T cell engagers and methods of use thereof

Abstract

The present disclosure relates to polypeptide molecules that specifically bind T cell receptor beta and compositions and methods comprising and employing the same.

Description

T CELL ENGAGERS AND METHODS OF USE THEREOFCROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of and the priority from U. S. Provisional Application No. 63 / 754,282, filed February 5, 2025, the disclosure of which is incorporated by reference in its entirety.FIELD OF THE DISCLOSURE

[0002] The present disclosure relates to polypeptide molecules that specifically bind T cell receptor beta (TCRβ), as well as compositions and methods of using said polypeptide molecules.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0003] The contents of the electronic sequence listing (JANX 005 01WO_SeqList_ST26.xml; Size: 2,561,106 bytes and Date of Creation: February 4, 2026) are herein incorporated by reference in its entirety.BACKGROUND

[0004] T cell engagers are a class of immunotherapeutic molecules that redirect the patient’s immune response to recognize and kill target cells (e.g., B cells expressing CD19). While T cell engagers have shown to elicit potent immune activity, these therapeutics have faced challenges due to overactivation of the immune system leading to cytokine release syndrome (CRS), on-target, healthy tissue toxicities, T cell exhaustion, as well as depletion of effector T cell populations with minimal expansion of memory T cell populations that can limit duration of immune activity.

[0005] Thus, there is a need in the art to improve the design of T cell engagers to improve the duration of immune activity as well as to reduce the toxicity and side effects associated with T cell engagers,SUMMARY OF THE INVENTION

[0006] The present disclosure provides T cell engagers, and compositions and methods comprising or employing the same. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβ-binding domain. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβC-binding domain. In some embodiments, the Tcell engager is a polypeptide molecule comprising an anti-TCRβC1-binding domain. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβC2-binding domain. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβV-binding domain. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβV6-5-binding domain. In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβV12-3-binding domain.

[0007] In some embodiments, the T cell engager is a polypeptide molecule comprising a first binding domain and a second binding domain. In some embodiments, the first binding domain comprises an anti-TCRP-binding domain (e g., an anti-TCRβC-binding domain or an anti-TCRβV-binding domain) and the second binding domain comprises an anti-tumor-associated antigen (TAA)-binding domain (e.g., an anti-CD19 binding domain). In some embodiments, a linker connects the first binding domain and the second binding domain. In some embodiments, the first binding domain comprises an scFv and the second binding domain comprises a Fab,

[0008] In some embodiments, the T cell engager is a polypeptide molecule comprising an anti-TCRβ-binding domain, an anti-TAA-binding domain, and an Fc region. In some embodiments, the polypeptide molecule comprises one or more linkers connecting the anti-TCRβ-binding domain, the anti-TAA-binding domain, and the Fc region.

[0009] In some embodiments, the present disclosure comprises treating a disease, disorder, or condition in a subject in need thereof by administering the polypeptide molecules disclosed herein to the subject. In some embodiments, the disease, disorder, or condition is cancer. In some embodiments, the disease, disorder, or condition is an autoimmune disease.

[0010] In some embodiments, the present disclosure provides methods for expanding T cells (e.g., effector T cells or memory T cells) in a subject by administering the polypeptide molecules disclosed herein.

[0011] In some embodiments, the present disclosure provides methods for depleting target cells (e.g., tumor cells or B cells) in a subject by administering the polypeptide molecules disclosed herein.BRIEF DESCRIPTION OF THE DRAWINGS

[0012] FIGs. 1A-1B provide schematics of exemplary polypeptide molecules with the C-terminus of the anti-TCRp scFv fused to the N-termmal heavy chain (HC) of the anti-TAA Fab-binding domain (FIG. 1A) and the C-terminus of the anti-TCRβ scFv fused to the N-terminal light chain (LC) of the anti-TAA Fab-binding domain (FIG. 1B). TAA, tumor-associated antigen.

[0013] FIGs. 2A-2C show tumor cell viability (left y-axis) and IFNy (FIG. 2A), TNF (FIG.2B), or IL-2 (FIG. 2C) concentration (right y-axis) as a function of PSMA-CD3 polypeptide molecule (PC43) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0014] FIGs. 3A-3C show tumor cell viability (left y-axis) and IFNy (FIG. 3A), TNF (FIG.3B), or IL-2 (FIG. 3C) concentration (right y-axis) as a function of PSMA-CD3 polypeptide molecule (PC44) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0015] FIGs. 4A-4C show tumor cell viability (left y-axis) and IFNy (FIG. 4A), TNF (FIG.4B), or IL-2 (FIG. 4C) concentration (right y-axis) as a function of PSMA-TCRβC1 polypeptide molecule (PC01) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0016] FIGs. 5A-5C show tumor cell viability (left y-axis) and IFNy (FIG. 5A), TNF (FIG.5B), or IL- 2 (FIG. 5C) concentration (right y-axis) as a function of PSMA-TCRβC1 polypeptide molecule (PC02) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0017] FIGs. 6A-6C show tumor cell viability (left y-axis) and IFNy (FIG. 6A), TNF (FIG.6B). or IL-2 (FIG. 6C) concentration (right y-axis) as a function of PSMA-TCRβC2 polypeptide molecule (PC03) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0018] FIGs. 7A-7C show tumor cell viability (left y-axis) and IFNy (FIG. 7 A), TNF (FIG.7B), or IL-2 (FIG. 7C) concentration (right y-axis) as a function of PSMA-TCRβC2 polypeptide molecule (PC04) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0019] FIGs. 8A-8C show tumor cell viability (left y-axis) and IFNy (FIG. 8A), TNF (FIG.8B), or IL-2 (FIG.8C) concentration (right y-axis) as a function of PSMA-TCRβV6-5 polypeptide molecule (PC05) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0020] FIGs. 9A-9C show tumor cell viability (left y-axis) and IFNy (FIG. 9 A), TNF (FIG.9B), or IL-2 (FIG.9C) concentration (right y-axis) as a function of PSMA-TCRβV6-5 polypeptide molecule (PC06) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0021] FIGs. 10A-10C show tumor cell viability (left y-axis) and IFNy (FIG. 10A), TNF (FIG.10B), or IL-2 (FIG. 10C) concentration (right y-axis) as a function of PSMA-TCRβV12-3 / 4 polypeptide molecule (PC07) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0022] FIGs. 11A-11C show tumor cell viability (left y-axis) and IFNy (FIG. 11A), TNF (FIG.11B), or IL-2 (FIG. 11C) concentration (right y-axis) as a function of PSMA-TCRβV12-3 / 4 polypeptide molecule (PC08) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0023] FIGs. 12A-12B show tumor cell viability (left y-axis) and IFNy (FIG. 12A) or IL-2 (FIG. 12B) concentration (right y-axis) as a function of PSMA-TCRPV5-5 / 6 polypeptide molecule (PC09) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0024] FIGs. 13A-13B show tumor cell viability (left y-axis) and IFNy (FIG. 13A) or IL-2 (FIG. 13B) concentration (right y-axis) as a function of PSMA-TCRPV5-5 / 6 polypeptide molecule (PC10) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0025] FIGs. 14A-14C show tumor cell viability (left y-axis) and IFNy (FIG. 14A), TNF (FIG.14B), or IL-2 (FIG. 14C) concentration (right y-axis) as a function of PSMA-TCRβV20-1 polypeptide molecule (PC12) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0026] FIGs. 15A-15B show tumor cell viability (FIG. 15A) and IFNy concentration (FIG.15B) as a function of polypeptide molecule PC11 (PSMA-TCRPV20-1), PCI 2 (PSMA-TCRpV20-l), PC06 (PSMA-TCRpV6-5), or PC08 (PSMA-TCRPVI 2-3 / 4) concentration m a co¬ culture of CD8+ T cells and LNCaP tumor cells.

[0027] FIGs. 15C-15D show IL-2 (FIG. 15C) and TNF (FIG. 15D) concentration as a function of polypeptide molecule PC11 (PSMA-TCRβV20-1), PC12 (PSMA-TCRβV20-1), PC06 (PSMA-TCRβV6-5), or PC08 (PSMA-TCRβV12-3 / 4) concentration in a co-culture of CD8+ T cells and LNCaP tumor cells.

[0028] FIG. 16 shows an exemplary flow cytometry plot of the gating strategy used to determine human T cell memory populations. Tn = naive T cells; Tscm = stem-cell memory; Ttm = transition cell memory; Tcm = central memory; Tern = effector memory; L-Tem = late effector memory; and Temra = effector memory re-expressing CD45RA.

[0029] FIGs. 17A-17B show results of the saturating mutagenesis selection for single pointed mutations on 3LCDRs (FIG. 17A) and 3HCDRs (FIG. 17B) of a wildtype TRBV6-5 binder. The tolerance of a single pointed mutation is determined by average OD of substitution AA / WT AA with a cutoff value of 0.34. A single pointed mutation with a value higher than 0.34 is determined to be tolerated.

[0030] FIGs. 18A-18B show results of the saturating mutagenesis selection for single pointed mutations on 3LCDRs (FIG. 18A) and 3HCDRs (FIG. 18B) of a wildtype TRBV12-3 binder. The tolerance of a single pointed mutation is determined by average OD of substitution AA / WT AA with a cutoff value of 0.5. A single pointed mutation with a value higher than 0.5 is determined to be tolerated.

[0031] FIGs. 19A-19B display exemplary molecule formats for TRBV binding domains. FIG.19A shows exemplary formats for scFv and Fab binding domains. FIG. 19B shows exemplary formats for bispecific molecules.

[0032] FIGs. 20A-20C shows ELISA binding to human (FIG. 20A) and cyno (FIG. 20B) antigens for exemplary mutated Fab constructs against TRBV6-5. Summarized results are displayed in FIG. 20C. Results show that affinity maturation of the original T cell binder strengthened human TRBV6-5 binding affinity by 2-fold but drastically strengthened cyno TRBV6-2 binding by more than 800-fold.

[0033] FIGs. 21A-21F show ELISA binding results for exemplary anti-TRBV6-5 binders: CLY-008, CLY-010, and CLY-013. FIG. 21A shows results for TRBV-Fc proteins, CLY-001 to CLY-005, at 5 ug / mL binding CLY-008 at concentrations from 0-5 pM. FIG. 21 B summarizes the results of FIG.21A. FIG.21C shows results for TRBV-Fc proteins, CLY-001 to CLY-005, at 5 ug / mL binding CLY-010 at concentration from 0-5 pM. FIG. 21 D summarizes the results of FIG. 21C. FIG. 21E shows results for TRBV-Fc proteins, CLY-001 to CLY-005, at 5 ug / mL binding CLY-013 at concentrations from 0-5 pM. FIG. 21F summarizes the results of FIG.21E.

[0034] FIGs. 22A-22H show ELISA binding results for exemplary anti-CD19 and anti-TRBV bi-specific binders, CLY-018 to CLY-024. FIG. 22A shows a summary of binding results for binders CLY-018 to CLY-024 against human CD19 (5 ug / mL) at concentrations from 0-5 pM.FIG. 22B summarizes the results of FIG.22A. FIG.22C shows a summary of binding results for binders CLY-018 to CLY-024 against cyno CD19 (5 ug / mL) at concentrations from 0-5 pM. FIG.22D summarizes the results of FIG. 22C. FIG. 22E shows a summary of binding results for binders CLY-018 to CLY-024, against human TRBV6-5 at 5 ug / mL. FIG. 22F summarizes the results of FIG.22E. FIG.22G shows a summary of binding results for binders CLY-018 to CLY- 024 against cyno TRBV6-2 at 5 ug / mL. FIG.22H summarizes the results of FIG. 22G.

[0035] FIG. 221 shows a summary of binding results for exemplary TRBV12-3 binders, CLY- 034 to CLY-037, against human TRBV12-3. FIG.22J summarizes the results of FIG.221. FIG.22K shows a summary' of binding results for CLY-034 to CLY-037 against cyno TRBV12-3. FIG.22L summarizes the results of FIG.22K.

[0036] FIGs. 23A-23D show results of human cell binding of exemplary anti-CD19 and anti-TRBV bi-specific binders, CLY-018 to CLY-024, by flow cytometry'. FIG. 23 A show’s the cell binding results by flow cytometry to human B cells. FIG. 23B summarizes the results of FIG.23A. FIG. 23C shows the flow cytometry cell binding results to human T cells. FIG. 23D summarizes the results of FIG.23C.

[0037] FIGs. 24A-24D show results of cyno cell binding of exemplary anti -CD 19 and anti-TRBV bi-specific binders, CLY-018 to CLY-024, by flow cytometry, FIG. 24A show's binding results of the binders to cyno B cells. FIG. 24B summarizes the results of FIG. 24A, FIG. 24C shows binding results of the binders to cyno T cells. FIG. 24D summarizes the results of FIG.24C.

[0038] FIGs. 25 A- FIG. 25U show results of functionality assays for exemplary anti-CD19 and anti-TRBV bi-specific binders CLY-018 to CLY-024. FIG. 25A show's normalized B cell count for human PBMC sample and the exemplary binders. FIG. 25B shows results for CD81 TRBV+ for human PBMC sample and the exemplary binders. FIG. 25C shows results for non-Treg CD4+ TRBV+ for human PBMC sample and the exemplary binders. FIG. 25D shows results for T regs for human PBMC sample and the exemplary binders. FIG. 25E summarizes the EC50 values for human B cell killing. FIG. 25F shows expansion of CD8+TRBV+ for CLY-023 binders from human PBMC sample. FIG. 25G show's expansion of CD8+TRBV+ for CLY-018 binders from human PBMC sample. FIG. 25H shows expansion of CD8+TRBV+ for CLY-019 binders from human PBMC sample. FIG. 251 shows expansion of CD8+TRBV+ for CLY-020 binders from human PBMC sample. FIG. 25 J shows expansion of CD8+TRBV+ for CLY-021 binders from human PBMC sample. FIG. 25K show's expansion of CD8+TRBV+ for CLY-022 binders from human PBMC sample. FIG. 25L show's B cell count after treatment of cyno PBMC (donor “326”) w'ith CLY-020, CLY-021, or CLY-024. FIG. 25M summarizes the results of FIG. 25L. FIG. 25N shows B cell count after treatment of cyno PBMC (donor “1611”) with CLY-020, CLY-021, or CLY-024. FIG. 250 summarizes the results of FIG. 25N. FIG. 25P shows CD8+TRBV+ fold change for cyno PBMC (donor “326”) treated with CLY-020, CLY-021, or CLY-024. FIG. 25Q show's CD8+TRBV+ fold change for cyno PBMC (donor “1611”) treated with CLY-020, CLY- 021, or CLY-024. FIG. 25R shows CD4+TRBV+ fold change for cyno PBMC (donor “326”)treated with CLY-020, CLY-021, or CLY-024. FIG. 25S shows CD4+TRBV+ fold change for cyno PBMC (donor “1611”) treated with CLY-020, CLY-021, or CLY-024. FIG. 25T show’s CD8+TRBV+ T cell fold change for cyno PBMC donor “326” treated with CLY-020. FIG. 25U shows CD8+TRBV+ T cell fold change for cyno PBMC donor “1611” treated with CLY-020.

[0039] FIGs.26A-26F show functionality'’ results for assays utilizing exemplary anti-CD19 and anti-TRBV bi-specific binders CLY-023, CLY-018, CLY-019, and CLY-022. FIG. 26A shows average TRBV+CD8+ T cell count for 3 donors treated with CLY-023, CLY-018, CLY-019, or CLY-022 over a 7-day culture, FIG. 26B show's average TRBV+CD4+ T cell count for 3 donors treated with CLY-023, CLY-018, CLY-019, or CLY-022 over a 7-day culture. FIG. 26C shows expansion of TRBV+ CD8+ T cells after 7 day culture with CLY-022, CLY-019, CLY-018, or CLY-023 enriched for TRBV6-1, 6-2, 6-5, and 6-9 (n=3 donor CD8+ T cells), of note is that CLY-022 also expanded TRBV10-3 T cells. FIG. 26D show's expansion of TRBV+ CD4+ T cells after 7 day culture with CLY-022, CLY-019, CLY-018, or CLY-023 enriched for TRBV6-1, 6-2, 6-5, and 6-9 (n=2-3 donor CD4+ T cells), of note is that CLY-022 also expanded TRBV10-3 T cells.FIG. 26E show's expansion of TRAV+- CD8+ T cells after 7 day culture with CLY-022, CLY-019, CLY-018, or CLY-023 indicating no change in relative abundance of TRAVs with TRBV stimulation (n=2-3 donor CD4+ T cells). FIG. 26F shows expansion of TRAV+ CD4+ T cells after 7 day culture with CLY-022, CLY-019, CLY-018, or CLY-023 indicating no change in relative abundance of TRAVs with TRBV stimulation (n=2-3 donor CD4+ T cells).

[0040] FIGs.27A-27R show results of in vivo activity of exemplary anti-CD19 and anti-TRBV bi-specific binders in a cynomolgus monkey model. FIG.27A show's the plasma concentration of CLY-023 for monkeys treated with CLY-023. FIG. 27B shows CD20+ B cell count in blood of monkeys treated with CLY-023. Of note is that minimal B cell depletion was observed in monkeys dosed up to 1 mg / kg IV. FIG. 27 C shows cytokine induction results for monkeys treated with CLY-023 at 0.1 mg / kg, iv. FIG. 27D shows cy'tokine induction results for monkeys treated with CLY-023 at 1 mg / kg, iv. Of note is that no in life observations or signs of cytokine release syndrome in monkeys dosed up to 1 mg / kg IV were detected. FIG. 27E show's the plasma concentration of CLY-024 for monkeys treated with CLY-024 at various concentrations. FIG.27F shows CD20+ B cell count in blood of monkeys treated with CLY-024. Of note is that moderate B cell depletion observed in monkey' dosed at 1 mg / kg IV. Minimal B cell depletion observed at lower doses (< 1 mg / kg IV). FIG. 27G shows cytokine induction results for monkeys treated withCLY-024 at 0.01 mg / kg i.v. FIG.27H shows cytokine induction results for monkeys treated with CLY-024 at 0.1 mg / kg i.v. FIG. 271 shows cytokine induction results for monkeys treated with CLY-024 at 1 mg / kg i.v. No in life observations or signs of cytokine release syndrome in cynomolgus monkeys dosed up to Img / kg IV. FIG.27J shows plasma concentration of CLY-020 in treated monkeys. FIG.27K shows CD20+ B cell count in blood of monkeys treated with CLY- 020 over 28 days. FIG.27L shows cytokine induction in CLY-020-treated monkeys for IL-2, IFN gamma, IL-6 and TNF. FIG. 27M shows plasma concentration of CLY-018 in treated monkeys.FIG. 27N shows CD20+ B cell count in monkeys treated with CLY-018, FIG. 270 shows cytokine induction for monkeys treated with CLY-018 at a concentration of 0.1 mg / kg. FIG. 27P shows cytokine induction for monkeys treated with CLY-018 at 1 mg / kg. FIG. 27Q shows cytokine induction for monkeys treated with CLY-018 at 2.5 mg / kg. FIG. 27R shows cytokine induction for monkeys treated with CLY-018 at 9 mg / kg. No m life observations or signs of cytokine release syndrome in cynomolgus monkeys dosed up to 9mg / kg IV was observed.

[0041] FIGs. 28A-28T show activity of the CLY-018 construct in healthy human PBMCs and PBMCs of autoimmune subjects (e.g., RA, SLE, and MG). FIG. 28A shows average B-cell fold chang e / killing of healthy human PBMC treated with CLY-018 over the course of 7 days. FIG.28B shows average CD4+ T cell fold change of healthy human PBMCs treated with CLY-018.FIG. 28C shows average CD8 + T cell fold change of healthy human PBMC treated with CLY-018 over the course of 7 days. FIG.28D shows average T reg fold change of healthy human PBMC treated with CLY-018 over the course of 7 days. FIG.28E shows results of CD8+ T cell expansion for the Tn, Tscm, Ttm, Tcm, Tern, Teff, and Temra subsets of healthy human PBMCs incubated with CLY-018. FIG. 28F shows average B-cell fold change / killing of PBMC from subjects with RA treated with CLY-018 over 7 days. FIG. 28G shows average CD4+ T cell fold change of PBMC from subjects with RA treated with CLY-018 over 7 days. FIG.28H shows average CD8+ T cell fold change of PBMC from subjects with RA treated with CLY-018. FIG. 281 shows average T reg fold change of PBMC from subjects with RA treated with CLY-018. FIG. 28J shows results of CD8+ T cell expansion for the Tn, Tscm, Ttm, Tcm, Tem, Teff, and Temra subsets of the RA subjects PBMCs incubated with CLY-018. FIG. 28K shows average B-cell fold change / killing of PBMC from 3 SLE subjects treated with CLY-018 over 7 days. FIG.28L shows average CD4+ T cell fold change of PBMC from 3 SLE subjects treated with CLY-018 over 7 days. FIG. 28M shows average CD8+ T cell fold change of PBMC from 3 SLE subjects treatedwith CLY-018. FIG.28N shows average T reg fold change of PBMC from 3 SLE subjects treated with CLY-018. FIG. 280 shows results of CD8+ T cell expansion for the Tn, Tscm, Ttm, Tcm, Tem, Teff, and Temra subsets of the SLE subjects PBMCs incubated with CLY-018. FIG. 28P shows average B-cell fold change of PBMC from 3 MG subjects treated with CLY-018 over 7 days. FIG. 28Q shows average CD4+ T cell fold change of PBMC from 3 MG subjects treated with CLY-018 over 7 days. FIG. 28R shows average CD8+ T cell fold change of PBMC from 3 MG subjects treated with CLY-018. FIG. 28S shows average T reg fold change of PBMC from 3 MG subjects treated with CLY-018. FIG.28T shows results of CD8+ T cell expansion for the Tn, Tscm, Ttm, Tcm, Tem, Teff, and Temra subsets of the MG subjects PBMCs incubated with CLY-018.DETAILED DESCRIPTIONDefinitions

[0042] Unless otherwise defined herein, technical and scientific terms used in the present description have the meanings that are commonly understood by those of ordinary skill in the art. For purposes of interpreting this specification, the following description of terms will apply and whenever appropriate, terms used in the singular will also include the plural and vice versa unless the content clearly dictates otherwise. In the event that any description of a term set forth conflicts with any document incorporated herein by reference, the description of the term set forth below shall control.

[0043] The terms “a”, “an”, and “the”, as used herein, include plural references unless the context clearly dictates otherwise.

[0044] The term “about” or “approximately”, as used herein, in reference to a number or range of numbers, is understood to mean the stated number and numbers + / - 10% thereof, or 10% below the lower listed limit and 10% above the higher listed limit for the values listed for a range (except where such number would exceed 100% of a possible value or go below 0%). It is used to indicate that a value includes the inherent variation of error for the device, or the method being employed to determine the value, or the variation that exists among the samples being measured.

[0045] The term “between”, as used in a phrase as such “between A and B” or “between A-B” refers to a range including both A and B.

[0046] The terms “comprise” and its grammatical equivalents, as used herein, specify the presence of stated features, integers, steps, operations, elements, and / or components, but do notpreclude the presence or addition of one or more other features, integers, steps, operations, elements, components, and / or groups thereof.

[0047] The terms “including”, “includes”, “included”, and other forms, as used herein, are not limiting.

[0048] The terms “or” and “and / or”, as used herein, include any, and all, combinations of one or more of the associated listed items.

[0049] The phrase “any range or subrange therebetween” or equivalents, are used herein to denote the intention that disclosure of any range or series of possible values, inherently also discloses all ranges and subranges encompassed by the highest and lowest values disclosed. This term includes the entire range from highest to lowest disclosed values, as well as subranges from any two or more disclosed points. This term is also intended to disclose any subranges encompassed anywhere within the highest and lowest disclosed values, including between two points that are explicitly recited in the document, up to one decimal point. Thus, disclosure of values 0, 5, 10, 15, 20, including all ranges and subranges therebetween, should be interpreted as also encompassing a range from 0-20, a range from 0-5 or 5-15, as well as a range from 2-16, or 3.1 to 19.8, etc. Unless otherwise indicated, it is to be understood that all numbers expressing quantities, ratios, and numerical properties of ingredients, reaction conditions, and so forth, used in the specification are contemplated to be able to be modified in all instances by the term “including all ranges and subranges therebetween”.

[0050] In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. For example, disclosure of a range of 1 to 10 mM concentration encompasses values of 2, 3, 6, 7, and 9 mM, as well as 1.3, 2.5, and 7.6 mM concentrations.

[0051] The term “polynucleotide” or “nucleic acid”, as used herein, refers to deoxyribonucleic acid (DNA), ribonucleic acid (RNA) and DNA / RNA hybrids. Polynucleotides may be single¬ stranded or double-stranded and either recombinant, synthetic, or isolated. Polynucleotides include but are not limited to: pre-messenger RNA (pre-mRNA), messenger RNA (mRNA), RNA, genomic DNA (gDNA), PCR amplified DNA, complementary DNA (cDNA), synthetic DNA, or recombinant DNA. Polynucleotides can comprise modified nucleotides or bases, and / or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase orby a synthetic reaction. Unless specified otherwise, the left-hand end of any single-stranded polynucleotide sequence disclosed herein is the 5’ end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5’ direction. The direction of 5’ to 3’ addition of nascent RNA transcripts is referred to as the transcription direction.

[0052] The term “coding sequence” or a polynucleotide which “encodes” a polypeptide or polypeptide molecule, as used herein, is a nucleic acid molecule which is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide or polypeptide molecule when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a start codon at the 5’ (amino) terminus and a translation stop codon at the 3’ (carboxy) terminus. A transcription termination sequence may be located 3’ to the coding sequence,

[0053] The terms “polypeptide” and “peptide” and “protein”, as used herein, refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid, including but not limited to, unnatural amino acids, as well as other modifications known in the art.

[0054] The terms “amino-terminal” and “carboxyl-terminal” are used herein to denote positions within the polypeptide molecules described herein. Where the context allows, these terms are used with reference to a particular sequence or portion of a polypeptide molecule to denote proximity or relative position.

[0055] The term “disulfide bond”, as used herein, refers to the covalent linkage between the thiol groups of two cysteine residues. The specific position / location of the disulfide bond can be defined using the location of the two cysteine residues within a protein or polypeptide. For instance, a VH44-VL100 disulfide bond in a TCRβV-binding domain of a polypeptide molecule refers to a disulfide bond formed between the cysteine residue at amino acid position 44 of the VH region of the TCRβV-binding domain and the cysteine residue at amino acid position 100 of the VL region of the TCRβV-binding domain. Similarly, a VH100B-VL49 disulfide bond of a TCRβV-binding domain of a polypeptide molecule refers to a disulfide bond formed between the cysteine residueat amino acid position 100B of the VH region of the TCRβV-binding domain and the cysteine residue at amino acid position 49 of the VL region of the TCRβV-binding domain. It is well known to a skilled artisan that antibodies have different HCDR3 lengths and additional residues may occur between positions VH100 and VH101 that can be numbered with a letter from A to K according to the Kabat numbering scheme (e.g., VH100A, VH100B, VH100C... H100K).

[0056] The term “peptide linker”, as used herein, generally refers to a short polypeptide sequence connecting two sub-domains of a polypeptide. Non-limiting examples of peptide linkers include flexible linkers comprising glycine-serine repeats, and peptide linkers derived from (a) an interdomain region of a transmembrane protein (e.g., a type I transmembrane protein); (b) a stalk region of a type II C-lectin; or (c) an immunoglobulin hinge. In some embodiments, a linker provides a spacer function compatible with interaction of the two sub-binding domains so that the resulting polypeptide retains a specific binding affinity to the same target molecule as an antibody that comprises the same light and heavy chain variable regions. In some embodiments, the linker connects two or more binding domains (e.g., the TCRβV-binding domain and the CD19-binding domain). In some embodiments, the linker connects a binding domain with a half-life extension moiety. In some embodiments, the linker connects a VH region of an scFv and a VL region of an scFv. In some embodiments, the linker connects a VH region of an scFv and a VL region of an scFv.

[0057] The term “variant”, when used in relation to a polypeptide, refers to a polypeptide comprising one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) ammo acid sequence substitutions, deletions, and / or insertions as compared to a wildtype or parental amino acid sequence. Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed. Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding the variants.

