Anti-latent transforming growth factor b binding protein 4 (LTBP4) antibodies and uses thereof
Patent Information
- Application Number
- PCT/US2026/016997
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2025-02-27
- Filing Date
- 2026-02-27
- Publication Date
- 2026-09-03
Smart Images

Figure US2026016997_03092026_PF_FP_ABST
Abstract
Description
ANTI-LATENT TRANSFORMING GROWTH FACTOR B BINDING PROTEIN 4 (LTBP4) ANTIBODIES AND USES THEREOFRELATED APPLICATIONS
[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application, U.S.S.N. 63 / 764,259, filed February 27, 2025, the entire contents of which are incorporated herein by reference.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING
[0002] The contents of the electronic sequence listing (N049170042WO00-SEQ-KGC.xml; Size: 324,664 bytes; and Date of Creation: February 17, 2026) are herein incorporated by reference in their entirety.BACKGROUND
[0003] Overactivity of transforming growth factor p (TGF-P) is implicated in several fibrosis pathways associated with various diseases such as Duchenne muscular dystrophy (DMD), fibrosis, etc. Many approaches to modulating TGF-3 activity directly target free TGF- , its soluble receptor ligands, and associated intracellular signaling pathways.However, due in part to the broad tissue distribution of TGF-P and its ligands, receptors, and intracellular signaling pathways, these approaches to targeting TGF-P are associated with unacceptable side effects. Accordingly, alternative means of targeting TGF-P activity in a local manner are highly desirable.FEDERALLY SPONSORED RESEARCH
[0004] This invention was made with government support under Grant Number NS127383, awarded by the National Institutes of Health. The government has certain rights in this invention.SUMMARY
[0005] Aspects of the disclosure provide anti-latent TGF-P-binding protein 4 (LTBP4) antibodies for targeting LTBP4, and methods of use thereof. Provided herein, in some aspects, is an antibody that specifically binds to latent transforming growth factor p (TGF-P) binding protein 4.
[0006] In some embodiments, the antibody comprises a heavy chain (HC) complementarity determining region (CDR) 1 (HC CDR1), HC CDR2, and HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7, and a light chain #14882946v3(LC) CDR 1 (LC CDR1), LC CDR2, and LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 8.
[0007] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 15, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 16.
[0008] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 23, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 24.
[0009] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 31, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 32.
[0010] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 39, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 40.
[0011] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 47, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 48.
[0012] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 55, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 56.
[0013] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 63, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 64.
[0014] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 71, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 72.#14882946v3
[0015] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 79, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 80.
[0016] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 87, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 88.
[0017] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 95, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 96.
[0018] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 103, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 104.
[0019] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 111, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 112.
[0020] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 119, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 120.
[0021] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 127, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 128.
[0022] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 135, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 136.
[0023] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: #14882946v3143, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 144.
[0024] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 151, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 152.
[0025] In some embodiments, the antibody comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 159, and a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 160.
[0026] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR1 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 6.
[0027] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 9, a HC CDR2 having the amino acid sequence of SEQ ID NO: 10, a HC CDR3 having the amino acid sequence of SEQ ID NO: 11, a LC CDR1 having the amino acid sequence of SEQ ID NO: 12, a LC CDR1 having the amino acid sequence of SEQ ID NO: 13, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 14.
[0028] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 17, a HC CDR2 having the amino acid sequence of SEQ ID NO: 18, a HC CDR3 having the amino acid sequence of SEQ ID NO: 19, a LC CDR1 having the amino acid sequence of SEQ ID NO: 20, a LC CDR1 having the amino acid sequence of SEQ ID NO: 21, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 22.
[0029] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 25, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 27, a LC CDR1 having the amino acid sequence of SEQ ID NO: 28, a LC CDR1 having the amino acid sequence of SEQ ID NO: 29, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 30.
[0030] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 33, a HC CDR2 having the amino acid sequence of SEQ ID NO: 34, a HC CDR3 having the amino acid sequence of SEQ ID NO: 35, a LC CDR1 having the amino acid sequence of SEQ ID NO: 36, a LC CDR1 having the amino acid sequence of SEQ #14882946v3ID NO: 37, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 38.
[0031] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 41, a HC CDR2 having the amino acid sequence of SEQ ID NO: 42, a HC CDR3 having the amino acid sequence of SEQ ID NO: 43, a LC CDR1 having the amino acid sequence of SEQ ID NO: 44, a LC CDR1 having the amino acid sequence of SEQ ID NO: 45, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 46.
