) one or more amino acid deletion (s) selected from the following positions: 5-8, 40-43; preferably, any two amino acid deletion (s) selected from the following positions: 5-8 and any one amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or(b) one or more amino acid insertion (s) selected from the following positions: 30, 31, 44; and one or more amino acid deletion (s) selected from the following positions: 5-6, 43, with reference to the amino acid positions of SEQ ID NO: 03; or(c) one or more amino acid substitution (s) selected from the following positions: 11, 14, 24, 35, 41, and one or more amino acid deletion (s) selected from the following positions: 5-8, 43, with reference to the amino acid positions of SEQ ID NO: 03;further preferably, the CRD2 comprising:(a) two amino acid deletion (s) of the following positions: 5-6 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or(b) two amino acid deletion (s) of the following positions: 6-7 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03; or(c) two amino acid deletion (s) of the following positions: 7-8 and any one or more amino acid deletion (s) selected from the following positions: 40-43, with reference to the amino acid positions of SEQ ID NO: 03;(d) two amino acid insertion (s) of the following positions: 30-31 and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; preferably, the two amino acid insertion (s) are 30T and 31P; or(e) two amino acid deletion (s) of the following positions: 5-6 and one amino acid insertion of position 44 with reference to the amino acid positions of SEQ ID NO: 03; preferably, one amino acid insertion of position 44 is 44P; or(f) one amino acid substitution of L16H, L15H, F11H, Y12F, H14Y, H14L, F11Y, D18H, S24D, S24V, Y35N or L41D, with reference to the amino acid positions of SEQ ID NO: 03; or(g) one amino acid substitution of L16H, L15H, F11H, Y12F, H14Y, H14L, F11Y, D18H, S24D, S24V, Y35N or L41D, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or(h) two amino acid substitutions selected from the following groups: H14Yand D18H, H14Yand S24D, H14Yand S24V, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or(i) three amino acid substitutions of H14Y, Y35N and L41D, and one amino acid deletion of the position 43, with reference to the amino acid positions of SEQ ID NO: 03; or(j) one amino acid substitution of F11Y, and three amino acid deletions of positions: 5, 6 and 43, with reference to the amino acid positions of SEQ ID NO: 03.2.The TACI polypeptide of claim 1, wherein the TACI polypeptide binds to BAFF and / or APRIL; preferably, the TACI polypeptide has improved binding affinity to one or both of BAFF and APRIL;more preferably, the TACI polypeptide binds to both BAFF and APRIL of with a KD of less than 10-9M, preferably about 10-10M to about 10-12M;further preferably, the TACI polypeptide binds to both BAFF and APRIL of with a KD of less than 10-10M, preferably about 10-11M to about 10-12M.3.The TACI polypeptide of claim 1, wherein the CRD2 comprising the sequence of (i) Formula I:SLSCX1X2 X3X4 X5K X6 X7D X8 X9 X10RX11CISCAX12ICGQHX13X14PKQCA X15FCENKX16RX17 (SEQ ID NO: 01) , wherein the X1-X17 are any amino acid;or(ii) Formula II:SLSCX1X2 X3X4 X5K X6 X7D X8 X9 X10R X11-Peptide A (SEQ ID NO: 02) , wherein the X1-X11 are any amino acid, Peptide A comprising or consisting of the sequence of CIPCQLRCSSNTPPLTCQRYCNASVTNSVKG or the variant thereof; or(iii) Formula III:SLSCX1X2X3X4 X5K X6 X7D X8 X9 X10R X11CISCA X12ICGQH X13 X14PKQCA X15FCENX16X17X18X19 X20 (SEQ ID NO: 71) , wherein the X1-X20 are any amino acid .4.The TACI polypeptide of claim 3, wherein(i) Formula I, the X1-X17 are defined as below:X1 is R or is absent;X2 is K or is absent;X3 is E or is absent;X4 is Q or is absent;X5 is G or is absent;X6 is F, H or Y;X7 is F or Y;X8 is H, L or Y;X9 is H, L or P;X10 is H, L or S;X11 is D or H;X12 is S, D or V;X13 is T or is absent;X14 is P or is absent;X15 is Y, N or D;X16 is L or D;X17 is S or is absent; preferably, X17 is absent; or(ii) Formula II, the X1-X11 are defined as below:X1 is R or is absent;X2 is K or is absent;X3 is E or is absent;X4 is Q or is absent;X5 is G or is absent;X6 is F, H or Y;X7 is F or Y;X8 is H, L or Y;X9 is H, L or P;X10 is H, L or S;X11 is D or H or(iii) Formula III, the X1-X20 are defined as below:X1 is R or is absent;X2 is K or is absent;X3 is E or is absent;X4 is Q or is absent;X5 is G or is absent;X6 is F, H or Y;X7 is F or Y;X8 is H, L or Y;X9 is H, L or P;X10 is H, L or S;X11 is D or H;X12 is S, D or V;X13 is T or is absent;X14 is P or is absent;X15 is Y, N or D;X16 is K or is absent;X17 is L, D or is absent;X18 is R or is absent;X19 is S or is absent;X20 is P or is absent;preferably, in Formula I, II and III, X1-X5 are defined as below:(a) X1 is R, X2 is K, X3 is E, X4 is Q, X5 is G; or,(b) X1 and X2 are absent, X3 is E, X4 is Q, X5 is G; or,(c) X1 is R, X2 and X3 are absent, X4 is Q, X5 is G; or,(d) X1 is R, X2 is K, X3 and X4 are absent, X5 is G; or,(e) X1 is R, X2 is K, X3 is E, X4 and X5 are absent.5.The TACI polypeptide of any one of claims 1-4, wherein: the CRD2 comprising of consisting of the sequence of Formula