[0058] The term “antigen,” as used herein, refers to a structure to which an antibody or an antibody fragment can specifically bind. An antigen may be a polypeptide, carbohydrate, nucleic acid, lipid, hapten, or other naturally occurring or synthetic compound.

[0059] The term “antigen-binding domain,” as used herein, refers to a portion of a polypeptide molecule that specifically binds a target antigen or target epitope. Antigen-binding domains may comprise antibodies or antigen-binding fragments thereof.

[0060] The term “antigen-binding fragment,” as used herein, refers to a portion of an antibody heavy and / or light chain polypeptide that retains some or all of the binding activity of the antibody from which the fragment was derived. An antigen-binding fragment may comprise 1, 2, 3, 4, 5, or all 6 CDRs of a variable heavy chain (VH) region and / or variable light chain (VL) region. Non¬ limiting examples of functional fragments include single-chain Fvs (scFv), Fab fragments, CrossFab fragments, F(ab’) fragments, F(ab)2 fragments, F(ab’)2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody. Such functional antigen -binding fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol, Biology and Biotechnology: A Comprehensive Desk Reference (Myers, ed., 1995); Huston, etal, 1993, Cell Biophysics 22:189-224; Pluckthun and Skerra, 1989, Meth. Enzymol. 178:497-515; and Day, Advanced Immunochemistrv (2d ed. 1990),

[0061] The term “antibody,” “immunoglobulin,” or “Ig” is used interchangeably herein, and is used in the broadest sense and specifically covers, for example, monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with poly epitopic or monoepitopic specificity, polyclonal or monovalent antibodies, multivalent antibodies, and multi -specific antibodies (e.g., bispecific antibodies). A conventional antibody is composed of two identical pairs of polypeptide chains, wherein each pair has one heavy chain (about 50-70 kDa) and one light chain (about 25 kDa), each amino-terminal portion of each chain includes a variable region of about 100 to about 130 or more amino acids, and each carboxy¬ terminal portion of each chain includes a constant region. See, e.g., Antibody Engineering (Borrebaeck, ed., 2d ed. 1995); and Kuby, Immunology' (3d ed. 1997). An antibody can be human, humanized, chimeric and / or affinity matured, as well as an antibody from a different species, for example, mouse, rabbit, etc. Antibodies also include, but are not limited to, synthetic antibodies, recombinantly produced antibodies, camelized antibodies or their humanized variants, and intrabodies. An antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgGl, IgG2, IgG3 and IgG4 (e.g., variants of IgG4 and IgG4 nullbody). An antibody can comprise kappa or lambda light chain constant sequences.

[0062] The term “Fab” or “Fab region”, as used herein, refers to an antibody region that binds to an antigen. A conventional IgG usually comprises two Fab regions, each residing on one of the two arms of the Y-shaped IgG structure. Each Fab region is typically composed of one variable region and one constant region of each of the heavy' and the light chain. More specifically, thevariable region and the constant region of the heavy chain in a Fab region are VH and CHI regions, and the variable region and the constant region of the light chain in a Fab region are VL and CL regions. The VH, CHI, VL, and CL in a Fab region can be arranged in various ways to confer an antigen binding capability. For example, VH and CHI regions can be on one polypeptide, and VL and CL regions can be on a separate polypeptide, similarly to a Fab region of a conventional IgG. Alternatively, VH, CHI, VL and CL regions can all be on the same polypeptide and oriented in different orders.

[0063] The term “single-chain variable fragment (scFv)”, as used herein, refers to a fusion protein of the variable heavy chain (VH) and the variable light chain (VL) of an antibody, connected with a short scFv linker peptide. In some embodiments, the scFv linker is about 5 amino acids to about 30 amino acids in length. In some embodiments, the scFv linker is rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH region with the C -terminus of the VL region, or vice versa. scFvs retain the specificity of the original antibody, despite removal of the constant regions and the introduction of the scFv linker. scFvs are, described in e.g., Houston, J. S., Methods in Enzymol. 203 (1991) 46-96).

[0064] The term “heavy chain”, when used in reference to an antibody, refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy -terminal portion includes a constant region. The constant region can be one of five distinct types, (e.g, isotypes) referred to as alpha, delta, epsilon, gamma, and mu, based on the ammo acid sequence of the heavy chain constant region. The distinct heavy chains differ in size: alpha, delta, and gamma contain approximately 450 amino acids, while epsilon and mu contain approximately 550 amino acids. When combined with a light chain, these distinct types of heavy chains give rise to five well known classes (e.g., isotypes) of antibodies, IgA, IgD, IgE, IgG, and IgM, respectively, including four subclasses of IgG, namely IgGl, IgG2, IgG3, and IgG4.

[0065] The term “light chain”, when used in reference to an antibody, refers to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy -terminal portion includes a constant region. The approximate length of a light chain is 211 to 217 amino acids. There are two distinct types, referred to as kappa or lambda based on the amino acid sequence of the constant domains.

[0066] The term “constant region” or “constant domain,” as used herein, refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor. This portion has a more conserved amino acid sequence relative to the variable region. The constant region may contain the CHI, CH2, and CH3 regions of the heavy chain and the CL region of the light chain.

[0067] The term “variable region”, “variable domain”, “V region”, or “V domain”, as used herein, refers to a portion of the light or heavy chains of an antibody that is generally located at the amino-terminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen. The variable region of the heavy chain may be referred to as “VH.” The variable region of the light chain may be referred to as “VL.” The term “variable” refers to the fact that certain segments of the variable regi ons differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the 110-amino acid span of the variable regions. Instead, the V regions consist of less variable (e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called “hypervariable regions” or “complementarity determining regions” that are each about 9-12 amino acids long. The variable regions of heavy and light chains each comprise four FRs, largely adopting a β sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases form part of, the β sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, e.g., Kabat et al, Sequences of Proteins of Immunological Interest (5th ed. 1991)).

[0068] The complementarity determining regions (CDRs) have been defined by well-known numbering systems. For example, the Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat, et al., supra). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol., 1987, 196:901-17). The end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this isbecause the Kabat numbering scheme places insertions atH35AandH35B; if neither 35Anor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Antibody Engineering Vol. 2 (Rontermann and Diibel, eds., 2d ed.2010)). The “contact” CDRs are based on an analysis of the available complex crystal structures. Another universal numbering system that has been developed and widely adopted is ImMunoGeneTics (IMGT) Information System® (Lafranc, et al, Dev. Comp. Immunol,, 2003, 27(1): 55-77). IMGT is an integrated information system specializing in immunoglobulins (IG), T-cell receptors (TCR), and major histocompatibility complex (MHC) of human and other vertebrates. An additional numbering system (AHon) has been developed by Honegger and Pluckthun, J. Mol, Biol., 2001, 309: 657-70. Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art (see, e.g., Kabat, supra, Chothia and Lesk, supra; Martin, supra, Lefranc, et al., supra).

[0069] The boundaries of a given CDR may vary depending on the scheme used for identification. Thus, unless otherwise specified, the CDRs of a given antibody or region thereof, such as a variable region, should be understood to encompass the complementary determining region as defined by any of the known schemes described herein. In some instances, the scheme for identification of a particular CDR or CDRs is specified, such as the CDR as defined by the Kabat, Chothia, or Contact method. In other cases, the particular amino acid sequence of a CDR is given. In some embodiments, a combination of CDR numbering systems may be used. In such embodiments, CDR sequences of a given binding domain or polypeptide molecule as determined by multiple numbering systems (e.g., a CDR1 sequence as determined by the Kabat, IMGT, and Chothia numbering systems) are compiled into a single sequence that encompasses the entirety of each of the CDR amino acid ranges in the variable region.

[0070] As the “location” of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues are readily identified. This information can be used in grafting and replacement of CDRresidues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody.

[0071] The term “polypeptide molecule,” as used herein, refers to a polypeptide or complex of polypeptides comprising at least one binding domain that specifically binds to a target. In some embodiments, the polypeptide molecule is a multi-specific polypeptide molecule. As used herein, a “multi-specific polypeptide molecule” refers to a polypeptide comprising two or more binding domains each capable of specifically binding to a target. For example, the polypeptide molecules described herein may comprise 2, 3, 4, or more binding domains and may be able to bind 2, 3, 4, or more targets. In some embodiments, the polypeptide molecule comprises a first binding domain that specifically binds to a T cell receptor beta variable region (TCRpV) or a T cell receptor beta constant region (TCR^C) expressed on a T cell. In a further embodiment, the polypeptide molecule comprises a second binding domain specifically binding to a tumor-associated antigen (TAA), such as CD 19 or PSMA.

[0072] The term “vector”, as used herein, refers to a substance that is used to carry or introduce a nucleic acid sequence (e.g., a nucleic acid sequence encoding polypeptide molecule as described herein) into a host cell. Vectors applicable for use include, for example, plasmids, phage vectors, viral vectors, episomes, and artificial chromosomes. A vector may include sequences that direct autonomous replication in a cell, or may include sequences sufficient to allow integration into host cell DNA. Additionally, the vectors can include one or more selectable marker genes and appropriate expression control sequences. Selectable marker genes that can be included, for example, provide resistance to antibiotics or toxins, complement auxotrophic deficiencies, or supply critical nutrients not in the culture media. Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like, which are well known in the art. When two or more nucleic acid molecules are to be coexpressed (e.g., both an antibody heavy and light chain or an antibody VH and VL), both nucleic acid molecules can be inserted, for example, into a single expression vector or in separate expression vectors. For single vector expression, the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences. The introduction of nucleic acid molecules into a host cell can be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as Northern blots or polymerase chain reaction (PCR) amplification of mRNA, immunoblotting forexpression of gene products, or other suitable analytical methods to test the expression of an introduced nucleic acid sequence or its corresponding gene product. It is understood by those skilled in the art that the nucleic acid molecules are expressed in a sufficient amount to produce a desired product and it is further understood that expression levels can be optimized to obtain sufficient expression using methods well known in the art.

[0073] The term “binds” or “binding,” as used herein, refers to a covalent or non-covalent interaction between molecules (e.g, forming a complex by interactions). Exemplary non-covalent interactions include hydrogen bonds, ionic bonds, hydrophobic interactions, and / or van der Waals interactions. Terms such as “specific binding,” “specifically binds to,” or “is specific for” means that a binding domain or a polypeptide molecule comprising a binding domain binds the target with an affinity or Ka (i.e., an equilibrium association constant of a particular binding interaction with units of 1 / M) equal to or greater than 105M'1, while not significantly binding other components present in a test sample,

[0074] The term “binding affinity,” as used herein, refers to the strength of the sum total of noncovalent interactions between a binding domain X and its binding partner Y. Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1: 1 interaction between members of a binding pair (e.g., antibody and antigen). Binding domains can be classified as “high affinity” binding domains and “low affinity” binding domains. “High affinity” binding domains refer to those binding domains with a Kaof at least 107M’1, at least 10sM”, at least 109M'1, at least 1010M”, at least 10” M'1, at least 1012M”, or at least 1013M”. “Low affinity” binding domains refer to those binding domains with a Ka of up to 107M'1, up to 106M‘ ', up to 105M'1. High affinity binding domains generally bind the binding partners faster and tend to remain bound longer, whereas low affinity binding domains generally bind the binding partners slowly and tend to dissociate readily. Affinity can also be defined as an equilibrium dissociation constant (Ka) of a particular binding interaction with units of M (e.g, 10‘5M to 10‘13, or about 1000 nM, about 900 nM, about 800 nM, about 700 nM, about 600 nM, about 500 nM, about 300 nM, about 250 nM, about 200 nM, about 150 nM, about 100 nM, about 50 nM, about 25 nM, about 10 nM, or about 5 nM). Affinities of binding domains according to the present disclosure can be readily determined using conventional techniques (see, e.g., Scatchard et al. (1949) Ann. N. Y. Acad. Sci. 51:660; and U. S. Patent Nos. 5,283,173, 5,468,614, or the equivalent).

[0075] The term “cytokine”, as used herein, refers to small proteins or variants thereof that act as signaling molecules to regulate immunity, inflammation, and hematopoiesis. Cytokines include chemokines, interferons, interleukins, lymphokines, and tumor necrosis factors. Specific examples of cytokines include interleukin-2 (IL-2), interleukin-7 (IL-7), interleukin- 10 (IL- 10), interleukin- 12 (IL-12), interleukin- 15 (IL-15), interleukin- 18 (IL-18), interleukin-21 (IL-21), interferon gamma (IFN-y), or combinations or variants thereof.

[0076] The term “subject”, as used herein, refers to an “animal” and in particular a “mammal” such as a non-primate (e.g, mice, rats, bovines, horses, household cats, tigers and other large cats, dogs, pigs, rabbits, goats, deer, sheep, ferrets, gerbils, guinea pigs, hamsters, bats, and birds (e.g, chickens, turkeys, and ducks)) or a primate (e.g., monkeys, baboons, chimpanzees, and human). The term may be used interchangeably with the term “patient” or “individual”. In some embodiments, the subject is a mammal, e.g., a human, diagnosed with a disease or disorder provided herein. In some embodiments, the subject is a mammal, e.g., a human, at risk of developing a disease, disorder, or condition described herein. In some embodiments, the subject is human. The term does not denote a particular age or sex. Thus, individuals of all ages, from newborn to adult, whether male or female, are intended to be covered.

[0077] The term “administer”, “administration”, or “administering,” as used herein refers to the act of injecting or otherwise physically delivering a substance (e.g., a polypeptide molecule or pharmaceutical composition thereof) to a subject (e.g, human), such as by oral, mucosal, topical, intradermal, parenteral, intravenous, intravitreal, intraarticular, subretinal, intramuscular, intrathecal delivery and / or any other method of physical delivery described herein or known in the art. The delivery can be systemic or to a specific tissue.

[0078] The term “effective amount”, as used herein, refers to an amount of a therapeutic (e.g., a pharmaceutical composition provided herein) which is sufficient to prevent, diagnose, treat, delay the onset of, reduce and / or ameliorate the severity, duration, advancement, and / or recurrence of a given condition, disorder or disease and / or a symptom related thereto. The term also encompasses an amount necessary to improve or enhance the prophylactic or therapeutic effect (s) of another therapy or to serve as a bridge to another therapy.

[0079] The term “prevent”, as used herein, refers to a pharmaceutical or other intervention regimen for reducing the likelihood of the onset (or recurrence) of a disease, disorder, condition, or associated symptom(s).

[0080] The term “population” of cells, as used herein, refers to any number of cells greater than 1, for example, at least about IxlO3cells, at least about 1x104cells, at least about 1x105cells, at least about 1x10° cells, at least about IxlO7cells, at least about IxlO8cells, at least about IxlO9cells, at least about IxlO10cells, at least about IxlO11or more cells. A population of cells may refer to an in vitro population (e.g, a population of cells in culture) or an in vivo population (e.g., a population of cells residing in a particular tissue).

[0081] The term “effector T cell”, as used herein, refers to active form of T cells that have relatively short lifespans and carry out the functions of an immune response. Effector T cells can be cytotoxic (CD8+), helper (CD4+, non-reg), and regulatory T cells. Specific types of effector T cells include effector memory T cells (TEM), T effector cells (TEFF), and T effector cells reexpressing CD45RA (TEMRA). In some embodiments, the effector T cell is TCRPV+. In some embodiments, the effector T cell is TCRaV+

[0082] The term “memory T cell”, as used herein, refers to long-lived T cells that remain in the body after a pathogen has been cleared. Memory T cells are highly capable of responding to antigens upon reintroduction. Specific types of memory T cells include central memory T cells (TCM), T memory stem cells (TSCM), and transitional memory T cells (TTM).

[0083] The term “cytotoxicity”, as used herein, refers to an ability of an effector cell to kill a target cell. In some embodiments, the effector cell is a TCRPV+ T cell. In some embodiments, the effector cell is a TCRaV + T cell. In some embodiments, the target cell is a B cell, such as a CD19+ B cell. In some embodiments, the target cell is a PSMA+ cell.

[0084] The term “durability”, as used herein, refers to the ability of a I cell, or population of T cells, to maintain their effector function (i.e., ability to kill a target cell) and / or the capacity of a T cell to expand and differentiate in a subject or sample.

[0085] The term “contact”, as used in the context of contacting a target cell with a polypeptide molecule described herein, is intended to include incubating the target cell and the polypeptide molecule together in vitro, or administering the polypeptide molecule to a subject where the polypeptide molecule “contacts” the target cell in vivo.

[0086] The term “pharmaceutical composition” or “therapeutic composition”, as used herein, refers to a composition capable of being administered to a subject for the treatment of a particular disease or disorder.

[0087] The term “pharmaceutically acceptable excipient, carrier or diluent,” as used herein, refers to any substance formulated alongside the active ingredient (i.e., the polypeptide molecule) of a pharmaceutical composition that allows the active ingredient to retain biological activity and is non-reactive with the subject’s immune system. Such a substance can be included for the purpose of long-term stabilization, bulking up solid formulations that contain potent active ingredients in small amounts, or to confer a therapeutic enhancement on the active ingredient in the final dosage form, such as facilitating absorption, reducing viscosity, or enhancing solubility. The selection of appropriate substance can depend upon the route of administration and the dosage form, as well as the active ingredient and other factors. Compositions having such substances can be formulated by well-known conventional methods (see, e.g., Remington, The Science and Practice of Pharmacy, 23rd edition, A, Adejare, ed,, Academic Press, 2020).

[0088] As used herein, the term “sequence identity” refers to the extent to which two optimally aligned polynucleotides or polypeptide sequences are invariant throughout a window of alignment of residues, e.g,, nucleotides or amino acids. An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical residues which are shared by the two aligned sequences divided by the total number of residues in the reference sequence segment, i.e., the entire reference sequence or a smaller defined part of the reference sequence. “Percent identity” is the identity fraction times 100. Comparison of sequences to determine percent identity can be accomplished by a number of well-known methods, including for example by using mathematical algorithms, such as, for example, those in the BLAST suite of sequence analysis programs. Unless noted otherwise, the term “sequence identity” in the claims refers to sequence identity as calculated by Clustal Omega® using default parameters.

[0089] General methods in molecular and cellular biochemistry can be found in such standard textbooks as Molecular Cloning: A Laboratory Manual, 3rd Ed. (Sambrook et al., HaRBor Laboratory Press 2001 ); Short Protocols in Molecular Biology, 4th Ed. (Ausubel et al. eds., John Wiley & Sons 1999); Protein Methods (Bollag et al., John Wiley & Sons 1996); Nonviral Vectors for Gene Therapy (Wagner et al. eds., Academic Press 1999); Viral Vectors (Kaplift & Loewy eds., Academic Press 1995); Immunology Methods Manual (I. Lefkovits ed., Academic Press 1997); and Cell and Tissue Culture: Laboratory Procedures in Biotechnology (Doyle & Griffiths, John Wiley & Sons 1998), the disclosures of which are incorporated herein by reference.Polypeptide Molecules

[0090] In some embodiments, the present disclosure provides a polypeptide molecule comprising at least one binding domain. In some embodiments, the polypeptide molecules comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 binding domains, including any ranges and subranges therebetween. In some embodiments the polypeptide molecule of the present disclosure comprises a first binding domain is a T cell binding domain and a second binding domain that is a is a tumor- associated antigen (TAA) binding domain. In some embodiments the polypeptide molecule comprises a T cell binding domain, a TAA binding domain, and a half-life extending moiety. In some embodiments, the half-life extending moiety comprises a binding domain (such as an albumin binding domain). In some embodiments, the polypeptide molecule comprises linkers connecting the various binding domains.

[0091] In some embodiments, any one of the binding domains within the polypeptide molecule comprises a Fab. In some embodiments, any one of the binding domains within the polypeptide molecule is an scFv. In some embodiments, the T cell-binding domain is a TCRβV-binding domain (e.g., a TCRβV6-5-binding domain or a TCRβV12-3-binding domain). In some embodiments, the T cell-binding domain is a TCRβC-binding domain (e.g., a TCRβC1-binding domain or a TCRβC2-binding domain). In some embodiments, the binding domain is a tumor-associated antigen (TAA) binding domain (e.g., a PSMA-binding domain or a CD19-binding domain).

[0092] In some embodiments, the polypeptide molecule of the present disclosure comprises at least one binding domain. In some embodiments, any one of the binding domains comprise an immunoglobulin molecule. In some embodiments, the immunoglobulin molecule is an antibody or antibody fragment. In some embodiments, any one of the binding domains is a full-length antibody, e.g., a polyclonal or monoclonal antibody. In some embodiments, any one of the binding domains is an antibody fragment, such as, e.g., a single domain antibody (sdAb, also referred to as a VHH antibody or nanobody), single-chain variable fragment (scFv), Fc, scFv-Fc, Fv, Fab, Fab', or F(ab′)₂.. In some embodiments, any one of the binding domains is a chimeric antibody. In some embodiments, the binding domain is a humanized antibody. In some embodiments, the binding domain is a T cell-binding domain. In some embodiments, the T cell-binding domain is a TCRβV-binding domain. In some embodiments, the T cell-binding domain is a TCR C-binding domain. In some embodiments, the binding domain is a TAA-binding domain. In some embodiments, the TAA-binding domain is a CD19-binding domain.

[0093] In some embodiments, the polypeptide molecule comprises at least one binding domain and the binding domain comprises a heavy chain. In some embodiments, the heavy chain is an IgA, IgD, IgE, IgG, or IgM heavy chain. In some embodiments, the heavy chain is a subclass of IgA, IgD, IgE, IgG, or IgM, such as, e.g., IgG₁, IgG₂, IgG₃, IgG4, IgA₁, and IgA₂. In some embodiments, the binding domain comprises an IgGl heavy chain. In some embodiments, the binding domain comprises an IgG4 heavy chain.

[0094] In some embodiments, the polypeptide molecule comprises an immunoglobulin constant region. The immunoglobulin constant region or a portion thereof may be obtained from a number of different sources. In some embodiments, an immunoglobulin constant region or a portion thereof is derived from a human immunoglobulin. In some embodiments, an immunoglobulin constant region or a portion thereof is derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g., a mouse, rat, rabbit, guinea pig) or non-human primate (e.g., chimpanzee, macaque) species. Moreover, the immunoglobulin constant region or a portion thereof may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3 and IgG4. In some embodiments, the immunoglobulin constant region is derived from human isotype IgGl.

[0095] A variety of the immunoglobulin constant region gene sequences (e.g., human constant region gene sequences) are available in the form of publicly accessible deposits. Constant region domains sequence can be selected having a particular effector function (or lacking a particular effector function) or with a particular modification to reduce immunogenicity. Many sequences of antibodies and antibody-encoding genes have been published and suitable Ig constant region sequences (e.g., hinge, CH2, and / or CH3 sequences, or portions thereof) can be derived from these sequences using art recognized techniques. The genetic material obtained using any of the foregoing methods may then be altered or synthesized to obtain polypeptides of the present disclosure. It will further be appreciated that the scope of this disclosure encompasses alleles, variants and mutations of constant region DNA sequences.

[0096] In some embodiments, the polypeptide molecule comprises an immunoglobulin constant region or a portion thereof. An immunoglobulin constant region is comprised of domains denoted CH (constant heavy) domains (CHI, CH2, etc.). Depending on the isotype, (i.e., IgG, IgM, IgA IgD, or IgE), the constant region can be comprised of three or four CH domains. Some isotypes(e.g, IgG) constant regions also contain a hinge region. See Janeway et al. 2001, Immunobiology, Garland Publishing, N. Y., N. Y.

[0097] In some embodiments, the immunoglobulin constant region includes all domains and the hinge region or portions thereof. In some embodiments, the immunoglobulin constant region or a portion thereof comprises a CH2 domain, a CH3 domain, and a hinge region, i.e., an Fc region or an FcRn binding partner.

[0098] In some embodiments, the polypeptide molecule comprises an Fc region. In some embodiments, the Fc region may comprise one or more of the CH2, CH3, and CH4 domains, as well as the hinge region. In some embodiments, fusion proteins comprising an Fc region of an immunoglobulin bestow several desirable properties on a fusion protein including increased stability, increased serum half-life (see Capon et al,, 1989, Nature 337:525) as well as binding to Fc receptors such as the neonatal Fc receptor (FcRn) (U. S. Pat. Nos. 6,086,875, 6,485,726, 6,030,613; WO 03 / 077834; US2003-0235536A1).

[0099] In some embodiments, the Fc region of the polypeptide molecule comprises two polypeptide chains. In some embodiments, each polypeptide chain is derived from an antibody heavy chain. In some embodiments, both polypeptide chains of the Fc region have the same domain organization (e.g., comprising a CH2 domain and a CH3 domain).

[0100] In some embodiments, the Fc region of the polypeptide molecule comprises a CH2 domain (about amino acids 231-340 of an antibody Fc region according to EU numbering), and a CH3 domain (about amino acids 341-438 of an antibody Fc region according to EU numbering). In some embodiment, the Fc region comprises a hinge (e.g, upper, middle, and / or lower hinge region) domain (about amino acids 216-230 of an antibody Fc region according to EU numbering), a CH2 domain, and a CH3 domain. In some embodiments, the Fc region comprises a hinge, a CH2 domain, a CH3 domain, and a CH4 domain. In some embodiments, the Fc region comprises at least one of: a hinge, a CH2 domain, a CH3 domain, and a CH4 domain, or a variant, portion, or fragment thereof. In some embodiments, the Fc region comprises a hinge domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), a hinge domain (or a portion thereof) fused to a CH2 domain (or a portion thereof), a CH2 domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), or a CH2 domain (or a portion thereof) fused to both a hinge domain (or a portion thereof) and a CH3 domain (or a portion thereof). In some embodiments, the Fc regionlacks at least a portion of a CH2 domain (eg., all or part of a CH2 domain). In some embodiments, the Fc region comprises or consists of amino acids corresponding to EU numbers 221 to 447.

[0101] In some embodiments, the Fc region of the polypeptide molecule is derived from a human immunoglobulin. In some embodiments, an Fc region is derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g., a mouse, rat, rabbit, guinea pig) or non-human primate (e.g., chimpanzee, macaque) species. In some embodiments, the Fc region is derived from any immunoglobulin class, including IgM, IgG, IgD, IgA and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3 and IgG4, In some embodiments, it is derived from the human isotype IgGl,

[0102] In some embodiments, the polypeptide molecule of the present disclosure is a monospecific antibody, F(ab′)₂, F(ab′)₃, a bispecific antibody, a CrossFab’, a trispecific antibody, a minibody, a diabody, a bispecific-scFv, a triabody, or a tetrabody. In some embodiments, the polypeptide molecule is a bispecific polypeptide molecule. In some embodiments, the polypeptide molecule is a full length antibody or antibody fragment that binds more than one antigen. In some embodiments, the polypeptide molecule is a full length antibody or antibody fragment that binds two antigens.

[0103] In some embodiments, the polypeptide molecule of the present disclosure comprises at least one binding domain. In some embodiments, the binding domain is an scFv. In some embodiments, the C-terminus of the VII region is linked to the N-terminus of the VL region. In some embodiments, the C-terminus of the VL region is linked to the N-terminus of the VH region. In some embodiments, the VH region and the VL region are linked by a peptide linker. In some embodiments, the peptide linker comprises the formula of (Gly4Ser)n, wherein n = 1-5 (SEQ ID NO: 1424). In some embodiments, the peptide linker is (Gly4Ser)3 (SEQ ID NO: 1342). In some embodiments, the peptide linker is (Gly4Ser)i (SEQ ID NO: 1425).

[0104] In some embodiments, the polypeptide molecule of the present disclosure comprises at least one binding domain. In some embodiments, the binding domain comprises a Fab comprising a VH region, a VL region, a first heavy chain constant region (CHI), and a light chain constant region (CL), wherein the C-terminus of the VH region is connected to the N-terminus of the CHI region, and the C-terminus of the VL region is connected to the N-terminus of the CL region.