[0032] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, a HC CDR3 having the amino acid sequence of SEQ ID NO: 51, a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR1 having the amino acid sequence of SEQ ID NO: 53, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 54.
[0033] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 57, a HC CDR2 having the amino acid sequence of SEQ ID NO: 58, a HC CDR3 having the amino acid sequence of SEQ ID NO: 59, a LC CDR1 having the amino acid sequence of SEQ ID NO: 60, a LC CDR1 having the amino acid sequence of SEQ ID NO: 61, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 62.
[0034] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 65, a HC CDR2 having the amino acid sequence of SEQ ID NO: 66, a HC CDR3 having the amino acid sequence of SEQ ID NO: 67, a LC CDR1 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 70.
[0035] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 73, a HC CDR2 having the amino acid sequence of SEQ ID NO: 74, a HC CDR3 having the amino acid sequence of SEQ ID NO: 75, a LC CDR1 having the amino acid sequence of SEQ ID NO: 76, a LC CDR1 having the amino acid sequence of SEQ ID NO: 77, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 78.
[0036] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 81, a HC CDR2 having the amino acid sequence of SEQ ID NO: 82, a HC CDR3 having the amino acid sequence of SEQ ID NO: 83, a LC CDR1 having the amino acid sequence of SEQ ID NO: 84, a LC CDR1 having the amino acid sequence of SEQ ID NO: 85, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 86.
[0037] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 89, a HC CDR2 having the amino acid sequence of SEQ ID NO: 90, a HC CDR3 having the amino acid sequence of SEQ ID NO: 91, a LC CDR1 having the #14882946v3amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 94.
[0038] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 97, a HC CDR2 having the amino acid sequence of SEQ ID NO: 98, a HC CDR3 having the amino acid sequence of SEQ ID NO: 99, a LC CDR1 having the amino acid sequence of SEQ ID NO: 100, a LC CDR1 having the amino acid sequence of SEQ ID NO: 101, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 102.
[0039] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 105, a HC CDR2 having the amino acid sequence of SEQ ID NO: 106, a HC CDR3 having the amino acid sequence of SEQ ID NO: 107, a LC CDR1 having the amino acid sequence of SEQ ID NO: 108, a LC CDR1 having the amino acid sequence of SEQ ID NO: 109, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 110.
[0040] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 113, a HC CDR2 having the amino acid sequence of SEQ ID NO: 114, a HC CDR3 having the amino acid sequence of SEQ ID NO: 115, a LC CDR1 having the amino acid sequence of SEQ ID NO: 116, a LC CDR1 having the amino acid sequence of SEQ ID NO: 117, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 118.
[0041] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 121, a HC CDR2 having the amino acid sequence of SEQ ID NO: 122, a HC CDR3 having the amino acid sequence of SEQ ID NO: 123, a LC CDR1 having the amino acid sequence of SEQ ID NO: 124, a LC CDR1 having the amino acid sequence of SEQ ID NO: 125, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 126.
[0042] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 129, a HC CDR2 having the amino acid sequence of SEQ ID NO: 130, a HC CDR3 having the amino acid sequence of SEQ ID NO: 131, a LC CDR1 having the amino acid sequence of SEQ ID NO: 132, a LC CDR1 having the amino acid sequence of SEQ ID NO: 133, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 134.
[0043] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 137, a HC CDR2 having the amino acid sequence of SEQ ID NO: 138, a HC CDR3 having the amino acid sequence of SEQ ID NO: 139, a LC CDR1 having the amino acid sequence of SEQ ID NO: 140, a LC CDR1 having the amino acid sequence of SEQ ID NO: 141, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 142.
[0044] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 145, a HC CDR2 having the amino acid sequence of SEQ ID NO: #14882946v3146, a HC CDR3 having the amino acid sequence of SEQ ID NO: 147, a LC CDR1 having the amino acid sequence of SEQ ID NO: 148, a LC CDR1 having the amino acid sequence of SEQ ID NO: 149, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 150.
[0045] In some embodiments, the antibody comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 153, a HC CDR2 having the amino acid sequence of SEQ ID NO: 154, a HC CDR3 having the amino acid sequence of SEQ ID NO: 155, a LC CDR1 having the amino acid sequence of SEQ ID NO: 156, a LC CDR1 having the amino acid sequence of SEQ ID NO: 157, and a LC CDR1 having the amino acid sequence of SEQ ID NO: 158.