IV:SLSCEQGKFYDHLLRDCISCASICGQHPKQCAYFCENX21X22X23X24X25 (SEQ ID NO: 113) , wherein X21-X25 are any amino acid;preferably, X21-X25 are defined as below:X21 is K or absent; X22 is L or absent; X23 is R or absent; X24 is S or absent; X25 is P or absent;more preferably,(a) X21 is K; X22 is L; X23-X25 are absent;(b) X21-X25 are absent;(c) X21 is K; X22 is L; X23 is R; X24 is S; X25 is P;(d) X21 is K; X22 is L; X23 is R; X24-X25 are absent; or(e) X21 is K; X22 is L; X23 is R; X24 is S; X25 is absent.6.The TACI polypeptide of any one of claims 1-5, wherein:the CRD2 comprise or consist of the amino acid sequence selected from SEQ ID NO: 62, 63, 64, 72, 07, 04-06, 08-24, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith; preferably, the CRD2 comprise or consist of the amino acid sequence selected from SEQ ID NO: 62 , 63, 64, 72, 07, 09, 21, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith.7.A fusion protein comprising a TACI polypeptide of any one of claims 1-6 or a TACI polypeptide comprise or consist of the amino acid sequence of SEQ ID NO: 108 or 03.8.The fusion protein of claim 7, wherein the TACI polypeptide is operably linked to Fc peptide by a linker; preferably, the Fc peptide comprise or consist of the amino acid sequence set forth in SEQ ID NO: 81, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;preferably, C terminal of the polypeptide is linked to the N terminal of the Fc peptide, or N terminal of the polypeptide is linked to the C terminal of the Fc peptide, or C terminal of the polypeptide is linked to the C terminal of the Fc peptide, or N terminal of the polypeptide is linked to the N terminal of the Fc peptide.9.The fusion protein of claim 7, wherein the TACI polypeptide is operably linked to an immunoglobulin by a linker;preferably, the polypeptide is operably linked to the constant domain of the immunoglobulin;more preferably, N terminal of the polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or N terminal of the polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin, or C terminal of the polypeptide is linked to the C terminal of the heavy chain constant domain of the immunoglobulin, or C terminal of the polypeptide is linked to the C terminal of the light chain constant domain of the immunoglobulin.10.The fusion protein of any one of claims 8-9, wherein the linker is selected from the group of (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GSGSGSG) n, (GSGSGSGSG) n, (GSGSGSGSGSG) n, (GGGGGS) n, (GGGGGGS) n, (GGGGGGGS) n, (GGGGGGGGS) n, (GGGGGGGGGS) n, (GGGGGGGGGGS) n, (G) n, (GSA) n, (GGSA) n, (GGGSA) n, (GGGGSA) n, (GGGGGSA) n, (GGGGGGSA) n, (GGGGGGGSA) n, (GGGGGGGGSA) n, (GGGGGGGGGSA) n, (GGGGGGGGGGSA) n, (GA) n, (GGA) n, (GGGA) n, (GGGGA) n, (GGGGGA) n, (GGGGGGA) n, (GGGGGGGA) n, (GGGGGGGGA) n, (GGGGGGGGGA) n, (GGGGGGGGGGA) n, n is an integer of 1-10, preferably, n is an integer of 1-5.11.The fusion protein of claim 10, wherein the immunoglobulin is an antibody inhibiting BDCA2, IFNAR1, IL23, IL17, IL12p40, TNFα, MASP2 or FcRn , or an antibody inhibiting the complement, preferably, the complement is selected from: C1, C5, C3, C7, C8, C9, MASP, DAF, C4, Factor B, Factor D, Factor P, factor H;preferably, the immunoglobulin is an antibody inhibiting IFNAR1, IL23, or C5; more preferably, the immunoglobulin is selected from Anifrolumab, Guselkumab, Eculizumab, Ravulizumab, Crovalimab, or BB5.1 (BHL006) .12.The fusion protein of any one of claims 8-11, wherein the fusion protein comprising a first TACI polypeptide comprise or consist of the amino acid sequence selected from SEQ ID NOs: 62, 63, 64, 72, 07, 04-06, 08-24, and a second TACI polypeptide comprise or consist of the amino acid sequence selected from SEQ ID NOs: 62, 63, 64, 72, 07, 04-06, 08-24; optionally, the first TACI polypeptide and the second TACI polypeptide are the same or different;preferably, the first TACI polypeptide and the second TACI polypeptide are the same.13.The fusion protein of any one of claims 11-12, the antibody comprises heavy chain variable region (VH) and light chain variable region (VL) , wherein:the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 29, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 31, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 33;andthe VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 30, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 32, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 34;or,the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 82, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 84, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 86; andandthe VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 83, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 85, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 87;or,the VH comprises: a) an HCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 88, b) an HCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 90, c) an HCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 92; andandthe VL comprises: d) an LCDR1 comprising an amino acid sequence as shown in SEQ ID NO: 89, e) an LCDR2 comprising an amino acid