[0105] In some embodiments, the polypeptide molecule of the present disclosure comprises at least one binding domain. In some embodiments, the binding domain is a CrossFab comprising aVH region, a VL region, a first CHI region, and a CL region, wherein the C-terminus of the VH region is connected to the N-terminus of the CL region, and the C-terminus of the VL region is connected to the N-terminus of the CHI region. In some embodiments, the CHI region and the CL region are connected by a disulfide bond. In some embodiments, the binding domain is a charge steering Fab or charge steering CrossFab. In some embodiments, a CHI region of the charge steering Fab or charge steering CrossFab comprises mutations K147E and / or K213E according to EU numbering, and a CL region of the charge steering Fab or charge steering CrossFab comprises mutations E123R and / or Q124K according to EU numbering,

[0106] In some embodiments, the polypeptide molecule comprises at least one binding domain, and the binding domain comprises: (a) an immunoglobulin heavy chain variable (VH) region comprising a heavy chain complementarity determining region (CDR) 1 (HCDR1), a heavy chain CDR2 (HCDR2), and a heavy chain CDR3 (HCDR3); and (b) an immunoglobulin light chain variable (VL) region comprising a light chain complementarity determining region (CDR) 1 (LCDR1), a light chain CDR2 (LCDR2), and a light chain CDR3 (LCDR3) In some embodiments, the polypeptide molecule comprises at least one binding domain, and the binding domain comprises: (a) a VH region comprising a HCDR1, a HCDR2, and a HCDR3; and (b) a VL region comprising a LCDR1, a LCDR2, and a LCDR3.

[0107] In some embodiments, the polypeptide molecule comprises at least one binding domain, and the binding domain comprises a light chain. In some embodiments, the light chain is a kappa light chain. In some embodiments, the light chain is a lambda light chain.

[0108] The polypeptide molecules described herein can be subject to modification to generate enhanced polypeptide molecules. The polypeptide molecules may be modified via a number of methodologies. Amino acid sequence modification(s) of sequences coding for the disclosed polypeptide molecules, and their binding domains and / or half-life extension moieties, are contemplated. These modifications can increase bio-longevity, alter any secretory characteristics, etc. In addition, it may be desirable to improve the binding affinity of binding domains to their corresponding binding targets; it may also be desirable to improve other biological properties, including but not limited to specificity, thermostability, expression level, or solubility.

[0109] In some embodiments, the polypeptide molecules, binding domains, or half-life extension moieties provided herein are chemically modified, for example, by the covalent attachment of any type of molecule to the polypeptide molecules, binding domains, or half-lifeextension moieties. Exemplary non-limiting modifications include glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting / blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc.

[0110] In some embodiments, the modification in the polypeptide molecule, or their binding domain or half-life extension moiety, is a substitution, deletion, or insertion of one or more amino acids that results in a change in the ammo acid sequence as compared to a parental or wildtype sequence. The variation may be determined by systematically making insertions, deletions, or substitutions of amino acids in the parental or wildtype sequence and testing the resulting variants for activity exhibited by the parental or wildtype sequence.

[0111] Substitution of one or more CDR residues or omission of one or more CDRs is also contemplated. Antibodies have been described in the scientific literature in which one or two CDRs can be dispensed with for binding. Padlan et al. (1995 FASEB J. 9: 133-139) analyzed the contact regions between antibodies and their antigens, based on published crystal structures, and concluded that only about one fifth to one third of CDR residues actually contact the antigen. Padlan also found many antibodies in which one or two CDRs had no amino acids in contact with an antigen (see also, Vajdos et al. 2002 J Mol Biol 320:415-428).

[0112] CDR residues not contacting antigen can be identified based on previous studies (for example residues H60-H65 in CDRH2 are often not required), from regions of Kabat CDRs lying outside Chothia CDRs, by molecular modeling and / or empirically. If a CDR or residue(s) thereof is omitted, it is usually substituted with an amino acid occupying the corresponding position in another human antibody sequence or a consensus of such sequences. Positions for substitution within CDRs and amino acids to substitute can also be selected empirically.

[0113] Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and / or chemical properties, such as the substitution of a leucine with a serine, e.g., conservative amino acid replacements. Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a polypeptide molecule provided herein, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis which results in amino acid substitutions.

[0114] A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art. These familiesinclude amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g, tyrosine, phenylalanine, tryptophan, histidine). Table 1 below lists exemplary conservative amino acid substitutions.Table 1. Conservative SubstitutionsOriginal AA Conservative SubstitutionAla SerArg Lys; GinAsn Gin; HisAsp GluCys SerGln Asn, LysGlu AspGly ProHis Asn; GinIle Leu; ValLeu Ile; ValLys Arg; GlnMet Leu; IlePhe Met; Leu; TyrSer ThrThr SerTrp TyrTyr Trp; PheVal Ile; Leu

[0115] Alternatively, mutations in the polypeptide molecule, binding domain, or half-life extension moiety can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity. Following mutagenesis, the encoded protein can be expressed, and the activity of the protein can be determined.

[0116] Substantial modifications in the biological properties of the polypeptide molecule are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. The substitutions which in general are expected to produce the greatestchanges in the polypeptide properties will be those in which (a) a hydrophilic residue, e.g. seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g. leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g, phenylalanine, is substituted for (or by) one not having a side chain, e.g., glycine, in this case, (e) by increasing the number of sites for sulfation and / or glycosylation.

[0117] In some embodiments, the polypeptide molecules, binding domains and / or half-life extension moieties comprise one or more non-classical amino acids.

[0118] Provided are also polypeptide molecules, binding domains and / or half-life extension moieties comprising one or more a small amino acids. Exemplary small ammo acids comprise alanine, glycine, serine, aspartic acid, cysteine, proline, and threonine. A small ammo acid can comprise a volume up to about 117 A3.

[0119] In some embodiments, the polypeptide molecules, binding domains and / or half-life extension moieties comprise one or more flexible amino acids. A flexible amino acid can comprise beta-turn forming ability. Exemplary flexible amino acids comprise glycine, serine, asparagine, and aspartic acid, are β-turn-forming amino acids. A flexible ammo acid can also comprise an amino acid that lacks a side chain or comprises a reduced side chain. Thus, alanine is a flexible amino acid as it comprises a reduced side chain that allows for flexibility. A flexible amino acid can also comprise a structure that allows for kinking. Exemplary amino acids that can kick comprise proline.

[0120] In some embodiments, the polypeptide molecule comprises a small and flexible amino acid. In some embodiments, the small and flexible amino acid comprises glycine. In some embodiments, the small and flexible amino acid comprises alanine.

[0121] Substitutions in the polypeptide molecules described herein may be in the range of about 1 to 100 amino acids, including all ranges and subranges therebetween. In some embodiments, the substitution includes fewer than about 100 amino acid substitutions, fewer than about 95 amino acid substitutions, fewer than about 90 amino acid substitutions, fewer than about 85 amino acid substitutions, fewer than about 80 amino acid substitutions, fewer than about 75 amino acid substitutions, fewer than about 70 amino acid substitutions, fewer than about 65 amino acid substitutions, fewer than about 50 amino acid substitutions, fewer than about 45 amino acidsubstitutions, fewer than about 40 amino acid substitutions, fewer than about 35 amino acid substitutions, fewer than about 30 amino acid substitutions, fewer than about 25 amino acid substitutions, fewer than about 20 amino acid substitutions, fewer than about 15 amino acid substitutions, fewer than about 10 amino acid substitutions, fewer than about 5 amino acid substitutions, fewer than about 4 amino acid substitutions, fewer than about 3 ammo acid substitutions, or fewer than about 2 amino acid substitutions relative to the original molecule.

[0122] Amino acid sequence insertions include amino- and / or carboxyl-terminal fusions ranging in length from 1 residue to polypeptides containing 100 or more residues, as well as intrasequence insertions of single or multiple ammo acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N or C terminus of the antibody to an enzyme (e.g., for antibody-directed enzyme prodrug therapy) or a polypeptide which increases the serum halflife of the antibody. In some embodiments, the insertion is about 1 amino acid, about 2 amino acids, about 3 ammo acids, about 4 ammo acids, about 5 ammo acids, about 6 ammo acids, about 7 ammo acids, about 8 amino acids, about 9 amino acids, about 10 amino acids, about 11 ammo acids, about 12 amino acids, about 13 amino acids, about 14 ammo acids, about 15 ammo acids, about 16 amino acids, about 17 amino acids, about 18 ammo acids, about 19 ammo acids, about 20 ammo acids, about 21 amino acids, about 22 amino acids, about 23 ammo acids, about 24 amino acids, about 25 ammo acids, about 26 ammo acids, about 27 amino acids, about 28 amino acids, about 29 ammo acids, about 30 amino acids, about 31 amino acids, about 32 amino acids, about 33 amino acids, about 34 amino acids, about 35 ammo acids, about 36 amino acids, about 37 ammo acids, about 38 amino acids, about 39 amino acids, about 40 ammo acids, about 41 ammo acids, about 42 amino acids, about 43 amino acids, about 44 amino acids, about 45 ammo acids, about 46 ammo acids, about 47 amino acids, about 48 amino acids, about 49 ammo acids, about 50 amino acids, about 51 ammo acids, about 52 ammo acids, about 53 amino acids, about 54 amino acids, about 55 ammo acids, about 56 amino acids, about 57 amino acids, about 58 amino acids, about 59 amino acids, about 60 amino acids, about 61 amino acids, about 62 amino acids, about 63 amino acids, about 64 amino acids, about 65 amino acids, about 66 amino acids, about 67 amino acids, about 68 amino acids, about 69 amino acids, about 70 amino acids, about 71 ammo acids, about 72 ammo acids, about 73 amino acids, about 74 amino acids, about 75 ammo acids, about 76 amino acids, about 77 amino acids, about 78 amino acids, about 79 amino acids, about 80 amino acids,about 81 amino acids, about 82 amino acids, about 83 amino acids, about 84 amino acids, about 85 amino acids, about 86 amino acids, about 87 amino acids, about 88 amino acids, about 89 amino acids, about 90 amino acids, about 91 amino acids, about 92 amino acids, about 93 amino acids, about 94 amino acids, about 95 amino acids, about 96 amino acids, about 97 amino acids, about 98 amino acids, about 99 amino acids, or about 100 amino acids, including all ranges and subranges therebetween.

[0123] Amino acid sequence deletions include amino- and / or carboxyl-terminal deletions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence deletions of single or multiple amino acid residues. In some embodiments, the deletion is about 1 amino acid to about 100 amino acids. In some embodiments, the deletion is about 1 amino acid, about 2 amino acids, about 3 amino acids, about 4 amino acids, about 5 amino acids, about 6 amino acids, about 7 amino acids, about 8 amino acids, about 9 amino acids, about 10 amino acids, about 11 amino acids, about 12 amino acids, about 13 amino acids, about 14 amino acids, about 15 amino acids, about 16 amino acids, about 17 amino acids, about 18 amino acids, about 19 amino acids, about 20 amino acids, about 21 amino acids, about 22 amino acids, about 23 amino acids, about 24 amino acids, about 25 amino acids, about 26 amino acids, about 27 amino acids, about 28 amino acids, about 29 amino acids, about 30 amino acids, about 31 amino acids, about 32 amino acids, about 33 amino acids, about 34 amino acids, about 35 amino acids, about 36 amino acids, about 37 amino acids, about 38 amino acids, about 39 amino acids, about 40 amino acids, about 41 amino acids, about 42 amino acids, about 43 amino acids, about 44 amino acids, about 45 amino acids, about 46 amino acids, about 47 amino acids, about 48 amino acids, about 49 amino acids, about 50 amino acids, about 51 amino acids, about 52 amino acids, about 53 amino acids, about 54 amino acids, about 55 amino acids, about 56 amino acids, about 57 amino acids, about 58 amino acids, about 59 amino acids, about 60 amino acids, about 61 amino acids, about 62 amino acids, about 63 amino acids, about 64 amino acids, about 65 amino acids, about 66 amino acids, about 67 amino acids, about 68 amino acids, about 69 amino acids, about 70 amino acids, about 71 amino acids, about 72 amino acids, about 73 amino acids, about 74 amino acids, about 75 amino acids, about 76 amino acids, about 77 amino acids, about 78 amino acids, about 79 amino acids, about 80 amino acids, about 81 amino acids, about 82 amino acids, about 83 amino acids, about 84 amino acids, about 85 amino acids, about 86 amino acids, about 87 amino acids, about 88 amino acids, about 89 amino acids, about 90 amino acids, about 91 amino acids, about 92 aminoacids, about 93 amino acids, about 94 amino acids, about 95 amino acids, about 96 amino acids, about 97 amino acids, about 98 amino acids, about 99 amino acids, or about 100 amino acids, including all ranges and subranges therebetween.

[0124] In some embodiments, the polypeptide molecule comprises a TCR V-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβV-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCR V-binding domain comprises a Fab.

[0125] In some embodiments, the polypeptide molecule comprises a TCRβV6-5-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβV6-5-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCRβV6-5-binding domain comprises a Fab.

[0126] In some embodiments, the polypeptide molecule comprises a TCRβV12-3-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβV12-3-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCRβV12-3-binding domain comprises a Fab.

[0127] In some embodiments, the polypeptide molecule comprises a TCRβC-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβC-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCRβC-binding domain comprises a Fab.

[0128] In some embodiments, the polypeptide molecule comprises a TCRβC1-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβVC1-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCRβC1- binding domain comprises a Fab.

[0129] In some embodiments, the polypeptide molecule comprises a TCRβC2-binding domain. In some embodiments, the polypeptide molecule comprising the TCRβC2-binding domain is an scFv. In some embodiments, the polypeptide molecule comprising the TCRβC2-binding domain comprises a Fab.

[0130] In some embodiments, the present disclosure provides a polypeptide molecule comprising a first binding domain and a second binding domain. In some embodiments, the first binding domain is a TCRβ-binding domain (e.g., a TCRβV or a TCRβC). In some embodiments, the second binding domain is a TAA-binding domain (e.g., a PSMA-binding domain or a CD19-binding domain). In some embodiments, the TCRβ-binding domain is an scFv. In some embodiments, the TAA-binding domain comprises a Fab comprising a Fab heavy chain and a Fab light chain.

[0131] In some embodiments, the present disclosure provides a polypeptide molecule comprising a first binding domain and a second binding domain. In some embodiments, the first binding domain is a TCRβC-binding domain (e.g., a TCRβC1-binding domain or a TCRβC2-binding domain). In some embodiments, the second binding domain is a TAA-binding domain (e.g., a PSMA-binding domain or a CD19-binding domain).

[0132] In some embodiments, the polypeptide molecule comprises: (i) a TCRp-bindmg domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRpV-bindmg domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRpC-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the TCRP-bindmg domain (e.g, a TCRβV-binding domain or a TCRpC-binding domain) is an scFv. In some embodiments, the T / XA-binding domain comprises a Fab. In some embodiments, the binding domain linker connects the C-terminus of the TCRPV or TCRPV-binding domain to the N-terminus of the T / XA-binding domain. In some embodiments, the binding domain linker connects the N-terminus of the TCRPV or TCRβV-binding domain to the C-termmus of the TAA-binding domain.

[0133] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises m order from N-terminus to C-terminus: (i) a TCRβV-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TAA-binding domain; (ii) a binding domain linker; and (iii) a TCRβV-binding domain. In some embodiments, the TCRβV-binding domain is an scFv. In some embodiments, the TAA-binding domain comprises a Fab.

[0134] In some embodiments, the polypeptide molecule comprises: (i) a TCRpV6-5-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRpV6-5-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, thepolypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TAA-binding domain; (ii) a binding domain linker; and (iii) a TCRβV6-5-binding domain. In some embodiments, the TCRPV 6-5-binding domain is an scFv. In some embodiments, the TAA-binding domain comprises a Fab.

[0135] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV12-3-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRβV12-3-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TAA-binding domain; (ii) a binding domain linker; and (iii) a TCRβV12-3-binding domain. In some embodiments, the TCRβV12-3-binding domain is an scFv. In some embodiments, the TAA-binding domain comprises a Fab.

[0136] In some embodiments, the polypeptide molecule comprises: (i) a TCRp-bindmg domain; (ii) a binding domain linker; and (iii) a B cell-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV-binding domain; (ii ) a binding domain linker; and (iii) a B cell-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRpC-binding domain; (ii) a binding domain linker; and (iii) a B cell-binding domain. In some embodiments, the TCRp-bindmg domain is an scFv. In some embodiments, the B cell-binding domain comprises a Fab. In some embodiments, the binding domain linker connects the C-terminus of the TCRP-binding domain to the N-terminus of the B cell-binding domain. In some embodiments, the binding domain linker connects the N-terminus of the TCRP-binding domain to the C-terminus of the B cell-binding domain.

[0137] In some embodiments, the polypeptide molecule comprises: (i) a TCRpV-bindmg domain; (ii) a binding domain linker; and (iii) a B cell- binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRPV -binding domain; (ii) a binding domain linker; and (iii) a B cell- binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a B cell-binding domain; (ii) a binding domain linker; and (iii) a TCRβV-binding domain. In some embodiments, the TCRβV-binding domain is an scFv. In some embodiments, the B cell-binding domain comprises a Fab.

[0138] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRβV-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a CD19-binding domain; (ii) a binding domain linker; and (iii) a TCRβV-binding domain. In some embodiments, the TCRβV-binding domain is an scFv. In some embodiments, the CD19-binding domain comprises a Fab.

[0139] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV6-5-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRpV6-5-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a CD19-binding domain; (ii) a binding domain linker; and (iii) a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain is an scFv. In some embodiments, the CD19-binding domain comprises a Fab.

[0140] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV12-3-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRβV12-3- binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a CD19-binding domain; (ii) a binding domain linker; and (iii) a TCRpV12-3-binding domain. In some embodiments, the TCRβV12-3-binding domain is an scFv. In some embodiments, the CD19-binding domain comprises a Fab.

[0141] In some embodiments, the polypeptide molecule comprises: (i) a TCRβC-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TCRpC-binding domain; (ii) a binding domain linker; and (iii) a TAA-binding domain. In some embodiments, the polypeptide molecule comprises in order from N-terminus to C-terminus: (i) a TAA-binding domain; (ii) a binding domain linker; and (iii) a TCRpC-binding domain. In some embodiments,the TCRpC-binding domain is an scFv. In some embodiments, the TAA-binding domain comprises a Fab.

[0142] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV5-5 / 6 binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV6-5-binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV12-3 / 4 binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV20-1 binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβC1-binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβC2-binding domain; (ii) a binding domain linker; and (iii) a PSMA-binding domain. In some embodiments, the binding domain linker connects the C-terminus of the TCRβ-binding domain to the N-terminus of the PSMA-binding domain. In some embodiments, the binding domain linker connects the N-terminus of the TCRβ-binding domain to the C-terminus of the PSMA-binding domain.

[0143] In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV5-5 / 6 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV6-5 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV12-3 / 4 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV20-1 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβC1 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβC2 scFv; (ii) a binding domain linker; and (iii) an anti-PSMA Fab. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VH region to the N-terminus of the anti-PSMA Fab heavy chain. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VL region to the N-terminus of the anti-PSMA Fab heavy chain. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VH region to the N-terminus of the anti-PSMA Fab light chain. In some embodiments, the bindingdomain linker connects the C-terminus of the anti-TCRβ scFv VL region to the N-terminus of the anti-PSMA Fab light chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VH region to the C-terminus of the anti-PSMA Fab heavy chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VL region to the C-terminus of the anti-PSMA Fab heavy chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VH region to the C-terminus of the anti-PSMA Fab light chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VL region to the C-terminus of the anti-PSMA Fab light chain.

[0144] In some embodiments, the polypeptide molecule comprises: (i) a TCRβV5-5 / 6 binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV6-5-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV12-3 / 4 binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβV20-1 binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβC1-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the polypeptide molecule comprises: (i) a TCRβC2-binding domain; (ii) a binding domain linker; and (iii) a CD19-binding domain. In some embodiments, the binding domain linker connects the C-terminus of the TCRβ-binding domain to the N-terminus of the CD19-binding domain. In some embodiments, the binding domain linker connects the N-terminus of the TCRβ-binding domain to the C-terminus of the CD19-binding domain.

[0145] In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV5-5 / 6 scFv; (ii) a binding domain linker; and (iii) an anti-CD19 Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV6-5 scFv; (ii) a binding domain linker; and (iii) an anti-CD19 Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV12-3 / 4 scFv; (ii) a binding domain linker; and (iii) an anti-CD19 Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβV20-1 scFv; (ii) a binding domain linker; and (iii) an anti-CD19 Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβC1 scFv; (ii) a binding domain linker; and (iii) an anti-CD19 Fab. In some embodiments, the polypeptide molecule comprises: (i) an anti-TCRβC2 scFv; (ii) a bindingdomain linker; and (iii) an anti-CD19 Fab. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VH region to the N-terminus of the anti-CD19 Fab heavy chain. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VL region to the N-terminus of the anti-CD19 Fab heavy chain. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VH region to the N-terminus of the anti-CD19 Fab light chain. In some embodiments, the binding domain linker connects the C-terminus of the anti-TCRβ scFv VL region to the N-terminus of the anti-CD19 Fab light chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VH region to the C-terminus of the anti-CD19 Fab heavy chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VL region to the C-terminus of the anti-CD19 Fab heavy chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VH region to the C-terminus of the anti-CD19 Fab light chain. In some embodiments, the binding domain linker connects the N-terminus of the anti-TCRβ scFv VL region to the C-terminus of the anti-CD19 Fab light chain.

[0146] In some embodiments, the polypeptide molecule is a bispecific polypeptide molecule comprising a TCRpV6-5-binding domain and a CD19-binding domain. In some embodiments, the bispecific polypeptide molecule comprises a heavy chain comprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 1412. In some embodiments, the bispecific polypeptide molecule comprises a heavy chain comprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to any one of SEQ ID NOs: 1417, 1418, and 1421-1423. In some embodiments, the bispecific polypeptide molecule comprises a light chain comprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to any one of SEQ ID NOs: 1369, 1416, 1419, and 1420. In some embodiments, the bispecific polypeptide molecule comprises (i) a first heavy chain comprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 1412; (li) a second heavy chaincomprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 1417, 1418, and 1421-1423; and (ii) a light chain comprising an amino acid sequence with at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 1369, 1416, 1419, and 1420.

[0147] In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1416, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1417. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1369, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1418. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1419, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1417. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1420, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1417. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1369, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1421. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1369, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1422. In some embodiments, the polypeptide molecule comprises: a first heavy chain (HC1) comprising an amino acid sequence of SEQ ID NO: 1412; a light chain that comprises an amino acid sequence of SEQ ID NO: 1369, and a second heavy chain (HC2) that comprises an amino acid sequence of SEQ ID NO: 1423.TCRβV-Binding Domains

[0148] In some embodiments, the polypeptide molecule of the disclosure specifically binds a T cell receptor (TCR). TCRs recognize foreign antigens, which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each TCR is a dimer of one alpha and one beta chain or one delta and one gamma chain. In a single cell, the TCR loci are rearranged and expressed in the order delta, gamma, beta, and alpha. If both delta and gamma rearrangements produce functional chains, the cell expresses delta and gamma. If not, the cell proceeds to rearrange the beta and alpha loci. This region represents the germline organization of the TCR beta locus. The beta locus includes V (variable), J (joining), diversity (D), and C (constant) segments. Recombination of many different V segments with several J segments provides a wide range of antigen recognition. The beta locus also includes eight trypsinogen genes, three of which encode functional proteins and five of which are pseudogenes. Chromosomal abnormalities involving the TCR beta locus have been associated with T cell lymphomas.

[0149] Provided herein are polypeptide molecules comprising TCRβV or TCRβC-binding domains. In some embodiments, the polypeptide molecule specifically binds TCRβV. In some embodiments, the polypeptide molecule specifically binds TCRβC. In some embodiments, the polypeptide molecule is a bispecific polypeptide molecule and the bispecific polypeptide molecule specifically binds a TAA (e.g., CD19 or PSMA) and TCRβV (e.g., TCRβV6-5 and TCRβV12-3). In some embodiments, the TCRβV or TCRβC-binding domain comprises a Fab comprising a Fab heavy chain and Fab light chain. In some embodiments, the TCRβV or TCRβC-binding domain is an scFv.

[0150] In some embodiments, the polypeptide molecule of the disclosure binds TCRPV. In some embodiments, the polypeptide molecule comprises a TCRβV-binding domain. In some embodiments, the TCRβV-binding domain is an scFv. In some embodiments, the TCRβV-binding domain comprises a Fab.

[0151] In some embodiments, the TCRPV -binding domain selectively binds to human TCRPV (e.g., a TCR V family, subfamily, or variant thereof). TCR V families and subfamilies are known in the art, e.g., as described in Yassai et al., (2009) Immunogenetics 61(7) pp:493-502; and Wei S. and Concannon P. (1994) Human Immunology 41(3) pp: 201-206. Different gene nomenclatures for any one of the TCR families and subfamilies described herein are also encompassed by the present disclosure. For example, the TCR V nomenclature as described by Folch, G. and Lefranc,M -P., Exp. Clin. Immunogenet, 17, 42-54 (2000); Lefranc, M.-P. and Lefranc, G, The T Cell Receptor FactsBook, Academic Press, Harcourt, 398 pages (2001); Slightom, J. L. et al., Genomics, 20, 149-168 (1994); Wei et al., Immunogenetics, 40, 27-36 (1994); Arden, B. et al., Immunogenetics, 42, 455-500 (1995); Rowen, L. et al., Science, 272, 1755-1762 (1996); and Wilson, R. K. et al., Immunological Reviews 101, 149-172 (1988) are encompassed by the present disclosure, each of which are hereby incorporated by reference in their entirety.

[0152] In some embodiments, the TCRβV-binding domain selectively binds to any one of: TCRpVl, TCRPV2, TCRPV3, TCRPV4, TCRPV5, TCRPV6, TCRPV7, TCRPV8, TCRPV9, TCRPV10, TCRpVl 1, TCRPV12, TCRPV13, TCRpVl 4, TCRpV15, TCRPV16, TCRPV17, TCRpVl 8, TCRpVl 9, TCR V20, TCR V21, TCRPV22, TCRPV23, TCRPV24, TCRPV25, TCRPV26, TCRPV27, TCRpV28, TCRPV29, TCRPV30, TCR VA, TCRPVB, TCRPVC, or a variant thereof. See, also, Folch and Lefranc, Exp. Clin, Immunogenet, 17, 42-54 (2000).

[0153] In some embodiments, the TCRpV-bindmg domain selectively binds to any one of TCRpV2*01, TCRpV2*02, TCRPV2*O3, TCRPV3-1*O1, TCRpV3-l*02, TCRPV4-1*O1, TCRpV4-l*02, TCRPV4-2*O1, TCRPV4-2*O2, TCRPV4-3*O1, TCRpV4-3*02, TCRpV4-3*03, TCRPV4-3*O4, TCRpV5-l*01, TCRpV5-l*02, TCRpV5-4*01, TCRPV5-4*O2, TCRPV5-4*O3, TCRpV5-4*04, TCRPV5-5*O1, TCRPV5-5*O2, TCRPV5-5*O3, TCRpV5-6*01, TCRpV5-8*01, TCRPV5-8*O2, TCRpV6-l*01, TCRpV6-2*01, TCRpV6-3*01, TCRPV6-4*O1, TCRPV6-4*O2, TCRpV6-5*01, TCRPV6-6*O1, TCRPV6-6*O2, TCRPV6-6*O3, TCRpV6-6*04, TCRpV6-6*05, TCRPV6-8*O1, TCRPV6-9*O1, TCRPV7-2*O1, TCRPV7-2*O2, TCRPV7-2*O3, TCRPV7-2*O4, TCRPV7-3*O1, TCRPV7-3*O4, TCRPV7-3*O5, TCRPV7-4*O1, TCRPV7-6*O1, TCRPV7-6*O2, TCRPV7-7*O1, TCRPV7-7*O2, TCRPV7-8*O1, TCRPV7-8*O2, TCRPV7-8*O3, TCRPV7-9*O1, TCRPV7-9*O2, TCRPV7-9*O3, TCRPV7-9*O4, TCRPV7-9*O5, TCRPV7-9*O6, TCRPV7-9*O7, TCRPV9*O1, TCRPV9*O2, TCRPV9*O3, TCRpV10-l*01, TCRPV1O-1*O2, TCRPV1O-2*O1, TCRPV1O-2*O2, TCRPV1O-3*O1, TCRPV1O-3*O2, TCRPV1O-3*O3, TCRPV1O-3*O4, TCRPV11-1*01, TCRPVI 1-2*01, TCRPV11-2*02, TCRPV11-2*03, TCRPV11-3*01, TCRPV11-3*02, TCRPV11-3*03, TCRPV11-3*04, TCRPV12-3*O1, TCRPV12-4*01, TCRPV12-4*O2, TCRPV12-5*O1, TCRPV13*O1, TCRPV13*O2, TCRPV14*O1, TCRPV14*O2, TCRPV15*O1, TCRPV15*O2, TCRPV15*O3, TCRPV16*O1, TCRPV16*O3, TCRPV18*O1, TCRPV19*O1, TCRPV19*O2, TCRPV19*O3, TCRPV2O-1*O1, TCRPV2O-1*O2, TCRPV2O-1*O3, TCRPV2O-1*O4, TCRPV2O-1*O5, TCRPV2O-1*O6, TCRPV2O-1*O7, TCRPV24-1*O1,TCRPV25-1*O1, TCRPV27*O1, TCRPV28*O1, TCRPV29-1*O1, TCRPV29-1*O2, TCRPV29-1*03, TCRPV3O*O1, TCRPV3O*O2, TCRPV3O*O3, TCRPV3O*O4, or a variant thereof.