[0046] In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 15 and a VL comprising the amino acid sequence of SEQ ID NO: 16. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 23 and a VL comprising the amino acid sequence of SEQ ID NO: 24. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO: 32. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 39 and a VL comprising the amino acid sequence of SEQ ID NO: 40. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 55 and a VL comprising the amino acid sequence of SEQ ID NO: 56. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 63 and a VL comprising the amino acid sequence of SEQ ID NO: 64. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 71 and a VL comprising the amino acid sequence of SEQ ID NO: 72. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 79 and a VL comprising the amino acid sequence of SEQ ID NO: 80. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 87 and a VL comprising the amino acid sequence of SEQ ID NO: 88. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 95 and a VL comprising the amino acid sequence of SEQ ID NO: 96. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 103 and a VL comprising the amino acid sequence of SEQ ID NO: 104. In some #14882946v3embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 111 and a VL comprising the amino acid sequence of SEQ ID NO: 112. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 119 and a VL comprising the amino acid sequence of SEQ ID NO: 120. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 127 and a VL comprising the amino acid sequence of SEQ ID NO: 128. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 135 and a VL comprising the amino acid sequence of SEQ ID NO: 136. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 143 and a VL comprising the amino acid sequence of SEQ ID NO: 144. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 151 and a VL comprising the amino acid sequence of SEQ ID NO: 152. In some embodiments, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 159 and a VL comprising the amino acid sequence of SEQ ID NO: 160.
[0047] Provided herein, in some aspects, is an antibody comprising a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 of any one of the antibodies listed in Table 1.
[0048] Provided herein, in some aspects, is an antibody comprising a VH and / or VL of any one of the antibodies listed in Table 1.
[0049] In some embodiments, an antibody provided herein is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv. In some embodiments, an antibody provided herein is a full-length IgG comprising a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.
[0050] In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 161 and an LC comprising the amino acid sequence of SEQ ID NO: 162. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 163 and an LC comprising the amino acid sequence of SEQ ID NO: 164. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 165 and an LC comprising the amino acid sequence of SEQ ID NO: 166. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 167 and an LC comprising the amino acid sequence of SEQ ID NO: 168. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 169 and an LC comprising the amino acid sequence of SEQ ID NO: 170. In some embodiments, the antibody comprises an HC comprising the amino acid #14882946v3sequence of SEQ ID NO: 171 and an LC comprising the amino acid sequence of SEQ ID NO: 172. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 173 and an LC comprising the amino acid sequence of SEQ ID NO: 174. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 175 and an LC comprising the amino acid sequence of SEQ ID NO: 176. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 177 and an LC comprising the amino acid sequence of SEQ ID NO: 178. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 179 and an LC comprising the amino acid sequence of SEQ ID NO: 180. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 181 and an LC comprising the amino acid sequence of SEQ ID NO: 182. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 183 and an LC comprising the amino acid sequence of SEQ ID NO: 184. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 185 and an LC comprising the amino acid sequence of SEQ ID NO: 186. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 187 and an LC comprising the amino acid sequence of SEQ ID NO: 188. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 189 and an LC comprising the amino acid sequence of SEQ ID NO: 190. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 191 and an LC comprising the amino acid sequence of SEQ ID NO: 192. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 193 and an LC comprising the amino acid sequence of SEQ ID NO: 194. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 195 and an LC comprising the amino acid sequence of SEQ ID NO: 196. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 197 and an LC comprising the amino acid sequence of SEQ ID NO: 198. In some embodiments, the antibody comprises an HC comprising the amino acid sequence of SEQ ID NO: 199 and an LC comprising the amino acid sequence of SEQ ID NO: 200.
[0051] In some embodiments, an antibody provided herein reduces the amount of active TGF-P in a subject. In some embodiments, an antibody provided herein reduces the activity of TGF-P in a subject. In some embodiments, the TGF-P comprises TGF-pi, TGF-P2, TGF-P3, or any combination thereof.#14882946v3
[0052] In some embodiments, an antibody provided herein stabilizes the hinge region of LTBP4.
[0053] Provided herein, in some aspects, is an isolated nucleic acid encoding an antibody provided herein.
[0054] Provided herein, in some aspects, is an expression vector comprising an isolated nucleic acid encoding antibody provided herein.