sequence as shown in SEQ ID NO: 91, f) an LCDR3 comprising an amino acid sequence as shown in SEQ ID NO: 93;preferably,the VH comprises an amino acid sequence as shown in SEQ ID NO: 25; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 26;or,the VH comprises an amino acid sequence as shown in SEQ ID NO: 73; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 74;or,the VH comprises an amino acid sequence as shown in SEQ ID NO: 77; and the VL comprises an amino acid sequence as shown in SEQ ID NO: 78;more preferably,the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 27, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 28;or,the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 75, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 76;or,the heavy chain comprising the amino acid sequence as shown in SEQ ID NO: 79, and light chain comprising the amino acid sequence as shown in SEQ ID NO: 80.14.The fusion protein of claim 13, wherein the fusion protein comprising of consisting of any one of the following:a) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 65, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;b) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 96, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;c) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 101, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;d) the amino acid sequence set forth in SEQ ID NO: 105, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;e) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 35, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;f) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 36, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;g) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 37, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;h) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 38, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;i) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 39, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;j) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 40, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;k) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 41, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;l) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 42, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;m) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 43, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;n) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 44, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;o) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 45, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;p) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 46, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;q) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 47, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;r) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 48, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;s) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 49, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;t) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 50, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;u) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 51, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;v) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 52, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;w) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 53, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;x) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 54, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;y) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 55, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;z) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 56, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;a1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 66, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;b1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 67, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;c1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 68, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 28, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;d1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 94, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;e1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 97, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 95, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;f1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 99, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;g1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 99, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;h1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 102, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;i1) heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 103, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith, and light chain comprising the amino acid sequence set