[0154] Exemplary amino acid sequences for TCRPV family members are shown in Table 2 and can also be found on the ImMunoGeneTics Information System website: www.imgt.org, or in a similar resource.Table 2. Exemplary TCR0V Family MembersSEQ IDTarget Species Amino Acid SequenceNO:DAGVTQSPTHLIKTRGQQVTIJ1CSPISGHKSV TCRPV5-5 Human SWYQQVTGQGPQFIFQYYEKEERGRGNFPDR 2230FSARQFPNYSSELNVNALLLGDSAIATCASSL DGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVCynomolgusTCRPV5-5 SWYQQALGQGPQFIFEYEEKERERGNFPDRFS 2231MonkeyGHQFSNYSSELNVNALEAGDSALYLCASSL DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDT VSWYQQALGQGPQFIFQYYEEEERQRGNFPD TCRpV5-6 Human 2232RFSGHQFPNYSSELNVNALLLGDSALYLCASS L DGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVCynomolgusTCRPV5-6 SWYQQALGQGPQFIFEYEEKERERGNFPDRFS 2231MonkeyGHQFSNYSSELNVNALEAGDSALYLCASSL DTGVTQSPTHLIRKRGQQVTLRCSPISGHNTVRhesusTCRPV5-6 SWYQQALGQGPQFIFQYYEKEERERGNFPGR 2233MonkeyF S GHQFPNYS SELN VS ALLLGD S AL YLC A S SL NADVTQSPKFQILKTGQSMTLQCAQDMNHN TCRPV6-1 Cynomolgus SMYWYRQDPGMGLRLIHYSATEDTTDPGEVP2410 (CLY-002) Monkey DGYSVSRLNKKEFLLRLESAALSQTSVYFCASSY NAGVTQTPKFQVLKTGQNMTLKCAQDMNH TCRpV6-2 Cynomolgus DRMYWYRQDPGMGLRLIHYSAGEGSTEKGE2411 (CLY-003) Monkey VPNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSY NAGVTQTPKFQVLKTGQSMTLQCAQDMNHD TCRPV6-3 Cynomolgus YMYWYRQDPGMGLRLIHYSVGEGSTEKGEV2412 (CLY-004) Monkey PDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY NAGVTQTPKFQ VLK TGQSMTLQCAQDMNHE TCRPV6-5 YMS W YRQDPGMGLRLIHYS V GAGL1 DQGEVHuman 223 (CLY-001) P^GYNVSRSTTEDFPLRLLSAAl’SQTSVYFCASSYCynomolgus WGVTQTPKFQ\TJ< TGQSMTVQCAQDA1NH TCRPV6-5 2234Monkey NFMYWYRQDPGMGLRLIHYSGAAGTTDKGESEQ ID Target Species Amino Acid SequenceNO: VPSGYNVSRLNTEDFPLRLESADPSQTSVYIC ASSY NVGVTQTPKFQVLKTGQSMTVQCAQDMNHRhesus NFMYWYRQDPGMGLRLIHYSGAAGTTDKGE TCR0V6-5 2235Monkey VPSGYNVSRLNTEDFPLRLESADP SQTSVYFCASSY NAGVNQTPKFQVLKTGQSMTLQCAQDMNHE TCRPV6-6 Cynomolgus SMSWYRQDPGMGLRLIHYSVGAGITDKGEVP 2413 (CLY-005) Monkey NGYNVSRSNTEDFPLRLESAASSQTSVYFCASSY DAGVIQSPRHEVTEMGQEVTLRCKPISGHNSL TCRPV12-3 Human FWYRQTMMRGLELLIYFNNNVPIDDSGMPED 2236RFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL DAGVIQSPRHEVTEMGKEVTLRCEPISGHTYLCynomolgusTCRPV12-3 FWYRQTMMRGLEFLI YFNNKSPIDD SGMPKD 2237Monkey RFSAKMPDASFSTLKIQPSEPRDSAVYFCASSL DAGVIQSPQHEVTEMGKEVTLRCEPISGHTYLRhesusTCRPV12-3 FWYRQTMMRGLEFLI YFNNKSPIDD SGMPKD 2238Monkey RFSATMPEVSFSTLKIQPSEP RDSAVYFCASSL DAGVIQSPRHEVTEMGQEVTIJ1CKPISGHNSL TCRpV12- FWYRQTMMRGLELLIYFNNNVPIDDSGMPED Human 2414 3*01 RFSAKMPNASFSTI. KIQPSEPRDSAVYFCASSY DAGVIQSPRHEVTEMGKEVTLRCEPISGHTYL TCRPV12- Cynomolgus FWYRQTMN1RGLEFLIYFNNKSPIDDSGMPKD2415 3*01 Monkey RFSAKMPDASFSTLKIQPSEPRDSAVYFCASSY DAG\TQSPRHEVTEMGQEVTI> RCKPISGHDY LFWYRQTMK1RGLELLIYFNNNVPIDDSGN1PE TCRpV12-4 Human 2239DRFSAKA1PNASFSTLKIQPSEPRDSAVYFCASSL DAGVTQTPRHKVTEMGQEVTMRCQPILGHNCynomolgus TVTWYRQTVMQGLELLVYLRNKASLDDSGM TCRPV12-4 2240Monkey PKDRFSAEMPDASLATLKIQPSEPRDSAVYLC ASGL DAGVTQTPRHKVTEMGQEVTMRCQPILGHNRhesus TVFWYRQTVMQGLELLVYLRNKASLDDSGM TCRPV12-4 2241Monkey PKDRFSAEMPDASLATLKIQPSEP RDSAVYLCASGL GAWSQHPSWVICKSGTSVKIECRSLDFQATT MFWTHQFPKQSI.> MI.> MATSNEGSKAT\TiQGV TCRPV20-1 Human 2242EKDKFLINHASLTI., STI. TVTSAHPEDSSFYICSARSEQ ID Target Species Amino Acid SequenceNO:AAWSQYPSRVICKRGTSVKIECRCLDFQATTCynomolgus MFWYRQFQTQSLILMATSNEGSGVTYEQGV TCRPV20-1 2243Monkey KQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR AAVVSQYPSRVICKRGTSVKIECRCLDFQATTRhesus MFWYRQFQTQSLILMATSNEGSGVTYEQGV TCRpV20-l 2244Monkey KQDKFPINI IPNLTFSTLTVTNAHPEDSSFYICSAR

[0155] In some embodiments, polypeptide molecule comprises a binding domain that binds human TCR[3V5-5, In some embodiments, the binding domain that binds human TCRpV5-5 binds a region of SEQ ID NO: 2230. In some embodiments, the polypeptide molecule comprises a binding domain that binds cynomolgus monkey TCRpV5-5, In some embodiments, the binding domain that binds cynomolgus monkey TCRpV5-5 binds a region of SEQ ID NO: 2231. In some embodiments, a polypeptide molecule binds human TCRpV5-6, In some embodiments, the polypeptide molecule that binds human TCRpV5-6 binds a region of SEQ ID NO: 2232. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRPV5-6. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV5-6 binds a region of SEQ ID NO: 2231. In some embodiments, a polypeptide molecule binds rhesus monkey TCRpV5-6. In some embodiments, the polypeptide molecule that binds rhesus monkey TCRpV5-6 binds a region of SEQ ID NO: 2233. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRpV6-l. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV6-1 binds a region of SEQ ID NO: 2410. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRPV6-2. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV6-2 binds a region of SEQ ID NO: 2411. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRPV6-3. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRpV6-3 binds a region of SEQ ID NO: 2412. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRPV6-6. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV6-6 binds a region of SEQ ID NO: 2413.

[0156] In some embodiments, a polypeptide molecule binds human TCRPV6-5. In some embodiments, the polypeptide molecule that binds human TCRPV6-5 binds a region of SEQ IDNO: 223. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCR0V6-5. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV6-5 binds a region of SEQ ID NO: 2234. In some embodiments, a polypeptide molecule binds rhesus monkey TCRPV6-5. In some embodiments, the polypeptide molecule that binds rhesus monkey TCRPV6-5 binds a region of SEQ ID NO: 2235.

[0157] In some embodiments, a polypeptide molecule binds human TCRPV12-3. In some embodiments, the polypeptide molecule that binds human TCRPV12-3 binds a region of SEQ ID NO: 2236 or SEQ ID NO: 2414. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRPV12-3, In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV12-3 binds a region of SEQ ID NO: 2237 or SEQ ID NO: 2415. In some embodiments, a polypeptide molecule binds rhesus monkey TCRPV12-3, In some embodiments, the polypeptide molecule that binds rhesus monkey TCRPV12-3 binds a region of SEQ ID NO: 2238.

[0158] In some embodiments, a polypeptide molecule binds human TCRPV12-4. In some embodiments, the polypeptide molecule that binds human TCRPV12-4 binds a region of SEQ I D NO: 2239. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRpV12-4. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRpV12-4 binds a region of SEQ ID NO: 2240. In some embodiments, a polypeptide molecule binds rhesus monkey TCRpV12-4. In some embodiments, the polypeptide molecule that binds rhesus monkey TCRPV12-4 binds a region of SEQ ID NO: 2241.

[0159] In some embodiments, a polypeptide molecule binds human TCRPV20-1. In some embodiments, the polypeptide molecule that binds human TCRPV20-1 binds a region of SEQ ID NO: 2242. In some embodiments, a polypeptide molecule binds cynomolgus monkey TCRpV20-1. In some embodiments, the polypeptide molecule that binds cynomolgus monkey TCRPV20-1 binds a region of SEQ ID NO: 2243. In some embodiments, a polypeptide molecule binds rhesus monkey TCRpV20-l. In some embodiments, the polypeptide molecule that binds rhesus monkey TCRPV20-1 binds a region of SEQ ID NO: 2244.

[0160] In some embodiments, the polypeptide molecule comprises a TCRβV-binding domain and the TCRβV-binding domain is an immunoglobulin molecule. In some embodiments, the immunoglobulin molecule is an antibody or antibody fragment. In some embodiments, the TCRβV-binding domain is a full-length antibody, e.g., a polyclonal or monoclonal antibody. Insome embodiments, the TCRβV-binding domain is an antibody fragment, such as, e.g., a single domain antibody (sdAb, also referred to as a VHH antibody or nanobody) or single-chain variable fragment (scFv). In some embodiments, the TCRβV-binding domain is a chimeric antibody. In some embodiments, the TCRpV-bmding domain is a humanized antibody. In some embodiments, the TCRβV-binding domain is a human antibody.

[0161] In some embodiments, the polypeptide molecule comprises a TCRβV-binding domain and the TCRβV-binding domain is an antibody fragment. In some embodiments, the antibody fragment is an Fv fragment. In some embodiments, the antibody fragment comprises a Fab fragment. In some embodiments, the antibody fragment is a F(ab')2. In some embodiments, the antibody fragment is an scFv. In some embodiments, the antibody fragment is Fab'. In some embodiments, the antibody fragment is an scFv-Fc, In some embodiments, the antibody fragment is a sdAb.

[0162] In some embodiments, the TCRβV-binding domain comprises: (a) an immunoglobulin heavy chain variable (VH) region comprising a heavy chain complementarity determining region (CDR) 1 (HCDR1), a heavy chain CDR2 (HCDR2), and a heavy chain CDR3 (I ICDR3); and (b) an immunoglobulin light chain variable (VL) region comprising a light chain complementarity determining region (CDR) 1 (LCDRl), a light chain CDR2 (LCDR2), and a light chain CDR3 (LCDR3). In some embodiments, the polypeptide molecule comprises a TCRβV-binding domain comprising: (a) a VH region comprising a HCDR1, a HCDR2, and a HCDR3; and (b) a VL region comprising a LCDRl, a LCDR2, and a LCDR3.

[0163] Exemplary TCRpV-bmding domains are provided in Table 3.Table 3. Exemplary TCRpV-Binding domainsHCDR1 (IMGT) GYSFTTYY 114 HCDR2 (IMGT) FFPGSGNI 115 HCDR3 (IMGT) AGSYYSYDVLDY 116 LCDRl (IMGT) QNVGIN 113LCDR2 (IMGT) SSS Not Applicable TCRPV6-5LCDR3 (IMGT) QQFKST TI JT 73 I-ICDR1 (Rabat) TYYIH 112 HCDR2 (Rabat) WFFPGSGNIKYNEKFKG 69 I-ICDR3 (Rabat) SYYSYDVLDY 70 LCDRl (R KASQNVGINWabat) 71LCDR2 (Rabat) SSSHRYS 72 LCDR3 (Kabat) QQFKSYPLT 73QVQLVQSGAEVKKPGSSVKVSC K ASGYSFTT Y YIHWV RQAPGQG VH region LEWMGWFFPGSGMKYNEKFKG 66RVTFEADTSTSTAYMELSSLRSE DTAVYYC1141WGQGTTVTVSS DIQMTQSPSFLSASVGDRVTITC KASQWGIEAAAYHQQKPGKAP VL region KALIYSSSHRYSGVPSRFSGSGSG 67TEFTLTI S SLQPEDE AT YFCQQFK SYPLTFGQGTKLEIK HCDR1 (IMGT) GFTF SEP G 1186 HCDR2 (IMGT) ISSGSSTI 1197 HCDR3 (IMGT) ARRGEGAMDY 1201 LCDRI (IMGT) SSVNY 1182 LCDR2 (IMGT) YTSLCDR3 (IMGT) QQFTSSPFT 1157 HCDR1 (Kabat) NFGMH 1160 HCDR2 (Kabat) YISSGSSTIYYADTLKG 1171 HCDR3 (Kabat) RGEGAA4DY 1180 TCR0V12- LCDRI (Kabat) RASSSVNYIY 1148 3 / 4 LCDR2 (Kabat) YTSNLAP 1156LCDR3 (Kabat) QQFTSSPFT 1157EVQIGESGGGF. VQPGGSF. RI.. SC AASGFTFSNFGMHWVRQ. A. PGKG i; EWVSYISSGSSnYYADTI. K. GR VH region 1113FTI S RDNSKNTL YLQMNSLRAE D TAVYYCARRGFXiAMDYWGQGT TVTVS S DN QLTQSPSFLS AS VGDRVHTC RASSSVNYIYWYQQKPGKAPKL VL region LIYYTSNLAPGVPSRFSGSGSGNE 1100YTLTISSLQPEDFA'TY YCQQFTSS PF1TGQGTKLEIKHCDR1 (IMGT) GFNIKSAY 2245 HCDR2 (IMGT) IDPATGKI' 2246 HCDR3 (IMGT) TRSENWDYGLDY 2247 TCR0V2O-1LCDRI (IMGT) KSVSILG'FHL 2248 LCDR2 (IMGT) AASLCDR3 (IMGT) QQSIEDPWT 2249HCDR1 (Kabat) SAYMH 2250 HCDR2 (Kabat) RIDPATGKTKYAPKFQA 2251 HCDR3 (Kabat) SLNWDYGLDY 2252 LCDR1 (Kabat) RASKSVSILGTHLIH 2253 LCDR2 (Kabat) AASNLES 2254 LCDR3 (Kabat) QQSIEDPWT 2249EVQLQQSVADLVRPGASLKESC TASGFNIKS A YMH W VI QRPDQG PECLGRIDPA1GKTKYAPKFQAK VH region 2255ATI T ADTS SNTAVLQLS S LTS EDTAt ¥ YCTRSLN WD Y GLD ¥ WGQG TSVTVSS DIVLTQSPASLAVSLGQRATISCR ASKSVMLGTHEIHWYQQKPGQP VL region PKLLIYAASET. ESGVPAR. FSGSGS 2256ETVFTLNIHPVEEEDA ATYFCQQ SIEDPWTFGGGTKLGIK HCDR1 (IMGT) GFSI. TAYG 2257 HCDR2 (IMGT) IWGDGNT 2258 HCDR3 (IMGT) ARDRVTATI A7AMD Y 2259 LCDR1 (IMGT) QGISNY 2260 LCDR2 (IMGT) YTSLCDR3 (IMGT) QQYSKLPRT 2261 HCDR1 (Kabat) AYGVN 2262 HCDR2 (Kabat) MI WGDGNTD ¥ A SALKS 2263 HCDR3 (Kabat) DRVTATLYAMDY 2264 LCDR1 (Kabat) SASQGISNYEN 2265 TCRPV5-5 / 6 LCDR2 (Kabat) YTSSLHS 2266LCDR3 (Kabat) QQYSKFPRT' 2261QVTIXESGPVI.. VK. PTETI.. TIACT VSGFSLTAYGVNWRQPPGKAL E WI. GMI WGDGNTD YN S ALK SR VH region 2267LTISKDNSKSQVVLTMTNMDPV DTATYYCARDRVTATLYAMDY WGQGTLVTVSS DIQMTQSPSSLSASVGDRVTITCS ASQGISNYIFNWYQQKPGKAVKI, VL region FIYY'rSSIHSGVPSRFSGSGSGTD 2268Y'n. / TISSI, QPEDFATY¥CQQYSKI. PRTEGGGrKVEIK

[0164] In some embodiments, the polypeptide molecule comprises a TCRpV5-5 / 6-binding domain. In some embodiments, the TCRpV5-5 / 6-binding domain comprises an amino acid sequence with at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2295. In some embodiments, the TCRPV5-5 / 6 binding domain comprises an amino acid sequence of SEQ ID NO: 2295. In some embodiments, the TCRPV5-5 / 6 -binding domain consists of an amino acid sequence of SEQ ID NO: 2295. In some embodiments, the TCRpV5-5 / 6-binding domain comprises an scFv.

[0165] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence with at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 149, In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence of SEQ ID NO: 149. In some embodiments, the TCRpV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 149. In some embodiments, the TCRpV6-5-binding domain comprises an scFv,

[0166] In some embodiments, the polypeptide molecule comprises a TCRpV12-3 / 4 binding domain. In some embodiments, the TCRpV12-3 / 4-binding domain comprises an amino acid sequence with at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1203. In some embodiments, the TCRPVI 2-3 / 4 binding domain comprises an amino acid sequence of SEQ ID NO: 1203. In some embodiments, the TCRPV12-3 / 4 binding domain consists of an amino acid sequence of SEQ ID NO: 1203. In some embodiments, the TCRp V12-3 / 4-binding domain comprises an scFv.

[0167] In some embodiments, the polypeptide molecule comprises a TCRPV20-1 binding domain. In some embodiments, the TCRpV20-l -binding domain comprises an amino acid sequence with at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2296. In some embodiments, the TCRPV20-1 binding domain comprises an amino acid sequence of SEQ ID NO: 2296. In some embodiments, the TCRPV20-1 binding domain consists of an amino acid sequence of SEQ ID NO: 2296. In some embodiments, the TCRPV20-1 -binding domain comprises an scFv.TCR^V6~5~binding Domains

[0168] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRPV6- 5 -binding domain comprises a KabatHCDRl thatcomprises the amino acid sequence of X31X32YIH, wherein X31 is selected from the group consisting of: T, L, H, Y, Q, K, F, S, A, D, V, I, R, W, E, G, N, and P and X32 is selected from the group consisting of Y, F, M, W, L, R, T, G, I, V, A, E, Q, P, H, D, N, and K. In some embodiments, X31 is selected from the group consisting of T and L. In some embodiments, X31 is L. In some embodiments, X2 is selected from the group consisting of Y, F, M, W, L, R, and T. In some embodiments, X32 is selected from the group consisting of M, L, and R. In some embodiments, X32 is W. In some embodiments, the Kabat HCDR1 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 112 and 2416-2424.

[0169] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRPV6- 5 -binding domain comprises a Kabat HCDR2 that comprises the ammo acid sequence of X50X51X52X53X54X55X56X57X58X59Y60X61X62K63F64K65G66, wherein X50 is selected from the group consisting of: W, E, D, R, V, H, G, Q, S, M, N, Y, I, L, A, T, P, and F; X51 is selected from the group consisting of F, E, II, M, K, Q, Y, L, N, V, T, A, R, G, S, D, W, I, and P; X52 is selected from the group consisting of: F, Y, R, S, A, K, W, N, M, H, G, Q, D, P, V, L, E, T, and I; X53 is selected from the group consisting of: P, G, N, A, I, V, L, T, Y, S, Q, K, F, R, D, E, and W; X54 is selected from the group consisting of G, R, K, W, L, F, Y, Q, II, I, M, S, D, P, T, and V; X55 is selected from the group consisting of S, T, G, W, FI, N, Y, L, A, F, Q, K, V, M, D, E, R, and P; X56 is selected from the group consisting of: G, Q, R, S, W, A, H, M, N, Y, E, L, T, D, K, I, V, and P; X57 is selected from the group consisting of N, K, R, T, G, H, V, Y, M, L, Q, I, D, A, E, F, W, S, and P; X58 is selected from the group consisting of: I, V, Y, L, A, Q, K, T, M, E, S, N, R, F, D, P, and W; X59 is selected from the group consisting of: K, N, Q, M, L, H, F, S, A, V, T, W, E, G, P, D, and R; Xgi is selected from the group consisting of N, V, S, H, P, T, D, E, W, G, M, Q, F, K, I, Y, and L; and Xs2 is selected from the group consisting of E, P, Q, I, N, W, H, F, K, A, V, Y, M, L, S, D, R, T, and G. In some embodiments, X50 is W. In some embodiments, X51 is F. In some embodiments, X52 is F. In some embodiments, X53 is P. In some embodiments, X54 is selected from the group consisting of G and R In some embodiments, X54 is R. In some embodiments, X55 is S. In some embodiments, Xss is G In some embodiments, X57 is N. In some embodiments, Xss is selected from the group consisting of I, V, Y, L, A, Q, K, T, and M. In some embodiments, X58 is selected from the group consisting of L, A, Q, K, and M. Insome embodiments, X59 is K. In some embodiments, Xei is selected from the group consisting of N, V, S, H, P, T, and D. In some embodiments, Xei is selected from the group consisting of V, S, H, P, T, and D. In some embodiments, X62 is E. In some embodiments, the Kabat HCDR2 of the TCRPV6- 5 -binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 69 and 2425-2446.

[0170] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises a Kabat HCDR3 that comprises the ammo acid sequence of X99X100X101X102X103X104X105X106X107X108, wherein X99 is selected from the group consisting of S, A, P, K, D, E, H, G, L, W, V, Y, I, N, M, R, and F; X100 is selected from the group consisting of Y, V, F, I, L, M, T, W, H, D, Q, A, S, E, K, P, N, and R; X101 is selected from the group consisting of: Y, W, F, V, H, M, P, Q, S, T, E, N, L, K, D, I, and A; X102 is selected from the group consisting of S, A, T, G, N, L, M, V, Y, H, Q, W, I, D, R, E, and F; X103 is selected from the group consisting of: Y, F, P, M, K, W, S, V, H, L, R, D, A, E, I, Q, and N; X104 is selected from the group consisting of D, N, S, G, L, T, K, Q, H, P, R, E, W, F, and V; X105 is selected from the group consisting of V, A, N, Q, T, W, E, P, Y, M, K, H, D, S, F, G, L, and R; X106 is selected from the group consisting of: L, I, M, V, Y, A, P, R, T, Q, H, G, K, N, E, D, and S; X107 is selected from the group consisting of: D, V, S, Q, I, H, E, R, T, M, Y, G, N, A, F, P, K, W, and L; and Xios is selected from the group consisting of: Y, D, V, S, Q, I, H, E, R, T, M, G, N, A, F, P, K, W, and L. In some embodiments, X99 is S. In some embodiments, X100 is Y. In some embodiments, X101 is Y. In some embodiments, X102 is S. In some embodiments, Xios is selected from the group consisting of Y and F. In some embodiments, X103 is F. In some embodiments, X104 is D. In some embodiments, Xios is V. In some embodiments, X106 is L. In some embodiments, X107 is D. In some embodiments, Xios is Y. In some embodiments, the Kabat HCDR3 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of SEQ ID NO: 70 or SEQ ID NO: 2447.

[0171] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCR[3V6- 5 -binding domain comprises a Kabat LCDR1 that comprises the amino acid sequence of K24A25S26Q27Z28Z29Z30Z31Z32Z33Z34, wherein Z28 is selected from the group consisting of: N, H, P, T, S, M, G, A, V, W, D, I, F, R, Y, Q, E, and L; Z29 is selected from the group consisting of V, G, A, L, M, S, P, F, Q, T, D, K, W, Y, H, R and E; Z30 is selected from the group consisting of: G, W, A, L, Q, N, R, M, P, D, K, H, I, V, S, E,and F; Z31 is selected from the group consisting of I, E, Q, G, H, S, W, Y, M, N, P, F, A, V, K, D, and L; Z32 is selected from the group consisting of: N, S, H, A, K, Q, L, D, M, T, E, Y, V, F, W, R and P; Z33 is selected from the group consisting of V, D, E, N, L, G, A, T, S, Q, H, F, R, K, W, P, and Y; and Z34 is selected from the group consisting of: V, T, N, I, K, P, H, M, F, Q, G, Y, R, W, L, D, A, and S. In some embodiments, Z28 is N. In some embodiments, Z29 is selected from the group consisting of V and G. In some embodiments, Z29 is G. In some embodiments, Z30 is G In some embodiments, Z31 is I. In some embodiments, Z32 is selected from the group consisting of N and R In some embodiments, Z32 is N, In some embodiments, Z32 is R. In some embodiments, Z33 is selected from the group consisting of V and D. In some embodiments, Z33 is D. In some embodiments, Z34 is V. In some embodiments, the Kabat LCDR1 of the TCRPV6-5-binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 71 and 2448-2456.

[0172] In some embodiments, the polypeptide molecule comprises a TCRpV6- 5 -binding domain. In some embodiments, the TCRpV6-5-binding domain comprises a Kabat LCDR2 that comprises the amino acid sequence of Z50SZ52Z53Z54Z55Z56, wherein Z50 is selected from the group consisting of: S, V, A, G, H, L, T, M, F, Q, E, P, K, W, and Y; Z52 is selected from the group consisting of S, W, Y, G, T, M, F, N, L, A, V, Q, I, E, D, H, P, and K; Z53 is selected from the group consisting of H, M, A, Y, L, N, E, V, G, Q, F, K, P, W, and R; Z54 is selected from the group consisting of: R, V, N, P, K, T, W, A, M, L, I, H, Q, F, and D; Z55 is selected from the group consisting of Y, W, M, F, A, S, E, G, V, P, D, N, R, Q, T, H; and Z56 is selected from the group consisting of: S, R, K, Q, Y, W, F, H, I, V, T, C, N, G, D, M and P. In some embodiments, Z50 is S. In some embodiments, Z52 is S. In some embodiments, Z53 is H. In some embodiments, Z54 is R. In some embodiments, Z55 is Y. In some embodiments, Z56 is selected from the group consisting of S and R. In some embodiments, Z56 is R. In some embodiments, the Kabat LCDR2 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of SEQ ID NO: 72 or SEQ ID NO: 2457.