[0055] Provided herein, in some aspects, is an isolated cell comprising an antibody, isolated nucleic acid, or expression vector provided herein.
[0056] Provided herein, in some aspects, is a composition comprising an antibody, isolated nucleic acid, expression vector, or isolated cell provided herein. In some embodiments, the composition further comprises a pharmaceutically acceptable carrier.
[0057] Provided herein, in some aspects, is a method of making an antibody provided herein, the method comprising culturing an isolated cell comprising an antibody, isolated nucleic acid, or expression vector provided herein under a condition allowing expression of the antibody by the isolated cell; and harvesting the antibody. In some embodiments, the method further comprises purifying the antibody.
[0058] Provided herein, in some aspects, is a method of treating a subject having muscular dystrophy, the method comprising administering to the subject an effective amount of an antibody, isolated nucleic acid, expression vector, isolated cell, and / or composition provided herein. In some embodiments, the muscular dystrophy is Duchenne muscular dystrophy. In some embodiments, the muscular dystrophy is limb-girdle muscular dystrophy.
[0059] Provided herein, in some aspects, is a method of delaying, preventing, or treating fibrosis in a subject in need thereof, the method comprising administering to the subject an effective amount of an antibody, isolated nucleic acid, expression vector, isolated cell, and / or composition provided herein. In some embodiments, the fibrosis is pulmonary fibrosis. In some embodiments, the fibrosis is skeletal muscle fibrosis. In some embodiments, the fibrosis is cardiac fibrosis.
[0060] Provided herein, in some aspects, is a method of reducing activity of transforming growth factor p (TGF-P) in a subject in need thereof, the method comprising administering to the subject an effective amount of an antibody, isolated nucleic acid, expression vector, isolated cell, and / or composition provided herein. In some embodiments, the subject has or is suspected of having a disease associated with abnormal TGF-P activity. In some embodiments, the disease associated with abnormal TGF-P activity fibrotic disease, a proliferative disease, an inflammatory disorder, an autoimmune disorder, or cataracts. In #14882946v3some embodiments, the fibrotic disease is a muscular dystrophy. In some embodiments, the muscular dystrophy is Duchenne muscular dystrophy (DMD). In some embodiments, the muscular dystrophy is Becker muscular dystrophy (BMD). In some embodiments, the muscular dystrophy is congenital muscular dystrophy. In some embodiments, the muscular dystrophy is distal muscular dystrophy. In some embodiments, the muscular dystrophy is Emery-Dreifuss muscular dystrophy. In some embodiments, the muscular dystrophy is Facioscapulohumeral muscular dystrophy. In some embodiments, the muscular dystrophy is limb-girdle muscular dystrophy. In some embodiments, the muscular is dystrophy myotonic dystrophy. In some embodiments, the muscular dystrophy is oculopharyngeal muscular dystrophy.
[0061] Provided herein, in some aspects, is a method of delaying, preventing, or treating heart disease in a subject in need thereof, the method comprising administering to the subject an effective amount of an antibody, isolated nucleic acid, expression vector, isolated cell, and / or composition provided herein. In some embodiments, the heart disease is cardiac fibrosis. In some embodiments, the heart disease is heart failure. In some embodiments, the heart failure is congestive heart failure. In some embodiments, the heart disease is cardiac myopathy. In some embodiments, the heart disease is a congenital cardiovascular defect. In some embodiments, the heart disease is associated with a muscular dystrophy. In some embodiments, the heart disease is cardiac fibrosis associated with muscular dystrophy.
[0062] Provided herein, in some aspects, is a method of stabilizing the hinge region of LTBP4 in muscle tissue, the method comprising contacting the muscle tissue with an antibody or composition provided herein. In some embodiments, the muscle tissue is skeletal muscle tissue or cardiac tissue.
[0063] In some embodiments, the contacting comprises administering the antibody or the composition to a subject in need thereof.
[0064] In some embodiments, the subject in need thereof has or is suspected of having a disease associated with abnormal TGF-P activity. In some embodiments, the disease associated with abnormal TGF-P activity is a fibrotic disease, a proliferative disease, an inflammatory disorder, an autoimmune disorder, or cataracts. In some embodiments, the fibrotic disease is a muscular dystrophy. In some embodiments, the muscular dystrophy is Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), congenital muscular dystrophy, distal muscular dystrophy, Emery-Dreifuss muscular dystrophy, Facioscapulohumeral muscular dystrophy, limb-girdle muscular dystrophy, myotonic dystrophy, or oculopharyngeal muscular dystrophy.#14882946v3
[0065] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.BRIEF DESCRIPTION OF THE DRAWINGS
[0066] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate certain embodiments, and together with the written description, serve to provide non-limiting examples of certain aspects of the compositions and methods disclosed herein.