forth in SEQ ID NO: 100, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;j1) the amino acid sequence set forth in SEQ ID NO: 104, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;k1) the amino acid sequence set forth in SEQ ID NO: 106, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith;l1) the amino acid sequence set forth in SEQ ID NO: 107, or sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%sequence identity therewith.15.An isolated polynucleotide or set of isolated polynucleotides comprising at least one sequence that encodes the TACI polypeptide according to any one of claims 1-6, or the fusion protein according to any one of claims 7-14.16.A vector or set of vectors comprising one or more of the polynucleotides or sets of polynucleotides according to claim 15.17.An isolated cell comprising a polynucleotide or set of polynucleotides according to claim 15, or a vector or set of vectors according to claim 16;preferably, the cell is a yeast cell, a bacterial cell, a hybridoma, a Chinese Hamster Ovary (CHO) cell, or a HEK293 cell.18.A method of producing the fusion protein of any one of claims 7-14, comprising:(a) culturing the cell of claim 17 in conditions under which the fusion protein is expressed; and(b) recovering the fusion protein from the cell culture; and, optionally further comprising enriching for the fusion protein and / or purifying the fusion protein.19.A pharmaceutical composition comprising the TACI polypeptide according to any one of the claims 1-6, or the fusion protein according to any one of the claims 7-14, and a pharmaceutically acceptable carrier.20.Use of the TACI polypeptide according to any one of the claims 1-6, or the fusion protein according to any one of the claims 7-14, or the pharmaceutical composition according to claim 19 for the treatment of a disease or disorder in a subject or in the manufacture of a medicine;preferably, the disease or disorder is cancer or autoimmune diseases;more preferably, the disease is selected from IgA nephropathy, IgM polyneuropathy, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SLE) , lupus nephritis (LN) , Wegener's disease, inflammatory bowel disease, idiopathic thrombocytopenia Purpura (ITP) , thrombotic thrombocytopenic purpura (TTP) , autoimmune thrombocytopenia, multiple sclerosis, psoriasis, myasthenia gravis, vasculitis, diabetes, Reynauld's syndrome, Sjorgen's syndrome, glomerulonephritis, autoimmune hepatitis, autoimmune encephalomyelitis, and autoimmune thyroiditis, Membranous Nephropathy, Generalized Myasthenia Gravis, Neuromyelitis optica spectrum disorder, Acute Antibody Mediated Rejection, Chronic Antibody Mediated Rejection 72 primary Sjogren’s syndrome, Autoimmune Hemolytic Anemia, Antiphospholipid Syndrome, IgA Vasculitis, Rheumatoid Vasculitis, Anti-Synthetase Syndrome, Primary Membranous Nephropathy, Juvenile Idiopathic Arthritis (JIA) , Systemic Sclerosis, Guillain-Barre Syndrome, Autoimmune Pulmonary Alveolar Proteinosis, Hemolytic Disease Of The Fetus And Newborn (HDFN) , Acute Hemolytic Transfusion Reaction, Preventative Treatment with Adeno-Associated Virus (AAV) , Thyroid Eye Disease (TED) , Huntington’s Disease, Chronic Inflammatory Demyelinating Polyneuropathy (CIDP) , Pemphigus Vulgaris (PV) , Bullous Pemphigoid (BP) , Immune Thrombocytopenic Purpura (ITP) ; more preferably, the disease is IgA nephropathy.21.A method of treatment of a subject having a disease or disorder comprising administering to the subject the TACI polypeptide according to any one of the claims 1-6, or the fusion protein according to any one of the claims 7-14, or the pharmaceutical composition according to claims 19;preferably, the disease or disorder is cancer or autoimmune diseases;more preferably, the disease is selected from IgA nephropathy, IgM polyneuropathy, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SLE) , lupus nephritis (LN) , Wegener's disease, inflammatory bowel disease, idiopathic thrombocytopenia Purpura (ITP) , thrombotic thrombocytopenic purpura (TTP) , autoimmune thrombocytopenia, multiple sclerosis, psoriasis, myasthenia gravis, vasculitis, diabetes, Reynauld's syndrome, Sjorgen's syndrome, glomerulonephritis, autoimmune hepatitis, autoimmune encephalomyelitis, and autoimmune thyroiditis, Membranous Nephropathy, Generalized Myasthenia Gravis, Neuromyelitis optica spectrum disorder, Acute Antibody Mediated Rejection, Chronic Antibody Mediated Rejection 72 primary Sjogren’s syndrome, Autoimmune Hemolytic Anemia, Antiphospholipid Syndrome, IgA Vasculitis, Rheumatoid Vasculitis, Anti-Synthetase Syndrome, Primary Membranous Nephropathy, Juvenile Idiopathic Arthritis (JIA) , Systemic Sclerosis, Guillain-Barre Syndrome, Autoimmune Pulmonary Alveolar Proteinosis, Hemolytic Disease Of The Fetus And Newborn (HDFN) , Acute Hemolytic Transfusion Reaction, Preventative Treatment with Adeno-Associated Virus (AAV) , Thyroid Eye Disease (TED) , Huntington’s Disease, Chronic Inflammatory Demyelinating Polyneuropathy (CIDP) , Pemphigus Vulgaris (PV) , Bullous Pemphigoid (BP) , Immune Thrombocytopenic Purpura (ITP) ; more preferably, the disease is IgA nephropathy.

Images