[0173] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises a Kabat LCDR3 that comprises the amino acid sequence of Z89Z90Z91Z92Z93Z94Z95Z96Z97, wherein Zs9 is selected from the group consisting of: Q, Y, K, E, V, A, N, I, G, W, S, R, L, and H; Z90 is selected from the group consisting of Q, M, H, E, N, L, D, G, V, R, I, Y, W, K, S and P; Z91 is selected from thegroup consisting of F, S, T, A, M, H, L, E, Y, W, N, R, Q, I, P, V, G, K, and D; Z92 is selected from the group consisting of: K, G, I, R, S, V, Y, F, W, M, A, Q, T, H, E, L, D, N, and P; Z93 is selected from the group consisting of S, F, R, A, L, M, K, D, W, N, V, Q, T, I, and G; Z94 is selected from the group consisting of: Y, L, V, I, A, N, Q, R, E, G, P, S, K, D, W, and F; Z95 is selected from the group consisting of P, N, A, G, S, H, V, D, K, T, L, E, M, Q, R, F, and W; Z96 is selected from the group consisting of L, I, V, M, E, Y, F, N, A, G, H, R, S, W, Q, D, P, and T; and Z97 is selected from the group consisting of: T, G, A, S, R, Q, V, W, E, L, I, H, M, F, N, D, and P. In some embodiments, Zs9 is Q. In some embodiments, Z90 is Q. In some embodiments, Z91 is F, In some embodiments, Z92 is K, In some embodiments, Z93 is selected from the group consisting of S, F, R, A, and L. In some embodiments, Z93 is selected from the group consisting of F, R, A, and L, In some embodiments, Z94 is Y, In some embodiments, Z95 is selected from the group consisting of P and N, In some embodiments, Z95 is N, In some embodiments, Z96 is selected from the group consisting of L and I, In some embodiments, Z96 is I. In some embodiments, Z97 is selected from the group consisting of T, G, and A. In some embodiments, Z97 is selected from the group consisting of G and A. In some embodiments, Z56 is R. In some embodiments, the Kabat LCDR3 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of SEQ ID NO: 73.

[0174] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-bindmg domain. In some embodiments, the TCRPV6- 5 -binding domain comprises:a Kabat HCDR1 that comprises the amino acid sequence of X31X32YIH, wherein X31 is selected from the group consisting of: T and L; and X32 is selected from the group consisting of Y, F, M, W, L, R, and T;a Kabat HCDR2 that comprises the ammo acid sequence of W50F51F52P53X54S55G56N57X58K59Y60X61E62K63F64K65G66, wherein X54 is selected from the group consisting of G and R; X58 is selected from the group consisting of: I, V, Y, L, A, Q, K, T, and M; and Xr,i is selected from the group consisting of N, V, S, H, P, T, and D;a Kabat HCDR3 that comprises the amino acid sequence of S99Y100Y101S102F103D104V105L106D107Y108;a Kabat LCDR1 that comprises the amino acid sequence of K24A25S26Q27N28Z29G30I31Z32Z33V34, wherein Z29 is selected from the group consisting of V andG; Z32 is selected from the group consisting of N and R; and Z33 is selected from the group consisting of V and D;a Kabat LCDR2 that comprises the amino acid sequence of S50S51S52H53R54Y55Z56, wherein Z56 is selected from the group consisting of: S and R;a Kabat LCDR3 that comprises the amino acid sequence of Q89Q90F91K92Z93Y94Z95L96Z97, wherein Z93 is selected from the group consisting of S, F, R, A, and L; Z95 is selected from the group consisting of P and N; Z96 is selected from the group consisting of L and I; and Z97 is selected from the group consisting of T, G, and A; wherein the polypeptide molecule does not comprise SEQ ID NOs: 69-73, 112, and 2416-2457.

[0175] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCR[3V6- 5 -binding domain comprises an IMGT HCDR1 that comprises the amino acid sequence of G26X27X28X29X30X31X32Y33, wherein X27 is selected from the group consisting of: Y, P, E, H, V, K, S, Q, T, L, N, F, M, I, R, G, W, and D; X28 is selected from the group consisting of S, K, A, P, T, V, N, Q, L, E, I, H, M, G, Y, and W; X29 is selected from the group consisting of: F, I, M, Q, L, W, P, V, S, Y, N, A, D, T, E, H, K, G, and R; X30 is selected from the group consisting of T, V, L, Y, W, Q, I, E, R, G, N, F, K, M, S, H, A, and P; X31 is selected from the group consisting of: T, L, H, Y, Q, K, F, S, A, D, V, I, R, W, E, G, N, and P; and X32 is selected from the group consisting of Y, F, M, W, L, R, T, G, I, V, A, E, Q, P, H, D, N, and K. In some embodiments, X27 is Y. In some embodiments, X28 is selected from the group consisting of S, K, A, P, T, and V. In some embodiments, X28 is selected from the group consisting of K, A, P, and V. In some embodiments, X29 is F. In some embodiments, X30 is selected from the group consisting of T, V, L, Y, W, and Q. In some embodiments, X30 is selected from the group consisting of V, L, Y, W, and Q. In some embodiments, X31 is selected from the group consisting of T and L. In some embodiments, X31 is L. In some embodiments, X32 is selected from the group consisting of Y, F, M, W, L, R, and T. In some embodiments, X32 is selected from the group consisting of M, L, and R. In some embodiments, the IMGT HCDR1 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 114 and 2458-2476.

[0176] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an IMGT HCDR2 that comprises the ammo acid sequence of X51X52X53X54X55X56X57X58, wherein X51 is selectedfrom the group consisting of F, E, H, M, K, Q, Y, L, N, V, T, A, R, G, S, D, W, I, and P; X52 is selected from the group consisting of: F, Y, R, S, A, K, W, N, M, H, G, Q, D, P, V, L, E, T, and I; X53 is selected from the group consisting of: P, G, N, A, I, V, L, T, Y, S, Q, K, F, R, D, E, and W; X54 is selected from the group consisting of G, R, K, W, L, F, Y, Q, H, I, M, S, D, P, T, and V; X55 is selected from the group consisting of: S, T, G, W, H, N, Y, L, A, F, Q, K, V, M, D, E, R, and P; X56 is selected from the group consisting of: G, Q, R, S, W, A, H, M, N, Y, E, L, T, D, K, I, V, and P; X57 is selected from the group consisting of N, K, R, T, G, H, V, Y, M, L, Q, I, D, A, E, F, W, S, and P; and X58 is selected from the group consisting of: I, V, Y, L, A, Q, K, T, M, E, S, N, R, F, D, P, and W. In some embodiments, X51 is F. In some embodiments, X52 is F, In some embodiments, X53 is P, In some embodiments, X54 is selected from the group consisting of G and R, In some embodiments, X54 is R In some embodiments, X55 is S, In some embodiments, Xse is G In some embodiments, X57 is N. In some embodiments, Xss is selected from the group consisting of I, V, Y, L, A, Q, K, T, and M. In some embodiments, X58 is selected from the group consisting of L, A, Q, K, and M. In some embodiments, the IMGT HCDR2 of the TCRPV6-5-binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 115 and 2477-2498.

[0177] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-bmding domain. In some embodiments, the TCRpV6-5-binding domain comprises an IMGT HCDR3 that comprises the ammo acid sequence of A97X98X99X100X101X102X103X104X105X106X107X108, wherein X98 is selected from the group consisting of: G, A, V, P, M, I, D, Q, N, F, L, W, C, and R; X99 is selected from the group consisting of S, A, P, K, D, E, H, G, L, W, V, Y, I, N, M, R, and F; Xioo is selected from the group consisting of: Y, V, F, I, L, M, T, W, H, D, Q, A, S, E, K, P, N, and R; Xioi is selected from the group consisting of: Y, W, F, V, H, M, P, Q, S, T, E, N, L, K, D, I, and A; X102 is selected from the group consisting of S, A, T, G, N, L, M, V, Y, H, Q, W, I, D, R, E, and F; X103 is selected from the group consisting of: Y, F, P, M, K, W, S, V, H, L, R, D, A, E, I, Q, and N; X104 is selected from the group consisting of D, N, S, G, L, T, K, Q, H, P, R, E, W, F, and V; X105 is selected from the group consisting of V, A, N, Q, T, W, E, P, Y, M, K, H, D, S, F, G, L, and R; Xioe is selected from the group consisting of: L, I, M, V, Y, A, P, R, T, Q, H, G, K, N, E, D, and S; X107 is selected from the group consisting of: D, V, S, Q, I, H, E, R, T, M, Y, G, N, A, F, P, K, W, and L; and Xios is selected from the group consisting of: Y, D, V, S, Q, I, FI, E, R, T, M, G, N, A, F, P, K, W, and L. wherein X98 is selected from the groupconsisting of G and A; X99 is S; X100 is Y; X101 is Y; X102 is S; X103 is selected from the group consisting of Y and F; X104 is D; X105 is V; X106 is L; X107 is D; or Xios is Y. In some embodiments, X98 is selected from the group consisting of G and A. In some embodiments, X98 is A. In some embodiments, X103 is F. In some embodiments, the IMGT HCDR3 of the TCRpV6-5-binding domain does not comprise the amino acid sequence of SEQ ID NO: 116 or SEQ ID NO: 2499.

[0178] In some embodiments, the polypeptide molecule comprises a TCRβV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an IMGT LCD 1 that comprises the amino acid sequence of Q27Z28Z29Z30Z31Z32, wherein Z28 is selected from the group consisting of: N, H, P, T, S, M, G, A, V, W, D, I, F, R, Y, Q, E, and L; Z29 is selected from the group consisting of V, G, A, L, M, S, P, F, Q, T, D, K, W, Y, H, R and E; Z30 is selected from the group consisting of: G, W, A, L, Q, N, R, M, P, D, K, H, I, V, S, E, and F; Z31 is selected from the group consisting of I, E, Q, G, H, S W, Y, M, N, P, F, A, V, K, D, and L; and Z32 is selected from the group consisting of: N, S, H, A, K, Q, L, D, M, T, E, Y, V, F, W, R and P In some embodiments, Z28 is N. In some embodiments, Z29 is selected from the group consisting of V and G. In some embodiments, Z29 is G. In some embodiments, Z30 is G. In some embodiments, Z31 is I. In some embodiments, Z32 is N. In some embodiments, Z32 is R. In some embodiments, the IMGT LCDRl of the TCRPV 6-5-binding domain does not comprise the amino acid sequence of any one of SEQ ID NOs: 113 and 2500-2508.

[0179] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an IMGT LCDR2 that comprises the ammo acid sequence of Z50SZ52, wherein Z50 is selected from the group consisting of: S, V, A, G, H, L, T. M, F, Q, E, P, K, W, and Y; and Z52 is selected from the group consisting of S, W, Y, G, T, M, F, N, L, A, V, Q, I, E, D, H, P, and K. In some embodiments, Z50 is S. In some embodiments, Z52 is S. In some embodiments, Z32 is R. In some embodiments, the IMGT LCDR2 of the TCRp V6-5-binding domain does not comprise the ammo acid sequence of SSS.

[0180] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an IMGT LCDR3 that comprises the amino acid sequence of Z89Z90Z91Z92Z93Z94Z95Z96Z97, wherein Zs9 is selected from the group consisting of: Q, Y, K, E, V, A, N, I, G, W, S, R, L, and H; Z90 is selected from the group consisting of Q, M, H, E, N, L, D, G, V, R, I, Y, W, K, S, and P; Z91 is selected from thegroup consisting of F, S, T, A, M, H, L, E, Y, W, N, R, Q, I, P, V, G, K, and D; Z92 is selected from the group consisting of: K, G, I, R, S, V, Y, F, W, M, A, Q, T, H, E, L, D, N, and P; Z93 is selected from the group consisting of S, F, R, A, L, M, K, D, W, N, V, Q, T, I, and G; Z94 is selected from the group consisting of: Y, L, V, I, A, N, Q, R, E, G, P, S, K, D, W, and F; Z95 is selected from the group consisting of P, N, A, G, S, H, V, D, K, T, L, E, M, Q, R, F, and W; Z96 is selected from the group consisting of L, I, V, M, E, Y, F, N, A, G, H, R, S, W, Q, D, P, and T; and Z97 is selected from the group consisting of: T, G, A, S, R, Q, V, W, E, L, I, H, M, F, N, D, and P. In some embodiments, Zs9 is Q. In some embodiments, Z90 is Q. In some embodiments, Z91 is F, In some embodiments, Z92 is K, In some embodiments, Z93 is selected from the group consisting of S, F, R, A, and L. In some embodiments, Z93 is selected from the group consisting of F, R, A, and L. In some embodiments, Z94 is Y. In some embodiments, Z95 is selected from the group consisting of P and N, In some embodiments, Z95 is N, In some embodiments, Z96 is selected from the group consisting of L and I. In some embodiments, Z96 is I. In some embodiments, Z97 is selected from the group consisting of T, G, and A. In some embodiments, Z97 is selected from the group consisting of G and A. In some embodiments, Z32 is R. In some embodiments, the IMGT LCDR3 of the TCRPV 6-5-binding domain does not comprise the amino acid sequence of SEQ ID NO: 73.

[0181] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-bindmg domain. In some embodiments, the TCRPV6- 5 -binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of G26Y27X28F29X30X31X32Y33, wherein X2.8 is selected from the group consisting of S, K, A, P, T, and V; X30 is selected from the group consisting of T, V, L, Y, W, and Q; X31 is selected from the group consisting of: T and L; and X32 is selected from the group consisting of Y, F, M, W, L, R, and T;an IMGT HCDR2 that comprises the amino acid sequence of F51F52P53X54S55G56N57X58, wherein X54 is selected from the group consisting of G and R; and Xss is selected from the group consisting of: I, V, Y, L, A, Q, K, T, and M;an IMGT HCDR3 that comprises the amino acid sequence of A97X98S99Y100Y101S102X103D104V105L106D107Y108, wherein X98 is selected from the group consisting of: G and A; and wherein X103 is selected from the group consisting of Y and F;an IMGT LCDRl that comprises the amino acid sequence of Q27N28Z29G30I31Z32, wherein Z29 is selected from the group consisting of V and G; and wherein Z32 is selected from the group consisting of N and R;an IMGT LCDR2 that comprises the amino acid sequence of S50S51S52;an IMGT LCDR3 that comprises the amino acid sequence of Q89Q90F91K92Z93Y94Z95Z96Z97, wherein Z93 is selected from the group consisting of S, F, R, A, and L; Z95 is selected from the group consisting of P and N; Z96 is selected from the group consisting of L and I; and Z97 is selected from the group consisting of: T, G, and A; and wherein the polypeptide molecule does not comprise the ammo acid sequence of SEQ ID NOs: 73, 113- 116, and 2458-2508, and SSS.

[0182] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0183] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0184] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 thatcomprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0185] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0186] In some embodiments, the TCR[3V6- 5 -binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0187] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 that comprises the ammo acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYK (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0188] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 thatcomprises the amino acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYK (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0189] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0190] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVEDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0191] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of L YYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0192] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of TWYIH(SEQ ID NO: 145); aKabatHCDR2 that comprises the amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 thatcomprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDR1 that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYK (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0193] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0194] In some embodiments, the TCR[3V6- 5 -binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the amino acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0195] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDR1 that comprises the ammo acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the amino acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYK (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0196] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprisesthe amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the amino acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the ammo acid sequence of SSSHRYK (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0197] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRW (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0198] In some embodiments, the TCRpV6-5-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the amino acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0199] In some embodiments, the TCRPV6- 5 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137); a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0200] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0201] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0202] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0203] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequenceof QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0204] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0205] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIN (SEQ ID NO: 113); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, IICDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0206] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT IICDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0207] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIN (SEQ ID NO: 113); an IMGT LCDR2 thatcomprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0208] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0209] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0210] In some embodiments, the TCRpV6-5-bmding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTTWY (SEQ ID NO: 146); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0211] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRlthat comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0212] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0213] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0214] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0215] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 thatcomprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0216] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0217] In some embodiments, the TCRpV6-5-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140); an IMGT LCDRl that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0218] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 100; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 85. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 100; and a VL comprising an amino acid sequence of SEQ ID NO: 85.

[0219] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 101; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 86. In some embodiments, theTCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 101; and a VL comprising an amino acid sequence of SEQ ID NO: 86.

[0220] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 102; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 87. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 102; and a VL comprising an amino acid sequence of SEQ ID NO: 87.

[0221] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 101; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 85. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 101; and a VL comprising an amino acid sequence of SEQ ID NO: 85.

[0222] In some embodiments, the polypeptide molecule comprises a VH comprising an ammo acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 103; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 85. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an ammo acid sequence of SEQ ID NO: 103; and a VL comprising an amino acid sequence of SEQ ID NO: 85. \

[0223] In some embodiments, the TCRpV6-5-bmding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 104; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 88. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 104; and a VL comprising an amino acid sequence of SEQ ID NO: 88.

[0224] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 105; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 89. In some embodiments, theTCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 105; and a VL comprising an amino acid sequence of SEQ ID NO: 89.

[0225] In some embodiments, the TCR|3V6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 101; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 91. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 101; and a VL comprising an amino acid sequence of SEQ ID NO: 91.

[0226] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 106; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 87. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 106; and a VL comprising an amino acid sequence of SEQ ID NO: 87.

[0227] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 107; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 87. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 107; and a VL comprising an amino acid sequence of SEQ ID NO: 87.

[0228] In some embodiments, the TCRpV6-5-bmding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 108; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 89. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 108; and a VL comprising an amino acid sequence of SEQ ID NO: 89.

[0229] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 109; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 90. In some embodiments, theTCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 109; and a VL comprising an amino acid sequence of SEQ ID NO: 90.

[0230] In some embodiments, the TCR|3V6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 109; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 86. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 109; and a VL comprising an amino acid sequence of SEQ ID NO: 86.

[0231] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 106; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 92. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 106; and a VL comprising an amino acid sequence of SEQ ID NO: 92.

[0232] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 110; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 92. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 110; and a VL comprising an amino acid sequence of SEQ ID NO: 92.

[0233] In some embodiments, the TCRpV6-5-bmding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 111; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 87. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 111; and a VL comprising an amino acid sequence of SEQ ID NO: 87.

[0234] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 107; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 91. In some embodiments, theTCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 107; and a VL comprising an amino acid sequence of SEQ ID NO: 91.

[0235] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 111; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 93. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 111; and a VL comprising an amino acid sequence of SEQ ID NO: 93.

[0236] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2512; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2514. In some embodiments, the TCRpV6-5-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 2512; and a VL comprising an amino acid sequence of SEQ ID NO: 2514.

[0237] In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2513; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 2514. In some embodiments, the TCRpV6-5-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 2513; and a VL comprising an amino acid sequence of SEQ ID NO: 2514.

[0238] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-bindmg domain. In some embodiments, the TCRpV6-5-binding domain is one selected from those disclosed in Table 20. In some embodiments, the TCRpV6-5-binding domain comprises an ammo any one or more of the amino acid sequences in Table 20. In some embodiments, the TCRPV6-5-binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any one or more of the amino acid sequences in Table 20.

[0239] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence of Table 21. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence with at least about or at most about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or100% identity to any one of the amino acid sequences in Table 21. In some embodiments, the TCR0V6- 5 -binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 149-222. In some embodiments, the TCRPV6- 5 -binding domain comprises an amino acid sequence of any one of SEQ ID NOs: 149-222. In some embodiments, the TCRpV6-5-binding domain consists of an amino acid sequence of any one of SEQ ID NOs: 149-222. In some embodiments, the polypeptide molecule is an scFv.

[0240] In some embodiments, the TCRPV6- 5 -binding domain is an scFv. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 205. In some embodiments, the TCRpV6- 5 -binding domain comprises an amino acid sequence of SEQ ID NO: 205. In some embodiments, the TCRpV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 205.

[0241] In some embodiments, the TCRPV6- 5 -binding domain is an scFv. In some embodiments, the TCRpV6-5-binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 206. In some embodiments, the TCRpV6-5-binding domain comprises an ammo acid sequence of SEQ ID NO: 206. In some embodiments, the TCRpV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 206.

[0242] In some embodiments, the TCRpV6- 5 -binding domain is an scFv. In some embodiments, the TCRPV6- 5 -binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 207. In some embodiments, the TCRpV6-5-binding domain comprises an ammo acid sequence of SEQ ID NO: 207. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 207.

[0243] In some embodiments, the TCRpV6- 5 -binding domain is an scFv. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 208. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence of SEQ ID NO: 208. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 208.

[0244] In some embodiments, the TCRpV6-5-binding domain is an scFv. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 209. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence of SEQ ID NO: 209. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 209.

[0245] In some embodiments, the TCRpV6-5-binding domain is an scFv. In some embodiments, the TCRpV6-5-bmding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 210, In some embodiments, the TCRpV6-5-bindmg domain comprises an amino acid sequence of SEQ ID NO: 210. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 210.

[0246] In some embodiments, the TCRpV6-5-binding domain is an scFv, In some embodiments, the TCRpV6-5-bmding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 211. In some embodiments, the TCRpV6-5-binding domain comprises an amino acid sequence of SEQ ID NO: 211. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 211.

[0247] In some embodiments, the TCRpV6-5-binding domain is an scFv. In some embodiments, the TCRpV6-5-bmding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 212. In some embodiments, the TCRpV6-5-bindmg domain comprises an amino acid sequence of SEQ ID NO: 212. In some embodiments, the TCRPV6-5-binding domain consists of an amino acid sequence of SEQ ID NO: 212.

[0248] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-bindmg domain. In some embodiments, the TCRpV6-5-binding domain comprises a light chain and / or a heavy chain having at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to an amino acid sequence of Table 13, Table 14, and Table 17. In some embodiments, the TCRPV6- 5 -binding domain comprises the HCDR 1-3 and LCDR 1-3 of any of the binding domains disclosed in Table 13, Table 14, and Table 17. In some embodiments, the polypeptide molecule comprises a heavy chain comprising an amino acid sequence that is atleast about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 576, 582-587, 594-1084, and 1099. In some embodiments, the polypeptide molecule comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 231, 236-574, and 1085-1094, In some embodiments, the polypeptide molecule comprises: (i) a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 576, 582-587, 594-1084, and 1099; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 231, 236-574, and 1085-1094. In some embodiments, the polypeptide molecule comprises a Fab that specifically binds to TCRPV6-5.

[0249] In some embodiments, the polypeptide molecule comprises a TCRpV6-5-binding domain. In some embodiments, the TCRpV6-5-binding domain comprises a light chain and / or a heavy chain having at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any one of the ammo acid sequence in Table 22. In some embodiments, the TCRpV6-5-binding domain comprises the HCDR 1-3 and LCDR 1-3 of any of the binding domains disclosed in Table 22. In some embodiments, the TCRpV6-5-binding domain comprises a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 575-1084. In some embodiments, the TCR V6- 5 -binding domain comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, atleast about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 230-574. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 575-1084; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 230-574, In some embodiments, the polypeptide molecule comprises a Fab.

[0250] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 582; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%,at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236.

[0251] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583; and (ii) a light chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, t least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 237.

[0252] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%,at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 584; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 238.

[0253] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, t least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236.

[0254] In some embodiments, the TCRpV6-5-bmding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 585; and (ii) a light chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236.

[0255] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 586; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 239.

[0256] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 587; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 240.

[0257] In some embodiments, the TCRpV6-5-binding domain comprises a Fab. In some embodiments, the TCRpV6-5-bindmg domain comprises: (i) a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583; and (ii) a light chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, t least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 241.

[0258] In some embodiments, the TCRpV6-5-binding domain specifically binds to a TCRpV6-5 with high affinity. In some embodiments, a TCRβV6-5-binding domain has a dissociation constant of about 10'5to about 10'12moles per liter or molar (M). For example, a TCRPV6-5-binding domain can have a dissociation constant of about 1000 nM, about 900 nM, about 800 nM, about 700 nM, about 600 nM, about 500 nM, about 400 nM, about 300 nM, about 200 nM, about 100 nM, about 75 nM, about 50 nM, about 25 nM, or about 10 nM, including all ranges and subranges therebetween. In some embodiments, a TCRβV6-5-binding domain has a dissociation constant of less than 200 nTCRfiV 12- 3-Binding, Domains

[0259] In some embodiments, the polypeptide molecule comprises a TCRPVI 2-3 -binding domain. In some embodiments, the TCRpV12-3-binding domain comprises a Kabat HCDR1 thatcomprises the amino acid sequence of X31X32G33M34X35, wherein X31 is selected from the group consisting of: N, R, I, Y, V, H, L, T, S, Q, D, F, K, M, A, W, G, E, and P; X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, I, G, M, L, Q, N, E, W, D, and P; and X35 is selected from the group consisting of H, W, F, N, G, S, D, M, A, Y, L, T, I, E, Q, K, and P. In some embodiments, X31 is selected from the group consisting of N, R, I, Y, V, H, L, T, S, Q, and D. In some embodiments, X31 is selected from the group consisting of R and I. In some embodiments, X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, and I. In some embodiments, X32 is T. In some embodiments, X35 is H. In some embodiments, the Kabat HCDR1 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1160.

[0260] In some embodiments, the polypeptide molecule comprises a TCRpV12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises a Kabat HCDR2 that comprises the amino acid sequence of Y50I51S52X53X54X55X56X57X58X59Y60X61X62X63L64K65G66, wherein X53 is selected from the group consisting of: S, T, G, K, A, L, W, Y, E, D, I, M, V, N, P, F, H, and Q; X54 is selected from the group consisting of G, W, 5*, Y, T, Q, V, R, H, E, M, K, P, N, F, A, L, I, and D; X55 is selected from the group consisting of S, II, G, Q, A, T, L, M, E, W, N, K, R, Y, D, P, I, and F; Xss is selected from the group consisting of: S, M, T, P, K, R, Q, Y, L, G, N, FI, I, D, V, F, W, and E; X57 is selected from the group consisting of T, V, S, L, A, I, P, M, R, K, Q, FI, W, F, Y, E, and D; Xss is selected from the group consisting of: I, F, W, Y, V, E, L, M, A, K, R, T, D, N, S, P, H, and G; X59 is selected from the group consisting of: Y, £, I, II, M, F, R, K, V, T, Q, G, P, A, S, W, and D; Xei is selected from the group consisting of A, K, R, D, Q, W, N, S, Y, G, F, E, P, H, T, V, I, L, and M; Xs2 is selected from the group consisting of D, P, T, E, H, G, R, N, Q, K, I, Y, W, L, F, and V; and X63 is selected from the group consisting of T, I, K, N, H, E, G, M, R, Y, V, F, L, P, S, Q, A, W, and D. In some embodiments, X53 is S. In some embodiments, X54 is selected from the group consisting of G, W, S, Y, T, Q, V, R, H, E, M, K, and P. In some embodiments, X54 is selected from the group consisting of S and T. In some embodiments, X55 is selected from the group consisting of S, H. In some embodiments, X56 is S. In some embodiments, X57 is selected from the group consisting of T and V. In some embodiments, X58 is selected from the group consisting of I, F, W, and Y. In some embodiments, X59 is selected from the group consisting of Y, L, I, and H. In some embodiments, X59 is L. In some embodiments, Xei is selected from the group consisting of A, K, R, D, Q, W, N, S, Y, G, and F. In some embodiments, X62 is selected from the group consisting of D, P, and T. In some embodiments, Xc,3is selected from the group consisting of T, I, K, N, H, E, G, M, R, Y, V, F, L, and P. In some embodiments, the Kabat HCDR2 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1171.

[0261] In some embodiments, the polypeptide molecule comprises a TCR0V12-3 -binding domain. In some embodiments, the TCRpV12-3-binding domain comprises a Kabat HCDR3 that comprises the amino acid sequence of X99X100X101X102X103X104X105X106, wherein X99 is selected from the group consisting of R, I, K, L, P, N, S, Y, V, A, G, T, D, Q, H, M, and W; X100 is selected from the group consisting of: G, N, H, S, K, Y, M, R, F, L, D, E, T, I, W, V, and P; X101 is selected from the group consisting of: E, H, L, A, T, M, R, S, G, N, Y, W, K, I, P, V, and D; X102 is selected from the group consisting of G, W, H, Y, K, R, A, F, N, V, M, S, T, E, L, P, I, and D; X103 is selected from the group consisting of: A, S, K, Y, G, T, V, P, R, F, W, N, I, Q, L, H, M, D, and E; X104 is selected from the group consisting of M, L, A, P, F, G, E, N, T, S, R, H, Q, W, Y, and D; X105 is selected from the group consisting of: D, I, H, Q, Y, K, T, W, L, R, S, E, M, G, P, F, and V; and Xioe is selected from the group consisting of: Y, N, A, W, V, M, P, T, Q, R, S, H, L, F, G, and D. In some embodiments, X99 is R. In some embodiments, X100 is G. In some embodiments, X101 is selected from the group consisting of E, II, L, A, T, M, R, S, G, N, Y, W, K, I, and P. In some embodiments, X101 is A. In some embodiments, X102 is G. In some embodiments, X103 is A. In some embodiments, X104 is M. In some embodiments, X105 is D. In some embodiments, X106 is selected from the group consisting of Y, N, A, W, V, M, P, and T. In some embodiments, the Kabat HCDR3 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1180.