[0067] FIG. 1 shows the proposed mechanism of action through which an anti-LTBP4 [anti-latent transforming growth factor p (TGF-P) binding protein 4 (LTBP4)] antibody modulates TGF-P activity. FIG. 1 (left) is a schematic showing activity of LTBP4 on TGF-P under normal conditions, following tissue injury and subsequent cleavage of the LTBP4 hinge by released proteases. FIG. 1 (right) shows proposed activity of LTBP4 TGF-pin the presence of an anti-LTBP4 antibody targeting the LTBP4 hinge, keeping the large complex intact, and the TGF-P sequestered and inactive.
[0068] FIGs. 2A-2C are schematics showing a fragment of LTBP4 containing the hinge region (TP2E). FIG. 2A shows a schematic of full length LTBP4 protein containing a proline rich (PRR) “hinge” domain aligned with LTBP4 TP2E, a 25 kDa fragment of LTBP4 that contains the hinge domain. The 19mer amino acid sequence used in the antibody selection process is contained within the LTBP4 hinge domain. FIG. 2B and 2C shows the Alpha Fold predicted 3-dimensional structures of full-length LTBP4 and LTBP4 TP2E fragment, showing similar free-loop structures in the hinge domain
[0069] FIG.3 shows a screening & development funnel describing the activities used to discover, develop and down select anti-LTBP4 antibody lead candidates.
[0070] FIG. 4 shows a series of immunoblot panels for 20 distinct anti-LTBP4 antibodies and one secondary antibody shown only as a negative specificity control added in five different conditions. These include 3 concentrations of recombinant human LTBP4 protein in buffer (1, 10, 30 ng of rLTBP4), lysate from dystrophic mdx mouse quadriceps (quad) muscle, and lysate from dystrophic mdx mouse heart muscle. Full length LTBP4 migrates at 160 kDa.
[0071] FIG. 5 shows an immunofluorescence panel of a subset of anti-LTBP4 antibodies from Figure 4 that bind to isolated dystrophic (mdx) muscle fibers. Immunofluorescence microscopic imaging shows that anti-LTBP4 antibodies localize “on target” in the expected#14882946v3striated and matrix- associated pattern in isolated mdx EDL muscle fibers. The use of a secondary alone antibody is shown as a negative control.
[0072] FIGs. 6A-6B shows immunofluorescence microscopic images illustrating on-target binding with Antibody #5 in FIG. 6A and Antibody #18 in FIG. 6B to isolated dystrophic mdx muscle fibers. The immunofluorescence imaging shows that both Antibody #5 and #18 localized in the expected striated pattern in isolated mdx EDL myofibers. Staining images confirm the LTBP4 binding occurred in the expected costameric pattern (double arrow) as well as matrix- associated (single arrow). Secondary alone is shown as a negative control.
[0073] FIG. 7 shows a panel of anti-LTBP4 antibodies that promote C2C12 myoblast differentiation evidenced by increased MyHC positive myotube area per field with antibody treatment compared to untreated C2C12 cells.
[0074] FIGs. 8A-8B show the effect of incubating Antibody #5 (FIG. 8A) and Antibody #18 (FIG. 8B) to C2C12 myoblasts, which enhanced muscle differentiation evidenced by increased MyHC positive myotube area per field. *p < 0.05. ***p < 0.005. n > 5.
[0075] FIGs. 9A-9B show treatment with Antibody #5 (FIG. 9A) and Antibody #18 (FIG.9B) protects isolated muscle fibers from membrane injury, modeled in this experiment by laser-induced injury. Flexor digitorum brevis (FDB) myofibers from mdx mice were isolated and pretreated (3hrs) with Antibody #5, Antibody #18, or vehicle (PBS) control and then subjected to laser-induced membrane injury in the presence of FM 4-64, a marker of membrane damage. Muscle fibers treated with anti-LTBP4 Antibody #5 and Antibody #18 both had >80% reduction in FM 4-64 fluorescence area compared to vehicle-treated control myofibers. Scale bar 5 pm. *p<0.05. ****p < 0.001. n=6-7 fibers from n=2 mdx mice.