[0262] In some embodiments, the polypeptide molecule comprises a TCRPV12-3 -binding domain. In some embodiments, the TCRpV12-3-bmding domain comprises a Kabat LCDR1 that comprises the ammo acid sequence of R24A25Z2.6Z27Z2.8Z29Z30Z31Z32Z33, wherein Z26 is selected from the group consisting of: S, M, V, L, Q, R, H, Y, I, T, F, A, W, N, P, G, D, and K; Z2.7 is selected from the group consisting of S, K, R, H, Y, N, I, Q, T, G, M, L, F, V, A, W, P, E, and D; Z28 is selected from the group consisting of: S, K, N, R, P, M, Y, A, I, H, V, Q, W, D, F, E, T, and G; Z29 is selected from the group consisting of I, T, L, A, R, M, G, P, Q, Y, F, H, W, N, E, and D; Z30 is selected from the group consisting of: N, V, R, K, M, A, T, L, W, E, Y, Q, S, H, G, P, F, and D; Z31 is selected from the group consisting of Y, F, Y, K, R, H, A, N, M, Q, V, P, G, L, T, E, I, and D; Z32 is selected from the group consisting of: I, A, S, M, L, T, Q, D, P, H, F, N, K, W, Y,and R; and Z33 is selected from the group consisting of Y, D, W, S, L, F, H, T, R, G, P, A, N, V, and I. In some embodiments, Z26 is selected from the group consisting of S, M, V, and L. In some embodiments, Z27 is selected from the group consisting of S, K, R, and H. In some embodiments, Z27 is selected from the group consisting of K and R. In some embodiments, Z28 is selected from the group consisting of S, K, N, R, and P. In some embodiments, Z29 is I. In some embodiments, Z30 is selected from the group consisting of N and V. In some embodiments, Z31 is selected from the group consisting of Y and F. In some embodiments, Z32 is selected from the group consisting of I, A, and S, In some embodiments, Z32 is A. In some embodiments, Z33 is Y. In some embodiments, the Kabat LCDR 1 of the TCRpV12-3-bindmg domain does not comprise the amino acid sequence of SEQ ID NO: 1148,

[0263] In some embodiments, the polypeptide molecule comprises a TCRpVl 2-3 -binding domain. In some embodiments, the TCRpV12-3-binding domain comprises a Kabat LCDR2 that comprises the amino acid sequence of Z49Z50Z51Z52Z53Z54Z55, wherein Z49 is selected from the group consisting of: Y, K, Y, F, I, T, H, M, W, L, Q, A, G, P, V, N, E, and D; Z50 is selected from the group consisting of: T, P, S, I, Q, / X, W, F, M, N, G, L, Y, R, K, D, E, and II; Z51 is selected from the group consisting of: S, N, K, R, P, D, L, T, V, Y, II, A, Q, W, I, F, C, E, and G; Z52 is selected from the group consisting of N, R, K, A, L, V, F, M, W, G, E, Y, H, D, I, S, and P; Z53 is selected from the group consisting of L, II, K, A, N, Y, R, F, P, V, C, I, W, G, E, D, and T; Z5 is selected from the group consisting of: A, R, V, I, II, F, K, T, P, Q, N, G, E, D, and Y; and Z55 is selected from the group consisting of P, R, T, Q, V, L, W, E, D, G, I, H, S, M, F, N, and Y. In some embodiments, Z49 is selected from the group consisting of Y and K. In some embodiments, Z50 is selected from the group consisting of I' and P. In some embodiments, Z51 is selected from the group consisting of S, N, K, R, P, D, and L. In some embodiments, Z52 is selected from the group consisting of N, R, K, A, and L. In some embodiments, Z53 is selected from the group consisting of L and H. In some embodiments, Z54 is selected from the group consisting of A, R, and V. In some embodiments, Z55 is selected from the group consisting of P, R, T, Q, V, and L. In some embodiments, Z33 is Y. In some embodiments, the Kabat LCDR2 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1156.

[0264] In some embodiments, the polypeptide molecule comprises a TCRPVI 2-3 -binding domain. In some embodiments, the TCRpV12-3-binding domain comprises a Kabat LCDR3 that comprises the amino acid sequence of Z88Z89Z90Z91Z92Z93Z94Z95Z96, wherein Zss is selected fromthe group consisting of: Q, E, L, Y, N, M, P, D, S, V, H, T, W, I, F, and R; Zs9 is selected from the group consisting of: Q, H, E, K, V, R, T, G, S, A, L, I, F, M, Y, D, and P; Z90 is selected from the group consisting of F, S, L, K, M, Y, V, Q, N, A, R, I, T, H, G, W, D, P, and E; Z91 is selected from the group consisting of T, S, I, H, N, A, K, G, R, Q, Y, M, F, L, V, P, W, E, and D; Z92 is selected from the group consisting of: S, G, R, A, N, Y, M, W, D, T, F, V, K, Q, H, L, I, E, and P; Z93 is selected from the group consisting of S, K, A, F, R, P, H, T, V, M, L, E, N, Q, W, D, and G; Z94 is selected from the group consisting of: P, W, E, I, Y, T, F, H, L, A, S, C, R, K, N, Q, and V; Z95 is selected from the group consisting of F, L, P, M, V, W, A, N, S, I, G, E, H, Q, and R; and Z96 is selected from the group consisting of T, V, S, H, Y, L, F, I, W, R, Q, M, E, K, G, and D. In some embodiments, Zss is Q, In some embodiments, Zg9 is Q. In some embodiments, Z90 is F, In some embodiments, Z91 is T. In some embodiments, Z92 is selected from the group consisting of S, G, and R. In some embodiments, Z93 is selected from the group consisting of S, K, A, F, R, P, and H. In some embodiments, Z94 is P. In some embodiments, Z95 is F. In some embodiments, Z96 is selected from the group consisting of T, V, S H, and Y. In some embodiments, Z96 is V, In some embodiments, Z33 is Y. In some embodiments, the Kabat LCDR3 of the TCRpV 12-3 -binding domain does not comprise the ammo acid sequence of SEQ ID NO: 1157.

[0265] In some embodiments, the polypeptide molecule comprises a TCRpV 12-3 -binding domain. In some embodiments, the TCRpV12-3-bmding domain comprises a Kabat HCDR1 that comprises the ammo acid sequence of X31X32G33M34H35, wherein X31 is selected from the group consisting of: N, R, I, Y, V, H, L, T, S, Q, and D; and X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, and 1;a Kabat HCDR2 that comprises the amino acid sequence of Y50I51S52S53X54X55S56X57X58X59Y60X61X62X63L64K65G66, wherein X54 is selected from the group consisting of G, W, 5', Y, T, Q, V, R, H, E, M, K, and P; X55 is selected from the group consisting of S and H; X57 is selected from the group consisting of T and V; Xss is selected from the group consisting of: I, F, W, and Y; X59 is selected from the group consisting of: Y, L, I, and H; Xsi is selected from the group consisting of A, K, R, D, Q, W, N, S, Y, G, and F; Xe2 is selected from the group consisting of D, P, and T; and Xes is selected from the group consisting of T, I, K, N, H, E, G, M, R, Y, V, F, L, and P;a Kabat HCDR3 that comprises the amino acid sequence of R99G100X101G102A103M104D105X106, wherein X101 is selected from the group consisting of: E, H, L,A, T, M, R, S, G,, Y, W, K, I, and P; and Xw is selected from the group consisting of: Y, N, A, W, V, M, P, and T;a Kabat LCDR1 that comprises the amino acid sequence of R24A25Z26Z27Z28I29Z30Z31Z32Y33, wherein Z26 is selected from the group consisting of: S, M, V, and L; Z27 is selected from the group consisting of S, K, R, and H; Z28 is selected from the group consisting of: S, K, N, R, and P; Z30 is selected from the group consisting of: N and V; Z31 is selected from the group consisting of Y and F; Z32 is selected from the group consisting of: I, A, and S;a Kabat LCDR2 that comprises the ammo acid sequence of Z49Z50Z51Z52Z53Z54Z55, wherein Z49 is selected from the group consisting of: Y and K; Z50 is selected from the group consisting of: T and P; Z51 is selected from the group consisting of: S, N, K, R, P, D, and L; Z52 is selected from the group consisting of N, R, K, A, and L; Z53 is selected from the group consisting of L and H; Z54 is selected from the group consisting of: A, R, and V; and Z is selected from the group consisting of P, R, T, Q, V, and L;a Kabat LCDR3 that comprises the amino acid sequence of Q88Q89F90T91Z92Z93P94F95Z96, wherein Z92 is selected from the group consisting of: S, G, and R; Z93 is selected from the group consisting of S, K, A, F, R, P, and FI; and Z96 is selected from the group consisting of T, V, S, II, and Y.wherein the polypeptide molecule does not comprise SEQ ID NOs: 1148, 1156, 1157, 1160, 1171, and 1180.

[0266] In some embodiments, the polypeptide molecule comprises a TCR0V12-3 -binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT HCDR1 that comprises the ammo acid sequence of G26X27X28X29X30X31X32G33, wherein X2.7 is selected from the group consisting of: F, Y, W, M, I, L, H, V, A, Q, G, T, N, P, S, R, K, and E; X2.8 is selected from the group consisting of T, K, S, M, N, I, F, H, G, Q, R, W, V, Y, E, A, D, and L; X2.9 is selected from the group consisting of: F, Y, W, M, I, T, A, E, L, V, S, P, N, Q, H, G, K, R, and D; X30 is selected from the group consisting of S, H, R, Q, W, F, K, N, Y, M, V, G, P, L, E, D, and I; X31 is selected from the group consisting of: N, R, I, Y, V, H, L, T, S, Q, D, F, K, M, A, W, G, E, and P; and X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, I, G, M, L, Q, N, E, W, D, and P. In some embodiments, X27 is F. In some embodiments, X28 is selected from the group consisting of T and K. In some embodiments, X29 is F. In some embodiments,X30 is selected from the group consisting of S and H. In some embodiments, X31 is selected from the group consisting of T, N, R, I, Y, V, H, L, T, S, Q, and D. In some embodiments, X31 is selected from the group consisting of R and I. In some embodiments, X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, and I. In some embodiments, X32 is T. In some embodiments, the IMGT HCDR1 of the TCRPV 12- 3 -binding domain does not comprise the amino acid sequence of SEQ ID NO: 1186.

[0267] In some embodiments, the polypeptide molecule comprises a TCRpV12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT HCDR2 that comprises the ammo acid sequence of I51S52X53X54X55X56X57X58, wherein X53 is selected from the group consisting of: S, T, G, K, A, L, W, Y, E, D, I, M, V, N, P, F, H, and Q; X54 is selected from the group consisting of G, W, S, Y, T, Q, V, R, H, E, M, K, P, N, F, A, L, I, and D; X55 is selected from the group consisting of S, H, G, Q, A, T, L, M, E, W, N, K, R, Y, D, P, I, and F; Xss is selected from the group consisting of: S, M, T, P, K, R, Q, Y, L, G, N, H, I, D, V, F, W, and E; X57 is selected from the group consisting of T, V, S, L, A, I, P, M, R, K, Q, H, W, F, Y, E, and D; and Xss is selected from the group consisting of: I, F, W, Y, V, E, L, M, A, K, R, T, D, N, S, P, H, and G. In some embodiments, X53 is S. In some embodiments, X54 is selected from the group consisting of G, W, S, Y, T, Q, V, R, II, E, M, K, and P. In some embodiments, X54 is selected from the group consisting of S and T. In some embodiments, X55 is selected from the group consisting of S and II. In some embodiments, X56 is S. In some embodiments, X57 is selected from the group consisting of T and V. In some embodiments, Xss is selected from the group consisting of I, F, W, and Y. In some embodiments, the IMGT HCDR2 of the TCRPV 12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1197.

[0268] In some embodiments, the polypeptide molecule comprises a TCRpV12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT HCDR3 that comprises the ammo acid sequence of A97R98X99X100X101X102X103X104X105X106, wherein X99 is selected from the group consisting of R, I, K, L, P, N, S, Y, V, A, G, T, D, Q, H, M, and W; X100 is selected from the group consisting of: G, N, H, S, K, Y, M, R, F, L, D, E, T, I, W, V, and P; X101 is selected from the group consisting of: E, H, L, A, T, M, R, S, G, N, Y, W, K, I, P, V, and D; X102 is selected from the group consisting of G, W, H, Y, K, R, A, F, N, V, M, S, T, E, L, P, I, and D; X103 is selected from the group consisting of: A, S, K, Y, G, T, V, P, R, F, W, N, I, Q, L, H, M, D, and E; X104 is selected from the group consisting of M, L, A, P, F, G, E, N, T, S,R, H, Q, W, Y, and D; X105 is selected from the group consisting of D, I, H, Q, Y, K, T, W, L, R, S, E, M, G, P, F, and V; and Xioe is selected from the group consisting of: Y, N, A, W, V, M, P, T, Q, R, S, H, L, F, G, and D In some embodiments, X99 is R. In some embodiments, X100 is G In some embodiments, X101 is selected from the group consisting of E, H, L, A, T, M, R, S, G, N, Y, W, K, I, and P In some embodiments, X101 is A. In some embodiments, X102 is G. In some embodiments, X103 is A. In some embodiments, X104 is M. In some embodiments, X105 is D. In some embodiments, X106 is selected from the group consisting of Y, N, A, W, V, M, P, and T. In some embodiments, the IMGT HCDR3 of the TCRpV 12-3 -binding domain does not comprise the amino acid sequence of SEQ ID NO: 1201.

[0269] In some embodiments, the polypeptide molecule comprises a TCR(3V12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT LCDR1 that comprises the amino acid sequence of Z27Z28Z29Z30Z31, wherein Z27 is selected from the group consisting of: S, K, R, H, Y, N, I, Q, T, G, M, L, F, V, A, W, P, E, and D; Z28 is selected from the group consisting of: S, K, N, R, P, M, Y, A, I, H, V, Q, W, D, F, E, T, and G; Z29 is selected from the group consisting of I, T, L, A, R, M, G, P, Q, Y, F, II, W, N, E, and D; Z30 is selected from the group consisting of: N, V, R, K, M, A, T, L, W, E, Y, Q, S, II, G, P, F, and D; and Z31 is selected from the group consisting of Y, F, Y, K, R, H, A, N, M, Q, V, P, G, L, T, E, I, and D. In some embodiments, Z27 is selected from the group consisting of S, K, R, and H. In some embodiments, Z27 is selected from the group consisting of K and R. In some embodiments, Z2.8 is selected from the group consisting of S, K, N, R, and P. In some embodiments, Z29 is I. In some embodiments, Z30 is selected from the group consisting of N and V. In some embodiments, Z31 is selected from the group consisting of Y and F. In some embodiments, the IMGT LCDR1 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of SEQ ID NO: 1182.

[0270] In some embodiments, the polypeptide molecule comprises a TCRpV12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT LCDR2 that comprises the ammo acid sequence of Z49Z50Z51, wherein Z49 is selected from the group consisting of: Y, K, Y, F, I, T, H, M, W, L, Q, A, G, P, V, N, E, and D; Z50 is selected from the group consisting of: T, P, S, I, Q, A, W, F, M, N, G, L, Y, R, K, D, E, and H; and Z51 is selected from the group consisting of S, N, K, R, P, D, L, T, V, Y, H, A, Q, W, I, F, C, E, and G In some embodiments, Z49 is selected from the group consisting of Y and K. In some embodiments, Z50 isselected from the group consisting of T and P. In some embodiments, Z51 is selected from the group consisting of S, N, K, R, P, D, and L. In some embodiments, the IMGT LCDR2 of the TCRpV12-3-binding domain does not comprise the amino acid sequence of YTS.

[0271] In some embodiments, the polypeptide molecule comprises a TCRpV12-3-binding domain. In some embodiments, the TCRpV12-3-binding domain comprises an IMGT LCDR3 that comprises the amino acid sequence of Z88Z89Z90Z91Z92Z93Z94Z95Z96, wherein Zss is selected from the group consisting of: Q, E, L, Y, N, M, P, D, S, V, H, T, W, I, F, and R; Zs9 is selected from the group consisting of: Q, H, E, K, V, R, T, G, S, A, L, I, F, M, Y, D, and P; Z90 is selected from the group consisting of F, S, L, K, M, Y, V, Q, N, A, R, I, T, H, G, W, D, P, and E; Z91 is selected from the group consisting of: T, S, I, H, N, A, K, G, R, Q, Y, M, F, L, V, P, W, E, and D; Z92 is selected from the group consisting of: S, G, R, A, N, Y, M, W, D, T, F, V, K, Q, H, L, I, E, and P; Z93 is selected from the group consisting of S, K, A, F, R, P, H, T, V, M, L, E, N, Q, W, D, and G; Z94 is selected from the group consisting of: P, W, E, I, Y, T, F, H, L, A, S, C, R, K, N, Q, and V; Z95 is selected from the group consisting of F, L, P, M, V, W, A, N, S, I, G, E, H, Q, and R; and Z96 is selected from the group consisting of T. V, S, II, Y, L, F, I, W, R, Q, M, E, K, G, and D. In some embodiments, Zss is Q. In some embodiments, Zs9 is Q In some embodiments, Z90 is F. In some embodiments, Z91 is T. In some embodiments, Z92 is selected from the group consisting of S, G, and R. In some embodiments, Z93 is selected from the group consisting of S, K, A, F, R, P, and H; Z94 is P. In some embodiments, Z95 is F. In some embodiments, Z96 is selected from the group consisting of T, V, S, H, and Y. In some embodiments, Z96 is V. In some embodiments, the IMGT LCDR3 of the TCRPV 12-3 -binding domain does not comprise the amino acid sequence of SEQ ID NO: 1157.

[0272] In some embodiments, the polypeptide molecule comprises a TCRPV 12-3 -binding domain. In some embodiments, the TCRPV 12-3 -binding domain comprises an IMGT HCDR1 that comprises the amino acid sequence of G26F27X28F29X30X31X32G33, wherein X2.8 is selected from the group consisting of T and K; X30 is selected from the group consisting of S and H; X31 is selected from the group consisting of: N, R, I, Y, V, H, L, T, S, Q, and D; and X32 is selected from the group consisting of F, K, T, Y, V, R, A, H, and I;an IMGT HCDR2 that comprises the amino acid sequence of I51S52S53X54X55S56X57X58, wherein X54 is selected from the group consisting of G, W, S, Y, T, Q, V, R, H, E, M, K, and P;X55 is selected from the group consisting of S and H; X57 is selected from the group consisting of T and V; and X58 is selected from the group consisting of: I, F, W, and Y;an IMGT HCDR3 that comprises the amino acid sequence of A97R98R99G100X101G102A103M104D105X106, wherein X101 is selected from the group consisting of: E, H, L, A, T, M, R S, G, N, Y, W, K, I, and P; and X106 is selected from the group consisting of: Y, N, A, W, V, M, P, and T;an IMGT LCDR1 that comprises the amino acid sequence of Z27Z28I29Z30Z31, wherein Z27 is selected from the group consisting of: S, K, R, and H; Z28 is selected from the group consisting of: S, K, N, R, and P; Z30 is selected from the group consisting of: N and V; and Z31 is selected from the group consisting of Y and F;an IMGT LCDR2 that comprises the amino acid sequence of Z49Z50Z51, wherein Z49 is selected from the group consisting of: Y and K; Z50 is selected from the group consisting of: T and P; and Z51 is selected from the group consisting of S, N, K, R, P, D, and L;an IMGT LCDR3 that comprises the amino acid sequence of Q88Q89F90T91Z92Z93P94F95Z96, wherein Z92 is selected from the group consisting of: S, G, and R; Z93 is selected from the group consisting of S, K, A, F, R, P, and II; and Zss is selected from the group consisting of T, V, S, FI, and Y; andwherein the polypeptide molecule does not comprise the amino acid sequence of SEQ ID NOs: 1157, 1182, 1186, 1197, and 1201, and YTS.

[0273] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0274] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a KabatHCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYIY (SEQ ID NO: 1148); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0275] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSnLYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0276] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat IICDRl that comprises the amino acid sequence of IKGMFI (SEQ ID NO: 1164); a Kabat HCDR2 that comprises the ammo acid sequence of YISSGSSTIYYADTLKG (SEQ ID NO: 1171); a Kabat FICDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0277] In some embodiments, the TCRpV12-3-bmding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of NKGMH (SEQ ID NO: 1165); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTIYYADTLKG (SEQ ID NO: 1175); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDRl that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In someembodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0278] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of NFGMH (SEQ ID NO: 1160); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTILYADTLKG (SEQ ID NO: 1176); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0279] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat FICDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, IICDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0280] In some embodiments, the TCRpV12-3-bmding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RFGMH (SEQ ID NO: 1166); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTILYADTLKG (SEQ ID NO: 1176); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0281] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of RKGMH (SEQ ID NO: 1167); a Kabat HCDR2 thatcomprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYIY (SEQ ID NO: 1155); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0282] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the ammo acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, IICDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0283] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0284] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of NKGMH (SEQ ID NO: 1165); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDRl that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a KabatLCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0285] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RFGMH (SEQ ID NO: 1166); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTIYYADTLKG (SEQ ID NO: 1178); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); aKabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0286] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the ammo acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0287] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of RKGMH (SEQ ID NO: 1167); a Kabat HCDR2 that comprises the ammo acid sequence of YISSGSSTIYYADTLKG (SEQ ID NO: 1171); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the ammo acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0288] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0289] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of IKGMH (SEQ ID NO: 1164); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0290] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RKGMH (SEQ ID NO: 1167); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0291] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of IFGMH (SEQ ID NO: 1162); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a KabatLCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0292] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of IYGMH (SEQ ID NO: 1169); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the ammo acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations,

[0293] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the amino acid sequence of YISSGSSTILYADTLKG (SEQ ID NO: 1179); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0294] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDRl that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In someembodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0295] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the ammo acid sequence of NKGMH (SEQ ID NO: 1165); a Kabat HCDR2 that comprises the amino acid sequence of YISSGSSTILYADTLKG (SEQ ID NO: 1179); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0296] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat FICDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYIY (SEQ ID NO: 1155); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, IICDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0297] In some embodiments, the TCRpV12-3-bmding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RFGMH (SEQ ID NO: 1166); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTIYYADTLKG (SEQ ID NO: 1178); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0298] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 thatcomprises the amino acid sequence of YISSSSSTIYYADTLKG (SEQ ID NO: 1175); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0299] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0300] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RKGMH (SEQ ID NO: 1167); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0301] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of NFGMH (SEQ ID NO: 1160); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTIYYADTLKG (SEQ ID NO: 1177); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDRl that comprises the amino acid sequence of RASKSVNYIY (SEQ ID NO: 1153); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a KabatLCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0302] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTLKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); aKabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0303] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0304] In some embodiments, the TCRPV 12- 3 -binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the ammo acid sequence of YISSWSSTILYADTLKG (SEQ ID NO: 1176); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0305] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the ammo acid sequence of NKGMH (SEQ ID NO: 1165); a Kabat HCDR2 that comprises the amino acid sequence of YISSWSSTILYADTLKG (SEQ ID NO: 1176); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASSSVNYAY (SEQ ID NO: 1154); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0306] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the ammo acid sequence of NKGMH (SEQ ID NO: 1165); a Kabat HCDR2 that comprises the ammo acid sequence of YISSGSSTILYADTLKG (SEQ ID NO: 1179); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); aKabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0307] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the ammo acid sequence of RASKSVNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0308] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTIYYADTLKG (SEQ ID NO: 1175); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181); a KabatLCDRl that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0309] In some embodiments, the TCRpV12-3-binding domain comprises: a Kabat HCDR1 that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTILYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180); a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYIY (SEQ ID NO: 1155); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations,

[0310] In some embodiments, the TCRpV12-3-bmding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0311] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDR1 that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0312] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTT (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0313] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSIKG (SEQ ID NO: 1190); an IMGT HCDR2 that comprises the amino acid sequence of ISSGSSTI (SEQ ID NO: 1197); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, 1ICDR2, 1ICDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0314] In some embodiments, the TCRpV12-3-bmding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNKG (SEQ ID NO: 1191); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDR1 that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0315] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNFG (SEQ ID NO: 1186); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acidsequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0316] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0317] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRFG (SEQ ID NO: 1192); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0318] In some embodiments, the TCRpV12-3-bmding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRKG (SEQ ID NO: 1193); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0319] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 thatcomprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0320] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0321] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSNKG (SEQ ID NO: 1191); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, IICDR2, IICDR3, LCDRl, LCDR2, and / or LCDR3 has I, 2, or 3 mutations.

[0322] In some embodiments, the TCR(3V12-3 -binding domain comprises: an IMGT HCDRl that comprises the ammo acid sequence of GFTFSRFG (SEQ ID NO: 1192); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0323] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRlthat comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0324] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRKG (SEQ ID NO: 1193); an IMGT HCDR2 that comprises the amino acid sequence of ISSGSSTI (SEQ ID NO: 1197); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the ammo acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT ECDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0325] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT IICDR3 that comprises the ammo acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDRl, 1ICDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0326] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSIKG (SEQ ID NO: 1190); an IMGT HCDR2 that comprises the ammo acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0327] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSRKG (SEQ ID NO: 1193); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 thatcomprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0328] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSIFG (SEQ ID NO: 1188); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0329] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GFTFSIYG (SEQ ID NO: 1195); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0330] In some embodiments, the TCR(3V12-3 -binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSGSSTI (SEQ ID NO: 1197); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0331] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0332] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the ammo acid sequence of GFTFSNKG (SEQ ID NO: 1191); an IMGT HCDR2 that comprises the amino acid sequence of ISSGSSTI (SEQ ID NO: 1197); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0333] In some embodiments, the TCRpV12-3-bmding domain comprises: an IMGT IICDRl that comprises the ammo acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT 1ICDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT 1ICDR3 that comprises the ammo acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of Yl'S; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0334] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRFG (SEQ ID NO: 1192); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0335] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTT (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0336] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the ammo acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0337] In some embodiments, the TCRβV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRKG (SEQ ID NO: 1193); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0338] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNFG (SEQ ID NO: 1186); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acidsequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0339] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0340] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2 that comprises the ammo acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0341] In some embodiments, the TCRβV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0342] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNKG (SEQ ID NO: 1191); an IMGT HCDR2 that comprises the amino acid sequence of ISSWSSTI (SEQ ID NO: 1200); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of SSVNY (SEQ ID NO: 1182); an IMGT LCDR2 thatcomprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0343] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSNKG (SEQ ID NO: 1191); an IMGT HCDR2 that comprises the amino acid sequence of ISSGSSTI (SEQ ID NO: 1197); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0344] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the ammo acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRl that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0345] In some embodiments, the TCR(3V12-3 -binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202); an IMGT LCDRl that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0346] In some embodiments, the TCRpV12-3-binding domain comprises: an IMGT HCDRl that comprises the amino acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201); an IMGT LCDRlthat comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159). In some embodiments, the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 has 1, 2, or 3 mutations.

[0347] In some embodiments, the TCRpV12-3-bindmg domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1116; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRpV12-3-bindmg domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1116; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0348] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1116; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1105. In some embodiments, the TCRβV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1116; and a VL comprising an amino acid sequence of SEQ ID NO: 1105.

[0349] In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1117; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1117; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0350] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1118; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1106. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1118; and a VL comprising an amino acid sequence of SEQ ID NO: 1106.

[0351] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1119; and a VL comprising an amino acid sequence with at least about 85%, 90%,95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1107. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1119; and a VL comprising an amino acid sequence of SEQ ID NO: 1107.

[0352] In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1120; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1105. In some embodiments, the TCRpVl 2-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1120; and a VL comprising an amino acid sequence of SEQ ID NO: 1105.

[0353] In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1121; and a VL comprising an ammo acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1108, In some embodiments, the TCRpVl 2-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1121; and a VL comprising an ammo acid sequence of SEQ ID NO: 1108.

[0354] In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1122; and a VL comprising an ammo acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1109. In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1122; and a VL comprising an ammo acid sequence of SEQ ID NO: 1109.

[0355] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1123; and a VL comprising an ammo acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1110. In some embodiments, the TCRpVl 2-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1123; and a VL comprising an amino acid sequence of SEQ ID NO: 1110.

[0356] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1124; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1105. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1124; and a VL comprising an amino acid sequence of SEQ ID NO: 1105.

[0357] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1125; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1105. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1125; and a VL comprising an amino acid sequence of SEQ ID NO: 1105.

[0358] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1126; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1111. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1126; and a VL comprising an amino acid sequence of SEQ ID NO: 1111.

[0359] In some embodiments, the TCRpV 12-3-binding domain comprises a VII comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1127; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1108. In some embodiments, the TCRβV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1127; and a VL comprising an amino acid sequence of SEQ ID NO: 1108.

[0360] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1128; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1109. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1128; and a VL comprising an amino acid sequence of SEQ ID NO: 1109.

[0361] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1129; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1111. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1129; and a VL comprising an amino acid sequence of SEQ ID NO: 1111.

[0362] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1130; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1107. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1130; and a VL comprising an amino acid sequence of SEQ ID NO: 1107.

[0363] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1131; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1109. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1131; and a VL comprising an amino acid sequence of SEQ ID NO: 1109.

[0364] In some embodiments, the TCRpV 12-3-binding domain comprises a VII comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1132; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1111. In some embodiments, the TCRβV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1132; and a VL comprising an amino acid sequence of SEQ ID NO: 1111.

[0365] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1116; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1108. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1116; and a VL comprising an amino acid sequence of SEQ ID NO: 1108.

[0366] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1133; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1111. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1133; and a VL comprising an amino acid sequence of SEQ ID NO: 1111.

[0367] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1134; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1106. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1134; and a VL comprising an amino acid sequence of SEQ ID NO: 1106.

[0368] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1135; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1108. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1135; and a VL comprising an amino acid sequence of SEQ ID NO: 1108.

[0369] In some embodiments, the TCRpV 12-3-binding domain comprises a VII comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1136; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1112. In some embodiments, the TCRpV12-3-bindmg domain comprises a VI I comprising an amino acid sequence of SEQ ID NO: 1136; and a VL comprising an amino acid sequence of SEQ ID NO: 1112.

[0370] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1137; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1110. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1137; and a VL comprising an amino acid sequence of SEQ ID NO: 1110.

[0371] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1127; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1127; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0372] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1138; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1106. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1138; and a VL comprising an amino acid sequence of SEQ ID NO: 1106.

[0373] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1139; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1105. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1139; and a VL comprising an amino acid sequence of SEQ ID NO: 1105.

[0374] In some embodiments, the TCRpV 12-3-binding domain comprises a VII comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1132; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1109. In some embodiments, the TCRpV12-3-bindmg domain comprises a VI I comprising an amino acid sequence of SEQ ID NO: 1132; and a VL comprising an amino acid sequence of SEQ ID NO: 1109.

[0375] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1140; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1109. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1140; and a VL comprising an amino acid sequence of SEQ ID NO: 1109.

[0376] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1141; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1141; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0377] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1142; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1142; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0378] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1143; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1143; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0379] In some embodiments, the TCRpV 12-3-binding domain comprises a VII comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1144; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1111. In some embodiments, the TCRpV12-3-bindmg domain comprises a VI I comprising an amino acid sequence of SEQ ID NO: 1144; and a VL comprising an amino acid sequence of SEQ ID NO: 1111.

[0380] In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1145; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRPV 12-3 -binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1145; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0381] In some embodiments, the TCRPV12-3 -binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1117; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1106. In some embodiments, theTCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1117; and a VL comprising an amino acid sequence of SEQ ID NO: 1106.

[0382] In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1146; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1104. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1146; and a VL comprising an amino acid sequence of SEQ ID NO: 1104.

[0383] In some embodiments, the TCRpV 12-3-binding domain comprises a VH comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1147; and a VL comprising an amino acid sequence with at least about 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1110. In some embodiments, the TCRpV12-3-binding domain comprises a VH comprising an amino acid sequence of SEQ ID NO: 1147; and a VL comprising an amino acid sequence of SEQ ID NO: 1110.

[0384] In some embodiments, the polypeptide molecule comprises a TCRpV 12-3 -binding domain. In some embodiments, the TCRPVI 2-3 -binding domain comprises an amino acid sequence of any one of the ammo acid sequences in Table 31. In some embodiments, the TCRpV 12-3 -binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any one of the ammo acid sequences in Table 31.

[0385] In some embodiments, the polypeptide molecule comprises a TCRPV 12-3 -binding domain. In some embodiments, the TCRPV 12-3 -binding domain comprises an amino acid sequence of any one of the ammo acid sequences in Table 32. In some embodiments, the TCRPVI 2-3 -binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any one of the amino acid sequences in Table 32. In some embodiments, the TCRPV 12-3- binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 1203-1277. In some embodiments, the TCRPVI 2-3 -binding domain comprises an amino acid sequence of any one of SEQ ID NOs: 1203-1277. In some embodiments, theTCRpV12-3-binding domain consists of an amino acid sequence of any one of SEQ ID NOs: 1203-1277. In some embodiments, the polypeptide molecule is an scFv.

[0386] In some embodiments, the TCRpV12-3-binding domain comprises an scFv. In some embodiments, the TCRpV12-3-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1262. In some embodiments, the TCRPV12-3 -binding domain comprises an amino acid sequence of SEQ ID NO: 1262. In some embodiments, the TCRPV12-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1262.

[0387] In some embodiments, the TCRpV12-3-binding domain comprises an scFv, In some embodiments, the TCRpVl 2-3-binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1264, In some embodiments, the TCRpVl 2-3 -binding domain comprises an amino acid sequence of SEQ ID NO: 1264, In some embodiments, the TCRpVl 2-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1264.

[0388] In some embodiments, the TCRpVl 2-3-binding domain comprises an scFv. In some embodiments, the TCRpVl 2-3-binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1270. In some embodiments, the TCRpVl 2-3-binding domain comprises an amino acid sequence of SEQ ID NO: 1270. In some embodiments, the TCRpV12-3- binding domain consists of an amino acid sequence of SEQ ID NO: 1270.

[0389] In some embodiments, the TCRpV12-3-bmding domain comprises an scFv. In some embodiments, the TCRpVl 2-3 -binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1271. In some embodiments, the TCRpVl 2-3 -binding domain comprises an amino acid sequence of SEQ ID NO: 1271. In some embodiments, the TCRPV12-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1271.

[0390] In some embodiments, the TCRpV12-3-binding domain comprises an scFv. In some embodiments, the TCRpVl 2-3-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1275. In some embodiments, the TCRpVl 2-3 -binding domaincomprises an amino acid sequence of SEQ ID NO: 1275. In some embodiments, the TCRPV12-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1275.

[0391] In some embodiments, the TCRpV12-3-binding domain comprises an scFv. In some embodiments, the TCRpV12-3-binding domain comprises an amino acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1276. In some embodiments, the TCRpV12-3-binding domain comprises an amino acid sequence of SEQ ID NO: 1276. In some embodiments, the TCRPV12-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1276.

[0392] In some embodiments, the TCRpV12-3-binding domain comprises an scFv, In some embodiments, the TCRpVl 2-3-binding domain comprises an ammo acid sequence with at least about or at most about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 1277, In some embodiments, the TCRpVl 2-3-binding domain comprises an amino acid sequence of SEQ ID NO: 1277, In some embodiments, the TCRpVl 2-3-binding domain consists of an amino acid sequence of SEQ ID NO: 1277.

[0393] In some embodiments, the polypeptide molecule comprises a TCRpVl 2-3 -binding domain. In some embodiments, the TCRpVl 2-3-binding domain comprises a light chain and / or a heavy chain having at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to an amino acid sequence of Table 26, Table 27, Table 28, and Table 29. In some embodiments, the polypeptide molecule comprises a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1278, 1426, 1427, 1431-1451, and 1459-1851. In some embodiments, the polypeptide molecule comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1280, 1287, 1291, 1429, 1430, 1452-1458, and 1852-2229. In some embodiments, the polypeptide molecule comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at leastabout 99%, or 100% identical to any one of SEQ ID NOs: 1278, 1426, 1427, 1431-1451, and 1459-1851; and (li) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1280, 1287, 1291, 1429, 1430, 1452-1458, and 1852-2229. In some embodiments, the polypeptide molecule comprises a Fab that specifically binds to TCRPV12-3.

[0394] In some embodiments, the polypeptide molecule comprises a TCRpVl 2-3 -binding domain. In some embodiments, the TCRpVl 2-3-binding domain comprises a light chain and / or a heavy chain having at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% idenuty to an amino acid sequence of Table 33. In some embodiments, the polypeptide molecule comprises a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1293-1317, and 1319-1328. In some embodiments, the polypeptide molecule comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1280-1292. In some embodiments, the polypeptide molecule comprises a Fab that specifically binds to TCRPV12-3. In some embodiments, the polypeptide molecule comprises: (i) a heavy chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1293-1317, and 1319-1328; and (li) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1280-1292. In some embodiments, the polypeptide molecule comprises a Fab that specifically binds to TCRPV12-3.

[0395] In some embodiments, the TCRPV12-3 -binding domain comprises a Fab. In some embodiments, the TCRpV12-3-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1315; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, t least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1288.

[0396] In some embodiments, the TCRPV 12-3 -binding domain comprises a Fab. In some embodiments, the TCRpV12-3-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1317; and (ii) a light chain comprising an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1290.

[0397] In some embodiments, the TCRPV 12-3 -binding domain comprises a Fab. In some embodiments, the I'CR V 12-3 -binding domain comprises: (!) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1322; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, t least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1284.

[0398] In some embodiments, the TCRPV12-3 -binding domain comprises a Fab. In some embodiments, the TCRpV12-3-binding domain comprises: (i) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%,at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1297; and (ii) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1286.

[0399] In some embodiments, the TCRPVI 2-3 -binding domain...

Claims

1. CLAIMS:

1. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding comprises:a Kabat HCDR1 that comprises an amino acid sequence selected from any one of: TYYIH (SEQ ID NO: 112), LYYIH (SEQ ID NO: 136), TWYIH (SEQ ID NO: 145), and LWYIH (SEQ ID NO: 147);a Kabat HCDR2 that comprises an amino acid sequence selected from any one of: WFFPGSGNIKYNEKFKG (SEQ ID NO: 69) and WFFPRSGNIKYNEKFKG (SEQ ID NO: 142) a Kabat HCDR3 that comprises an amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137)a Kabat LCDR1 that comprises an ammo acid sequence selected from any one of: KASQNVGINVV (SEQ ID NO: 71) and KASQNVGIRVV (SEQ ID NO: 134);a Kabat LCDR2 that comprises an ammo acid sequence selected from any one of: SSSIIRYS (SEQ ID NO: 72), SSSHRYK (SEQ ID NO: 128), and SSSIIRYR (SEQ ID NO: 144);a Kabat LCDR3 that comprises an amino acid sequence selected from any one of: QQFKSYPIT (SEQ ID NO: 135) and QQFKFYPIT (SEQ ID NO: 141);wherein each of the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 independently comprise 0, 1, 2, or 3 amino acid mutations.

2. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:(i) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 142, and 137, respectively, and the LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 134, 72, and 141, respectively;(ii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 136, 69, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 72, and 135, respectively;(iii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 69, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 144, and 135, respectively;(iv) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 142, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 72, and 135, respectively;(v) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 69, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 72, and 135, respectively:(vi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 142, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 71, 128, and 135, respectively;(vii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 136, 142, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 128, and 135, respectively;(viii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 142, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 71, 144, and 135, respectively;(ix) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 142, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 144, and 135, respectively;(x) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 136, 142, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 144, and 135, respectively;(xi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 145, 69, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 128, and 141, respectively;(xii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 69, and 137, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 71, 144, and 141, respectively;(xiii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 69, and 137, respectively, and the Kabat LCDRl, the LCDR2,and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 72, and 135, respectively;(xiv) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 112, 142, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 128, and 141, respectively;(xv) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 136, 69, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 128, and 141, respectively;(xvi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 142, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 144, and 135, respectively;(xvii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 136, 142, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 71, 144, and 135, respectively; or(xviii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 147, 142, and 137, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 134, 144, and 141, respectively.

3. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the ammo acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYS (SEQ ID NO:72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKFYPIT (SEQ ID NO: 141).

4. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the ammo acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSIIRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

5. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the amino acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSIIRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

6. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the ammo acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the amino acid sequence of WFFPGSGNIKYNEKFKG (SEQ ID NO: 69); a Kabat HCDR3 that comprises the ammo acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDR1 that comprises the amino acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

7. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the ammo acid sequence of LWYIH (SEQ ID NO: 147); a Kabat HCDR2 that comprises the amino acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVEDY (SEQ ID NO: 137);a Kabat ECDR1 that comprises the amino acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the ammo acid sequence of (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

8. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat heavy chain CDR1 (I ICDRl ) that comprises the amino acid sequence of TYYII I (SEQ ID NO: 112); a Kabat heavy chain CDR2 (FICDR2) that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat heavy chain CDR3 (HCDR3) that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat light chain CDRl (LCDRl) that comprises the ammo acid sequence of KASQNVGIRVV (SEQ ID NO: 134); a Kabat light chain CDR2 (LCDR2) that comprises the amino acid sequence of SSSHRYS (SEQ ID NO: 72); and a Kabat light chain CDR3 (LCDR3) that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135).

9. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the ammo acid sequence of LYYIH (SEQ ID NO: 136); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ IDNO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDRl that comprises the amino acid sequence of (SEQ ID NO: 134); a Kabat LCDR2 that comprises the amino acid sequence of (SEQ ID NO: 128); and a Kabat LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

10. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the ammo acid sequence of TYYIH (SEQ ID NO: 112); a Kabat HCDR2 that comprises the ammo acid sequence of WFFPRSGNIKYNEKFKG (SEQ ID NO: 142); a Kabat HCDR3 that comprises the amino acid sequence of SYYSFDVLDY (SEQ ID NO: 137);a Kabat LCDRl that comprises the ammo acid sequence of KASQNVGINVV (SEQ ID NO: 71); a Kabat LCDR2 that comprises the amino acid sequence of SSSHRYR (SEQ ID NO: 144); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135).

11. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises an amino acid sequence selected from any one of: GYSFTTYY (SEQ ID NO: 114), GYSFTLYY (SEQ ID NO: 139), GYSFTTWY (SEQ ID NO: 146), and GYSFTLWY (SEQ ID NO: 148);an IMGT HCDR2 that comprises an amino acid sequence selected from any one of: FFPGSGNI (SEQ ID NO: 115) and FFPRSGNI (SEQ ID NO: 143)an IMGT HCDR3 that comprises an amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140)an IMGT LCDRl that comprises an amino acid sequence selected from any one of: QNVGIN (SEQ ID NO: 113) and QNVGIR (SEQ ID NO: 138);an IMGT LCDR2 that comprises an amino acid sequence of SSS;an IMGT LCDR3 that comprises an amino acid sequence selected from any one of: QQFKSYPIT (SEQ ID NO: 135) and QQFKFYPIT (SEQ ID NO: 141);wherein each of the HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and / or LCDR3 independently comprise 0, 1, 2, or 3 amino acid mutations.

12. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:(i) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 114, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively;(ii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 139, 115, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(iii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 114, 115, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(iv) the IMGT HCDRl, the HCDR2, and the I ICDR3 comprising the ammo acid sequences of SEQ ID NOs: 114, 143, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(v) the IMGT HCDRl, the IICDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 148, 115, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDRl comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(vi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 148, 143, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 113, SSS, and 135, respectively;(vii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 139, 143, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(viii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 114, 143, and 140, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 113, SSS, and 135, respectively;(ix) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 114, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(x) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 139, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(xi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 146, 115, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively;(xii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 148, 115, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively;(xiii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 148, 115, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(xiv) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 114, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively;(xv) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 139, 115, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively;(xvi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 148, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively;(xvii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 139, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2,and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 135, respectively; or(xviii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 148, 143, and 140, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 138, SSS, and 141, respectively.

13. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the ammo acid sequence of SSS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFKFYPIT (SEQ ID NO: 141).

14. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the ammo acid sequence of SSS; and an IMGT LCDR3 that comprises the ammo acid sequence of QQFKSYPIT (SEQ ID NO: 135).

15. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the amino acid sequence of FFPGSGNI (SEQ ID NO:115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

16. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the ammo acid sequence of FFPGSGNI (SEQ ID NO: 115); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of Q VGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

17. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT IICDRl that comprises the amino acid sequence of GYSFTLWY (SEQ ID NO: 148); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVG1N (SEQ ID NO: 113); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

18. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:an IMGT HCDRl that comprises the amino acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO:143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

19. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTLYY (SEQ ID NO: 139); an IMGT HCDR2 that comprises the ammo acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of Q VGIR (SEQ ID NO: 138); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

20. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the ammo acid sequence of GYSFTTYY (SEQ ID NO: 114); an IMGT HCDR2 that comprises the amino acid sequence of FFPRSGNI (SEQ ID NO: 143); an IMGT HCDR3 that comprises the amino acid sequence of AASYYSFDVLDY (SEQ ID NO: 140);an IMGT LCDR1 that comprises the amino acid sequence of QNVG1N (SEQ ID NO: 113); an IMGT LCDR2 that comprises the amino acid sequence of SSS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFKSYPIT (SEQ ID NO: 135).

21. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises an amino acid sequence selected from any one of: NFGMH (SEQ ID NO: 1160); IFGMH (SEQ ID NO: 1162); RTGMH (SEQ ID NO: 1163); IKGMH (SEQ ID NO: 1164); NKGMH (SEQ ID NO: 1165); RFGMH (SEQ ID NO: 1166); RKGMH (SEQ IDNO: 1167); ITGMH (SEQ ID NO: 1168); IYGMH (SEQ ID NO: 1169); and NTGMH (SEQ ID NO: 1170);a Kabat HCDR2 that comprises an amino acid sequence selected from any one of: YISSGSSTIYYADTLKG (SEQ ID NO: 1171), YISSTSSTILYADTLKG (SEQ ID NO: 1173), YISSSSSTILYADTLKG (SEQ ID NO: 1174), YISSSSSHYYADTLKG (SEQ ID NO: 1175), YISSWSSTILYADTLKG (SEQ ID NO: 1176), YISSWSSTIYYADTLKG (SEQ ID NO: 1177), YISSTSSHYYADTLKG (SEQ ID NO: 1178), and YISSGSSTILYADTLKG (SEQ ID NO: 1179);a Kabat HCDR3 that comprises an ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180) and RGAGAMDY (SEQ ID NO: 1181 );a Kabat LCDRI that comprises an amino acid sequence selected from any one of: RASSSVNYIY (SEQ ID NO: 1148), RASRSVNYAY (SEQ ID NO: 1151), RASKSVNYAY (SEQ ID NO: 1152), RASKSVNYIY (SEQ ID NO: 1153), RASSSVNYAY (SEQ ID NO: 1154), and RASRSVNYIY (SEQ ID NO: 1155);a Kabat LCDR2 that comprises an amino acid sequence of YTSNLAP (SEQ ID NO: 1156); a Kabat LCDR3 that comprises an ammo acid sequence selected from any one of: QQFTSSPFT (SEQ ID NO: 1157) and QQFTSSPFV (SEQ ID NO: 1159);wherein each of the HCDR1, HCDR2, HCDR3, LCDRI, LCDR2, and / or LCDR3 independently comprise 0, 1, 2, or 3 amino acid mutations.

22. The polypeptide of claim 21, wherein the binding domain comprises:(i) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1162, 1173, and 1180, respectively, and the Kabat LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(li) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1162, 1173, and 1180, respectively, and the Kabat LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1148, 1156, and 1159, respectively;(iii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1163, 1174, and 1180, respectively, and the Kabat LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(iv) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1164, 1171, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1152, 1156, and 1159, respectively;(v) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1165, 1175, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1157, respectively;(vi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1160, 1176, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1159, respectively;(vii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1162, 1177, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1157, respectively;(viii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1166, 1176, and 1180, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1153, 1156, and 1159, respectively;(ix) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1167, 1173, and 1180, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1155, 1156, and 1159, respectively;(x) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1162, 1177, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1159, respectively;(xi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1162, 1174, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1159, respectively;(xii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1165, 1174, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1157, respectively;(xiii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1166, 1178, and 1180, respectively, and the Kabat LCDRl, theLCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1157, respectively;(xiv) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1168, 1173, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1159, respectively;(xv) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1167, 1171, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1157, respectively;(xvi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1168, 1177, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1157, respectively;(xvii) the Kabat HCD l, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1164, 1174, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1159, respectively;(xviii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1167, 1177, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1157, respectively;(xix) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1162, 1173, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1157, respectively;(xx) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1169, 1173, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1154, 1156, and 1157, respectively;(xxi) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1163, 1179, and 1180, respectively, and the Kabat LCDRl, theLCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1152, 1156, and 1159, respectively;(xxii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1170, 1173, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1157, respectively;(xxiii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1165, 1179, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1152, 1156, and 1157, respectively;(xxiv) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1168, 1173, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1155, 1156, and 1159, respectively;(xxv) the Kabat IICDRl, the IICDR2, and the IICDR3 comprising the ammo acid sequences of SEQ ID NOs: 1166, 1178, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(xxvi) the Kabat IICDRl, the IICDR2, and the IICDR3 comprising the ammo acid sequences of SEQ ID NOs: 1168, 1175, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1152, 1156, and 1159, respectively;(xxvii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1163, 1177, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1154, 1156, and 1159, respectively;(xxviii) the Kabat HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1167, 1177, and 1181, respectively, and the Kabat LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1159, respectively;(xxix) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1160, 1177, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1153, 1156, and 1159, respectively;(xxx) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1170, 1173, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(xxxi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1170, 1174, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(xxxii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1163, 1176, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(xxxiii) the Kabat HCDR1, the IICDR2, and the IICDR3 comprising the amino acid sequences of SEQ ID NOs: 1165, 1176, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1154, I l 56, and 1157, respectively;(xxxiv) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1165, 1179, and 1181, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively;(xxxv) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1163, 1174, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1152, 1156, and 1159, respectively;(xxxvi) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1170, 1175, and 1181, respectively, and the Kabat LCDR1, theLCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1151, 1156, and 1159, respectively; or(xxxvii) the Kabat HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1168, 1174, and 1180, respectively, and the Kabat LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1155, 1156, and 1159, respectively.

23. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTI. G (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the amnio acid sequence of RGAGAMDY (SEQ ID NO: 1181);a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the ammo acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFT (SEQ ID NO: 1157).

24. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTEKG (SEQ ID NO: 1173); a Kabat HCDR3 that comprises the ammo acid sequence of RGAGAMDY (SEQ ID NO: 1181);a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYIY (SEQ ID NO: 1155); a Kabat LCDR2 that comprises the ammo acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

25. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSTSSTILYADTEKG (SEQ IDNO: 1173); a Kabat HCDR3 that comprises the amino acid sequence of RGEGAMDY (SEQ ID NO: 1180);a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

26. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the ammo acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the ammo acid sequence of YISSSSSTILYADTI^KG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the amino acid sequence of RGAGAMDY (SEQ ID NO: 1181);a Kabat LCDR1 that comprises the ammo acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

27. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the amino acid sequence of RTGMH (SEQ ID NO: 1163); a Kabat HCDR2 that comprises the ammo acid sequence of YISSSSS1TLYADTLKG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180);a Kabat LCDR1 that comprises the amino acid sequence of RASKS VNYAY (SEQ ID NO: 1152); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

28. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDRl that comprises the amino acid sequence of NTGMH (SEQ ID NO: 1170); a Kabat HCDR2 that comprises the amino acid sequence of YISSSSSTIYYADTLKG (SEQ IDNO: 1175); a Kabat HCDR3 that comprises the ammo acid sequence of RGAGAMDY (SEQ ID NO: 1181);a Kabat LCDR1 that comprises the amino acid sequence of RASRSVNYAY (SEQ ID NO: 1151); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

29. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:a Kabat HCDR1 that comprises the amino acid sequence of ITGMH (SEQ ID NO: 1168); a Kabat HCDR2 that comprises the ammo acid sequence of YISSSSSTILYADTI^KG (SEQ ID NO: 1174); a Kabat HCDR3 that comprises the ammo acid sequence of RGEGAMDY (SEQ ID NO: 1180);a Kabat LCDR1 that comprises the ammo acid sequence of RASRSVNYIY (SEQ ID NO: 1155); a Kabat LCDR2 that comprises the amino acid sequence of YTSNLAP (SEQ ID NO: 1156); and a Kabat LCDR3 that comprises the ammo acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

30. A polypeptide molecule comprising an anti-TCRβV-binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises an amino acid sequence selected from any one of: GFTFSIFG (SEQ ID NO: 1188), GFTFSRTG (SEQ ID NO: 1189), GFTFSIKG (SEQ ID NO: 1190), GFTFSNKG (SEQ ID NO: 1191), GFTFSRFG (SEQ ID NO: 1192), GFTFSRKG (SEQ ID NO: 1193), GFTFSITG (SEQ ID NO: 1194), GFIFSIYG (SEQ ID NO: 1195), and GFTFSNTG (SEQ ID NO: 1196);an IMGT HCDR2 that comprises an amino acid sequence selected from any one of: ISSGSSTI (SEQ ID NO: 1197), ISSTSSTI (SEQ ID NO: 1198), ISSSSSTI (SEQ ID NO: 1199), and ISSWSSTI (SEQ ID NO: 1200);an IMGT HCDR3 that comprises an amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201) or ARRGAGAMDY (SEQ ID NO: 1202);an IMGT LCDR1 that comprises an amino acid sequence selected from any one of: SSVNY (SEQ ID NO: 1182), RS VNY (SEQ ID NO: 1184), and KSVNY (SEQ ID NO: 1185);an IMGT LCDR2 that comprises an amino acid sequence of YTS;an IMGT LCDR3 that comprises an amino acid sequence selected from any one of: QQFTSSPFT (SEQ ID NO: 1157) and QQFTSSPFV (SEQ ID NO: 1159);wherein each of the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 independently comprise 0, 1, 2, or 3 amino acid mutations.

31. The polypeptide molecule of claim 30, wherein the binding domain comprises:(i) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1198, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(ii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1198, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1159, respectively;(iii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1189, 1199, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(iv) the IMGT IICDR1, the HCDR2, and the HCD 3 comprising the amino acid sequences of SEQ ID NOs: 1190, 1197, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(v) the IMGT I ICDR1, the IICDR2, and the IICDR3 comprising the amino acid sequences of SEQ ID NOs: 1191, 1199, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1185, YTS, and 1157, respectively;(vi) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1186, 1200, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1159, respectively;(vii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1200, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1157, respectively;(viii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1192, 1200, and 1201, respectively, and the IMGT LCDR1, theLCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(ix) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1193, 1198, and 1201, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(x) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1200, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1159, respectively;(xi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1199, and 1202, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1182, YTS, and 1159, respectively;(xii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1191, 1199, and 1202, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1157, respectively;(xiii) the IMGT HCDRl, the IICDR2, and the IICDR3 comprising the amino acid sequences of SEQ ID NOs: 1192, 1198, and 1201, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1157, respectively;(xiv) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1194, 1198, and 1202, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xv) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1193, 1197, and 1202, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1157, respectively;(xvi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1194, 1200, and 1202, respectively, and the IMGT LCDRl, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1157, respectively;(xvii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1190, 1199, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xviii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1193, 1200, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1157, respectively;(xix) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1188, 1198, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1184, YTS, and 1157, respectively;(xx) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1195, 1198, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1182, YTS, and 1157, respectively;(xxi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1189, 1197, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xxii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1196, 1198, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1157, respectively;(xxiii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1191, 1197, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1157, respectively;(xxiv) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1194, 1198, and 1202, respectively, and the IMGT LCDRI, theLCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxv) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1192, 1198, and 1201, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxvi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1194, 1199, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xxvii) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1189, 1200, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1182, YTS, and 1159, respectively;(xxviii) the IMGT HCDRl, the IICDR2, and the IICDR3 comprising the amino acid sequences of SEQ ID NOs: 1193, 1200, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xxix) the IMGT HCDRl, the HCDR2, and the IICDR3 comprising the ammo acid sequences of SEQ ID NOs: 1186, 1200, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xxx) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1196, 1198, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxxi) the IMGT HCDRl, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1196, 1199, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxxii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1189, 1200, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxxiii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1191, 1200, and 1202, respectively, and the IMGT LCDR1, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1182, YTS, and 1157, respectively;(xxxiv) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1191, 1197, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively;(xxxv) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1189, 1199, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1185, YTS, and 1159, respectively;(xxxvi) the IMGT HCDR1, the HCDR2, and the IICDR3 comprising the amino acid sequences of SEQ ID NOs: 1196, 1199, and 1202, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the ammo acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively; or(xxxvii) the IMGT HCDR1, the HCDR2, and the HCDR3 comprising the amino acid sequences of SEQ ID NOs: 1194, 1199, and 1201, respectively, and the IMGT LCDRI, the LCDR2, and the LCDR3 comprising the amino acid sequences of SEQ ID NOs: 1184, YTS, and 1159, respectively.

32. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202);an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFT (SEQ ID NO: 1157).

33. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202);an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

34. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT FICDR2 that comprises the amino acid sequence of ISSTSSTI (SEQ ID NO: 1198); an IMGT FICDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201);an IMGT LCDR1 that comprises the amino acid sequence of RS VNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

35. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202);an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

36. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSRTG (SEQ ID NO: 1189); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201);an IMGT LCDR1 that comprises the amino acid sequence of KSVNY (SEQ ID NO: 1185); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

37. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSNTG (SEQ ID NO: 1196); an IMGT FICDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT FICDR3 that comprises the amino acid sequence of ARRGAGAMDY (SEQ ID NO: 1202);an IMGT LCDR1 that comprises the amino acid sequence of RS VNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the ammo acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

38. A polypeptide molecule comprising an anti-TCRpV binding domain, wherein the binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GFTFSITG (SEQ ID NO: 1194); an IMGT HCDR2 that comprises the amino acid sequence of ISSSSSTI (SEQ ID NO: 1199); an IMGT HCDR3 that comprises the amino acid sequence of ARRGEGAMDY (SEQ ID NO: 1201);an IMGT LCDR1 that comprises the amino acid sequence of RSVNY (SEQ ID NO: 1184); an IMGT LCDR2 that comprises the amino acid sequence of YTS; and an IMGT LCDR3 that comprises the amino acid sequence of QQFTSSPFV (SEQ ID NO: 1159).

39. A polypeptide molecule comprising an anti-T cell receptor beta variable chain (TCRPV) binding domain comprising:(i) a variable heavy chain (VH) region comprising an HCDR1, an HCDR2, and an HCDR3, wherein the VH region comprises an amino acid sequence of any one of SEQ ID NOs: 100-111, 2512, and 2513; and(li) a variable light chain (VL) region comprising an LCDR1, an LCDR2, and an LCDR3, wherein the VL region comprises an ammo acid sequence of any one of SEQ ID NOs: 85-93 and 2514;wherein the HCDR1-3 and LCDR1-3 sequences are each determined according to the Kabat numbering scheme, the Chothia numbering scheme, or the ImMunoGeneTics Information System (IMGT).

40. The polypeptide molecule of any one of claims 1-38, wherein the polypeptide molecule comprises a VH region and / or a VL region.

41. The polypeptide molecule of claim 40, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 100- 111, 2512, and 2513.

42. The polypeptide molecule of claim 40 or 41, wherein the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 85-93 and 2514.

43. The polypeptide molecule of any one of claims 40-42, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 100-111, 2512, and 2513; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 85-93 and 2514.

44. The polypeptide molecule of claim 43, wherein the VH region has a C44 mutation and the VL region has a Cl 00 utation,45. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 100; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 85.

46. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 101; and the VL region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 86.

47. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 102; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 87.

48. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 85; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 101.

49. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 103; and the VL region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 85.

50. The polypeptide molecule of any one of claims 40-44, wherein the VI I region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 104; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 88.

51. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 105; and the VL region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 89.

52. The polypeptide molecule of any one of claims 40-44, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at leastabout 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 101; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 91.

53. A polypeptide molecule comprising an anti-TCRpV binding domain comprising:(i) a VH region comprising an HCDR1, an HCDR2, and an HCDR3, wherein the VH region comprises an amino acid sequence of any one of SEQ ID NOs: 1116-1147; and(li) a VL region comprising an LCDR1, an LCDR2, and an LCDR3, wherein the VL region comprises an amino acid sequence of any one of SEQ ID NOs: 1104-1112;wherein the HCDR1-3 and LCDR1-3 sequences are each determined according to the Kabat numbering scheme, the Chothia numbering scheme, or the ImMunoGeneTics Information System (IMGT)54. The polypeptide molecule of claim 40, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1116-1147.

55. The polypeptide molecule of claim 40 or 54, wherein the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1104-1112.

56. The polypeptide molecule of claim 54 or 55, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1116-1147; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1104-1112.

57. The polypeptide molecule of claim 56, wherein the VH region has a C44 mutation and the VL region has a Cl 00 mutation.

58. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1135; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1108.

59. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1137; and the VL region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1110.

60. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1141; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1104.

61. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1142; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1104.

62. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1117; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1106.

63. The polypeptide molecule of any one of claims 54-57, wherein the VH region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1146; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1104.

64. The polypeptide molecule of any one of claims 54-57, wherein the VI I region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1147; and the VL region comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1110.

65. The polypeptide molecule of any one of claims 1-64, wherein the TCRβV-binding domain is a single chain variable fragment (scFv), Fab, CrossFab, Fab’, or F(ab’)2.

66. The polypeptide molecule of any one of claims 1-65, wherein the TCRβV-binding domain is an scFv comprising a VH region and a VL region.

67. The polypeptide molecule of claim 66, wherein the C-terminus of the VH region is linked to the N-terminus of the VL region.

68. The polypeptide molecule of claim 66, wherein the C -terminus of the VL region is linked to the N-terminus of the VH region.

69. The polypeptide of any one of claims 66-68, wherein the VH region and VL region are linked by a peptide linker.

70. The polypeptide molecule of claim 69, wherein the peptide linker comprises the formula of (Gly4Ser)n, wherein n= 1-5 (SEQ ID NO: 1424).

71. The polypeptide molecule of claim 69, wherein the peptide linker is (Gly4Ser)3 (SEQ ID NO: 1342).

72. The polypeptide molecule of claim 69, wherein the peptide linker is (Gly4Ser) (SEQ ID NO: 1425).

73. The polypeptide of any one of claims 66-72, wherein the VH region and the VL region are linked by one or more engineered disulfide bond(s).

74. The binding molecule of claim 73, wherein one cysteine that forms the engineered disulfide bond is located in the VH region, and wherein the other cysteine that forms the engineered disulfide bond is located in the VL region.

75. The binding molecule of claim 73 or 74, wherein the positions of the one or more engineered disulfide bond(s) are selected from the group consisting of: VH44-VL100, VH100B-VL49, VH100-VL50, VH101-VL46, and VH105-VL43, according to EU numbering.

76. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 149-222.

77. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 205.

78. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 206.

79. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 207.

80. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 208.

81. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 209.

82. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 210.

83. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 211.

84. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 212.

85. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1203-1277.

86. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1262.

87. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1264.

88. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1270.

89. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1271.

90. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1275.

91. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1276.

92. The polypeptide molecule of claim 66, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1277.

93. The polypeptide molecule of any one of claims 1-65, wherein the TCRβV-binding domain is a Fab comprising the VH region, the VL region, a first heavy chain constant region (CHI), and a light chain constant region (CL), wherein the C-terminus of the VH region is connected to the N-terminus of the CHI region, and the C-terminus of the VL region is connected to the N-terminus of the CL region.

94. The polypeptide molecule of any one of claims 1-65, wherein the TCRβV-binding domain is a CrossFab comprising the VH region, the VL region, a first heavy chain constant region (CHI), and a light chain constant region (CL), wherein the C-terminus of the VH region is connected to the N-terminus of the CL region, and the C-terminus of the VL region is connected to the N- terminus of the CHI region.

95. The polypeptide molecule of claim 93 or 94, wherein the CHI region and the CL region are connected by a disulfide bond.

96. The polypeptide molecule of any one of claims 93-95, wherein TCRβV-binding domain is a charge steering Fab or charge steering CrossFab.

97. The polypeptide molecule of claim 96, wherein the CH I region of the charge steering Fab or charge steering CrossFab comprises mutations K147E and / or K213E according to EU numbering, and the CL region of the charge steering Fab or charge steering CrossFab comprises mutations El 23R and / or QI 24K according to EU numbering.

98. The polypeptide molecule of any one of claims 93-97, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 230-574; and (li) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 575-1084.

99. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236; and (li) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 582.

100. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 237; and (ii) a heavy chain sequence that is at least about 80%, at leastabout 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583.

101. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 238; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 584.

102. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583.

103. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 236; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 585.

104. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 239; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 586.

105. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 240; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 587.

106. The polypeptide molecule of claim 98, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 241; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 583.

107. The polypeptide molecule of any one of claims 93-97, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1280-1292; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1293-1328.

108. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1288; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1315.

109. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1290; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1317.

110. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1284; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1322,111. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1284; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1323.

112. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1286; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1297.

113. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1284; and (ii) a heavy chain sequence that is at least about 80%, at leastabout 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1327.

114. The polypeptide molecule of claim 107, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1290; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1328.

115. A polypeptide molecule comprising a first binding domain and a second binding domain, wherein the first binding domain comprises the TCRβV-binding domain of any one of claims 1-114.

116. The polypeptide molecule of claim 115, wherein the second binding domain specifically binds to a protein expressed on a B cell.

117. The polypeptide molecule of claim 115, wherein the second binding domain specifically binds to a protein expressed on a tumor cell.

118. The polypeptide molecule of claim 117, wherein the protein expressed on the tumor cell is a tumor-associated antigen (TAA).

119. The polypeptide molecule of any one of claims 115-118, wherein the second binding domain is a TAA-binding domain.

120. The polypeptide molecule of claim 119, wherein the TAA-binding domain comprises a CD19-binding domain.

121. The polypeptide molecule of claim 120, wherein the CD19-binding domain comprises:a Kabat HCDR1 that comprises the amino acid sequence of SYVMH (SEQ ID NO: 1353); a Kabat HCDR2 that comprises the amino acid sequence of YINPYNDGTKYNEKFQG (SEQ ID NO: 1355); a Kabat HCDR3 that comprises the amino acid sequence of GTYYYGTRVFDY (SEQ ID NO: 1357);a Kabat LCDR1 that comprises the amino acid sequence of RSSKSLQNA^NGNTYLY (SEQ ID NO: 1347); a Kabat LCDR2 that comprises the amino acid sequence of RMSNLNS (SEQ ID NO: 1349); and a Kabat LCDR3 that comprises the amino acid sequence of MQHLEYPIT (SEQ ID NO: 1 51).

122. The polypeptide molecule of claim 120, wherein the CD19-binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GYTFTSYV (SEQ ID NO: 1361); an IMGT HCDR2 that comprises the amino acid sequence of INPYNDGT (SEQ ID NO: 1363); an IMGT HCDR3 that comprises the amino acid sequence of AR GTYYYGTRVFDY (SEQ ID NO: 1365);an IMGT LCDR1 that comprises the amino acid sequence of KSLQNVNGNTY(SEQ ID NO: 1359); an IMGT LCDR2 that comprises the ammo acid sequence of RMS; and an IMGT LCDR3 that comprises the amino acid sequence of MQHLEYPIT (SEQ ID NO: 1351).

123. The polypeptide molecule of claim 120, wherein the CD19-binding domain comprises:a Kabat HCDR1 that comprises the amino acid sequence of TSTMGVG (SEQ ID NO: 1354); a Kabat HCDR2 that comprises the amino acid sequence of FIWWDDDKRYNPNLKS (SEQ ID NO: 1356); a Kabat HCDR3 that comprises the ammo acid sequence of MELWSYYFDP (SEQ ID NO: 1358);a Kabat LCDR1 that comprises the amino acid sequence of SASSSVGYMH (SEQ ID NO: 1348); a Kabat LCDR2 that comprises the amino acid sequence of DTSKLAF (SEQ ID NO: 1350); and a Kabat LCDR3 that comprises the amino acid sequence of FQGSVYPFT (SEQ ID NO: 1352).

124. The polypeptide molecule of claim 120, wherein the CD19-binding domain comprises:an IMGT HCDR1 that comprises the amino acid sequence of GGSISTSTMG (SEQ ID NO: 1362); an IMGT HCDR2 that comprises the ammo acid sequence of IWWDDDK (SEQ IDNO: 1364); an IMGT HCDR3 that comprises the amino acid sequence of ARMELWSYYFDP (SEQ ID NO: 1366);an IMGT LCDR1 that comprises the amino acid sequence of SSVGY (SEQ ID NO: 1360); an IMGT LCDR2 that comprises the amino acid sequence of DTS; and an IMGT LCDR3 that comprises the amino acid sequence of FQGSVYPFT (SEQ ID NO: 1352).

125. The polypeptide molecule of any one of claims 119-124, wherein the TAA-binding domain comprises an immunoglobulin heavy chain variable (VH) region and / or an immunoglobulin light chain variable (VI..) region.

126. The polypeptide molecule of claim 125, wherein the VH region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1345; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1343.

127. The polypeptide molecule of claim 125, wherein the VI I region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1346; and the VL region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1344.

128. The polypeptide molecule of any one of claims 119 to 127, wherein the TAA-binding domain is a single chain variable fragment (scFv), Fab, CrossFab, Fab’, or F(ab’)?..

129. The polypeptide molecule of claim 128, wherein the TAA-binding domain is an scFv comprising a VH region and a VL region.

130. The polypeptide molecule of claim 129, wherein the C -terminus of the VH region is linked to the N-terminus of the VL region.

131. The polypeptide molecule of claim 129, wherein the C-terminus of the VL region is linked to the N-terminus of the VH region.

132. The polypeptide molecule of claim 131, wherein the VH region and VL region are linked by a peptide linker.

133. The polypeptide molecule of claim 132, wherein the peptide linker comprises the formula of (Gly4Ser)n, wherein n = 1-5 (SEQ ID NO: 1424).

134. The polypeptide molecule of claim 1 2, wherein the peptide linker is (Gly4Ser)s (SEQ ID NO: 1342).

135. The polypeptide molecule of claim 132, wherein the peptide linker is (Gly4Ser) (SEQ ID NO: 1425).

136. The polypeptide of any one of claims 129-135, wherein the VH region and the VL region are linked by one or more engineered disulfide bond(s).

137. The binding molecule of claim 136, wherein one cysteine that forms the engineered disulfide bond is located in the VH region, and wherein the other cysteine that forms the engineered disulfide bond is located in the VL region.

138. The binding molecule of claim 136 or 137, wherein the positions of the one or more engineered disulfide bond(s) are selected from the group consisting of: VH44-VL100, VH100B-VL49, VH100-VL50, VH101-VL46, and VH105-VL43, according to EU numbering.

139. The polypeptide molecule of claim 129, wherein the scFv comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, atleast about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1367.

140. The polypeptide molecule of claim 129, wherein the scFv comprises an amino acid sequence of SEQ ID NO: 1367.

141. The polypeptide molecule of claim 128, wherein the TAA-binding domain is a Fab comprising the VH region, the VL region, a first heavy chain constant region (CHI), and a light chain constant region (CL), wherein the C-terminus of the VH region is connected to the N-terminus of the CHI region, and the C-terminus of the VL region is connected to the N-terminus of the CL region.

142. The polypeptide molecule of claim 128, wherein the TAA-binding domain is a CrossFab comprising the VH region, the VL region, a first heavy chain constant region (CHI), and a light chain constant region (CL), wherein the C -terminus of the VH region is connected to the N-terminus of the CL region, and the C-terminus of the VL region is connected to the N-terminus of the CHI region.

143. The polypeptide molecule of claim 141 or 142, wherein the CHI region and the CL region are connected by a disulfide bond.

144. The polypeptide molecule of any one of claims 141-143, wherein the TAA-binding domain is a charge steering Fab or charge steering CrossFab.

145. The polypeptide molecule of claim 144, wherein the CHI region of the charge steering Fab or charge steering CrossFab comprises mutations K147E and / or K213E according to EU numbering, and the CL region of the charge steering Fab or charge steering CrossFab comprises mutations E123R and / or Q124K according to EU numbering.

146. The polypeptide molecule of any one of claims 141-145, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1369; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1371.

147. The polypeptide molecule of any one of claims 141-145, wherein the Fab or CrossFab comprises (i) a light chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1368; and (ii) a heavy chain sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1370.

148. The polypeptide molecule of any one of claims 115-147, wherein the first binding domain is an scFv, and wherein the second binding domain is a Fab, a CrossFab, a charge steering Fab, or a charge steering CrossFab.

149. The polypeptide molecule of any one of claims 115-147, wherein the first binding domain is a Fab, a CrossFab, a charge steering Fab, or a charge steering CrossFab, and wherein the second binding domain is an scFv.

150. The polypeptide molecule of any one of claims 115-149, wherein the first binding domain and the second binding domain are linked by a peptide linker.

151. The polypeptide molecule of claim 150, wherein the peptide linker comprises the formula of (Gly4Ser)n, wherein n = 1-5.

152. The polypeptide molecule of claim 150, wherein the peptide linker is (Gly4Ser)3.

153. The polypeptide molecule of claim 150, wherein the peptide linker is (Gly4Ser)1.

154. The polypeptide molecule of any one of claims 115-153, wherein the polypeptide molecule further comprises a half-life extension moiety.

155. The polypeptide molecule of claim 154, wherein the half-life extension moiety is selected from the group consisting of: a fragment crystallizable (Fc) region, albumin, transferrin, a binding domain that specifically binds to transferrin or albumin, an unstructured biodegradable proteins (XTEN), a polyethylene glycol (PEG), a glycine-rich homo-amino-acid polymer (HAP), a hydroxyethyl starch (HES), a polysialic acid (PSA), an immunoglobulin binding polypeptide, and a conformational ly disordered polypeptide comprising Proline, Alanine and Serine (PAS), or is a derivative or functional fragment thereof.

156. The polypeptide molecule of claim 154 or 155, wherein the half-life extension moiety comprises an amino acid sequence with at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 2510.

157. The polypeptide molecule of claim 154 or 155, wherein the half-life extension moiety comprises an ammo acid sequence with at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 2511.

158. The polypeptide molecule of any one of claims 154-157, wherein the half-life extension moiety is connected to the polypeptide molecule by a linker.

159. The polypeptide molecule of claim 158, wherein the linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1342, 1424, 1425, 2339, 2340, 2341, and 2515-2523.

160. The polypeptide molecule of any one of claims 115-159, wherein the polypeptide molecule further comprises an Fc region.

161. The polypeptide molecule of claim 160, wherein the Fc region comprises two polypeptides.

162. The polypeptide molecule of claim 161, wherein the first binding domain is connected to one of the polypeptides of the Fc region via a peptide linker and the second binding domain is connected to the other polypeptide of the Fc region via a peptide linker.

163. The polypeptide molecule of claim 161, wherein the first binding domain and the second binding domain are connected to the same polypeptide of the Fc region via a peptide linker.

164. The polypeptide molecule of claim 162 or 163, wherein the peptide linker comprises an amino acid sequence having the formula of (Gly4Ser)n, wherein n = 1-5,165. The polypeptide molecule of claim 162 or 163, wherein the peptide linker comprises an amino acid sequence amino acid sequence of KTHTCP (SEQ ID NO: 2515).

166. The polypeptide molecule of claim 162 or 163, wherein the peptide linker comprises an amino acid sequence amino acid sequence of DKTHTCP (SEQ ID NO: 2517).

167. The polypeptide molecule of any one of claims 161-166, wherein the Fc region has a knobs-into-holes format, wherein the first polypeptide of the Fc region comprises one or more hole mutations, and wherein second polypeptide of the Fc region comprises one or more knob mutations.

168. The polypeptide molecule of claim 167, wherein the first polypeptide of the Fc region comprises mutations T366S, L368A and Y407V according to EU numbering, and wherein the second polypeptide of the Fc region comprises a mutation T366W according to EU numbering.

169. The polypeptide molecule of claim 167 or 168, wherein the first polypeptide of the Fc region comprising the one or more hole mutations further comprises a mutation Y349C according to EU numbering, wherein the second polypeptide of the Fc region comprising the one or moreknob mutations further comprises a mutation S354C according to EU numbering, and wherein the Fc region comprises an engineered disulfide bond formed between these two cysteines.

170. The polypeptide molecule of any one of claims 161-169, wherein one or both of the polypeptides of the Fc region comprise mutations L234A, L235A, and P329G according to EU numbering.

171. The polypeptide molecule of any one of claims 161-170, wherein one or both of the polypeptides of the Fc region comprise the mutation N297G according to EU numbering.

172. The polypeptide molecule of any one of claims 161-171, wherein one or both of the polypeptides of the Fc region comprise mutations H435R and Y436F according to EU numbering.

173. The polypeptide molecule of any one of claims 161-172, wherein the Fc region lacks one or more effector functions and / or lacks glycosylation.

174. The polypeptide molecule of claim 173, wherein the effector function is selected from the group consisting of antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), and binding to a Fey receptor (FcyR), or is any combination thereof.

175. The polypeptide molecule of any one of claims 161-174, wherein the Fc region lacks glycine-lysine (GK) residues at the C terminus.

176. The polypeptide molecule of any one of claims 161-175, wherein the first polypeptide of the Fc region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, and wherein the second polypeptide of the Fc region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1414.

177. The polypeptide molecule of any one of claims 161-175, wherein the first polypeptide of the Fc region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1413, and wherein the second polypeptide of the Fc region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1415.

178. The polypeptide molecule of any one of claims 115-177, wherein the polypeptide molecule comprises three polypeptides.

179. The polypeptide molecule of claim 178, wherein the first polypeptide comprises: (i) a peptide linker; and (ii) an Fc heavy chain comprising a hole mutation; the second polypeptide comprises: (i) an anti-TCRpV scFv; (ii) a peptide linker; and (lii) an anti-CD19 Fab light chain; and the third polypeptide comprises: (i) an anti-CD19 Fab heavy chain; (ii) a peptide linker; and (lii) an Fc heavy chain comprising a knob mutation.

180. The polypeptide molecule of claim 178, wherein the first polypeptide comprises: (i) a peptide linker; and (ii) an Fc heavy chain comprising a hole mutation; the second polypeptide comprises: (i) an anti-CD19 Fab light chain; and the third polypeptide comprises: (i) an anti-TCRβV scFv; (ii) a peptide linker; (lii) an anti-CD19 Fab heavy chain; (iv) a peptide linker; and (v) an Fc heavy chain comprising a knob mutation.

181. The polypeptide molecule of claim 178, wherein the first polypeptide comprises: (i) a peptide linker; and (ii) an Fc heavy chain comprising a hole mutation; the second polypeptide comprises: (i) an anti-CD19 Fab heavy chain; (ii) a peptide linker; and (iii) an Fc heavy chain comprising a knob mutation; and the third polypeptide comprises: (i) an anti-TCRpV scFv; (ii) a peptide linker; and (iii) an anti-CD19 Fab light chain.

182. The polypeptide molecule of claim 178, wherein the first polypeptide comprises: (i) a peptide linker; and (li) an Fc heavy chain comprising a hole mutation; the second polypeptide comprises: (i) an anti-TCRpV scFv; (ii) a peptide linker; (iii) an anti-CD19 Fab heavy chain; (iv) a peptide linker; and (v) an Fc heavy chain comprising a knob mutation; and the third polypeptide comprises an anti-CD19 Fab light chain.

183. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1416, and the third polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1417.

184. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1369, and the third polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1418.

185. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at leastabout 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1419, and the third polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1417.

186. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1420, and the third polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1417.

187. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1369, and the third polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1421.

188. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1369, andthe third polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1422.

189. The polypeptide molecule of claim 178, wherein the first polypeptide comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1412, the second polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1369, and the third polypeptide comprises an ammo acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to SEQ ID NO: 1423.

190. A recombinant nucleic acid molecule encoding the polypeptide molecule of any one of claims 1-189.

191. A vector comprising the recombinant nucleic acid molecule of claim 190.

192. A composition comprising the polypeptide molecule of any one of claims 1-189, the recombinant nucleic acid molecule of claim 190, or the vector of claim 191.

193. A pharmaceutical composition comprising (i) the polypeptide molecule of any one of claims 1-189, the recombinant nucleic acid molecule of claim 190, or the vector of claim 191, and (li) a pharmaceutically acceptable carrier, diluent, or excipient.

194. A method of producing a polypeptide, comprising introducing the recombinant nucleic acid molecule of claim 190, or the vector of claim 191, into a host cell under conditions that express the polypeptide molecule in the cell, wherein the method is ex vivo.

195. A method of expanding a T cell population, wherein the method comprises contacting the T cell population with the polypeptide molecule of any one of claims 1 to 189, or the pharmaceutical composition of claim 193, wherein the T cell population expresses a TCRPV antigen on the cell surface, and wherein the polypeptide molecule specifically binds to the TCRPV antigen.

196. The method of claim 195, wherein the method expands T cells in vitro or ex vivo.

197. The method of claim 195, wherein the method expands T cells in vivo in a subject,198. The method of any one of claims 195-197, wherein the population of T cells comprises a plurality of effector T cells and / or memory T cells.

199. The method of claim 198, wherein the effector T cells are selected from the group consisting of effector memory T cells (TEM), T effector cells (TEFF), and T effector cells re¬ expressing CD45 A (TEMRA), or are a combination thereof.

200. The method of claim 198 or 199, wherein the memory T cells are selected from the group consisting of central memory T cells (TCM) and T memory stem cells (TSCM), or are a combination thereof.

201. The method of any one of claims 195-200, wherein the population of T cells has an increased expansion of the effector T cells and / or memory T cells than that produced by a polypeptide molecule comprising a CD3 -binding domain.

202. The method of any one of claims 195-201, wherein the population of T cells has an increased percentage of effector T cells and / or memory T cells than that produced by a polypeptide molecule comprising a CD3-binding domain.

203. The method of claim 201 or 202, wherein the effector T cells are effector memory T cells (TEM).

204. The method of claim 201 or 202, wherein the memory T cells are central memory T cells (TCM).

205. The method of any one of claims 195-204, wherein the expanded T cell population has an increased and / or prolonged cytotoxicity than that of a polypeptide molecule comprising a CD3- binding domain.

206. A method of depleting target cells in a subject, comprising administering to the subject an effective amount of the polypeptide molecule of any one of claims 1-189, or the pharmaceutical composition of claim 193, wherein the target cells are tumor cells,207. A method of depleting target cells in a subject, comprising administering to the subject an effective amount of the polypeptide molecule of any one of claims 1-189, or the pharmaceutical composition of claim 193, wherein the target cells are B cells.

208. The method of claim 206 or 207, wherein the method decreases the number of target cells by at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, at least about 99.8%, at least about 99.9%, or 100% in the subject.

209. A method of treating a disease, disorder, or condition in a subject in need thereof, comprising administering to the subject an effective amount of the polypeptide molecule of any one of claims 1-189, or the pharmaceutical composition of claim 193.

210. The method of claim 209, wherein the disease, disorder, or condition is a cancer.

211. The method of claim 210, wherein the cancer is a blood cancer.

212. The method of claim 211, wherein the blood cancer is chronic lymphocytic leukemia or non-Hodgkin lymphoma.

213. The method of claim 210, wherein the cancer is a solid tumor.

214. The method of claim 209, wherein the disease, disorder, or condition is an autoimmune disease.

215. The method of claim 214, wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus, or myasthenia gravis.

216. The method of any one of claims 209-215, wherein the subject has previously been treated with a polypeptide molecule comprising a CD3-binding domain,217. The method of any one of claims 209-215, wherein the subject is relapsing or refractory to a treatment comprising a polypeptide molecule comprising a CD3-binding domain.

Images