[0076] FIGs. 10A-10B show a pharmacokinetic (PK) assessment of Antibody #5 (FIG. 10A) and Antibody #18 (FIG. 10B) after a single dose in mdx mice. Following a single ascending dose of the respective antibodies injected via intravenous (RO: retro-orbital) at 10 mg / kg and 30 mg / kg into male mdx mice, resulted in a dose dependent levels of serum levels of anti-LTBP4. In all cases Cmax occurred quickly after injection (< 2 hours) followed by a quick decline in serum antibody mean concentration. n=4-5 samples per timepoint.
[0077] FIGs. 11A-11B show in vivo tissue biodistribution of Antibody #18 radiolabeled with Zr89 using a DFO chelator. As expected, mdx muscle tissue had more Zr89 labelled Antibody #18 per mg of tissue than WT controls (FIG. 11 A) . For non-muscle organ tissues (FIG. 11B) the differences between WT and mdx are not as pronounced. n=3-6 samples per group from n=3 mice. * p < 0,05, ** p < 0.01, *** p < 0.005, **** p < 0.0001.#14882946v3
[0078] FIGs. 12A-12C show the biodistribution assessment in muscle of Antibody #18 using immunofluorescence after a single dose in mdx mice. FIG 12A is a schematic of the experimental plan. FIG. 12B shows that following a single ascending dose of Antibody #18 injected via intravenous (RO = retro-orbital) injection at 10 and 30 mg / kg into mdx mice, Antibody #18 muscle tissue levels proportionally increased 7 days after injection with 30 mg / Kg samples displaying significantly more fluorescence signal than 10 mg / Kg samples.FIG. 12C shows a representative image of Antibody #18 levels in muscle tissue for lOmg / kg (left) and 30mg / kg (right) 7 days after injection. Quantification of anti-human secondary fluorescence signal was used as a measure of human IgGl antibody #18 present within the mouse tissue. n=3 mice per dose with 3 sections quantified per mouse. **** p < 0. 0001.
[0079] FIGs. 13A-13D show Antibody #5 recognized healthy and dystrophic mdx mouse LTBP4 after cardiotoxin injury. LTBP4 migrates at ~160kDa on gel electrophoresis (arrow).FIG. 13A shows Antibody #5 recognized LTBP4 protein found in lysates generated from WT mouse muscle (tibialis anterior, TA). FIG. 13B shows Antibody #5 detected significantly increased LTBP4 post cardiotoxin-induced TA muscle injury in healthy WT control muscle by immunoblot. FIG. 13C shows Antibody #18 recognized LTBP4 protein found in lysates generated from dystrophic mdx mouse muscle (tibialis anterior, TA). FIG.13D shows Antibody #5 detected significantly increased LTBP4 post cardiotoxin-induced TA muscle injury in mdx muscle by immunoblot. Total protein is shown as a loading control. n=3 mice per group. *p<0.05. **p<0.01.
[0080] FIGs. 14A-14D show human monoclonal Antibody #18 recognized healthy and dystrophic mouse LTBP4 after cardiotoxin injury. LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). FIG. 14A shows Antibody #18 recognized LTBP4 protein found in lysates generated from WT mouse muscle (tibialis anterior, TA). FIG. 14B shows Antibody #18 detected significantly increased LTBP4 post cardiotoxin-induced TA muscle injury in healthy WT control muscle by immunoblot. FIG. 14C shows Antibody #18 recognized LTBP4 protein found in lysates generated from mdx mouse muscle (tibialis anterior, TA). FIG. 14D shows Antibody #18 detected significantly increased LTBP4 post cardiotoxin-induced TA muscle injury in mdx muscle by immunoblot. Total protein is shown as a loading control. n=3 mice per group. *p<0.05. **p<0.01.
[0081] FIGs. 15A-15E show the protective effective of anti-LTBP4 Antibody #18 on LTBP4 as modeled in this prophylactic experiment by Cardiotoxin (CTX) injury in mdx mice using histopathology and immunofluorescence. FIG. 15A is a schematic showing the dosing regimen where mdx mice were administered PBS (control) or anti-LTBP4 Antibody #18 via #14882946v3intraperitoneal (IP) administration; one loading dose at 30mg / Kg and then one dose every 4 days at lOmg / Kg. After two weeks of treatment, muscle was injured with cardiotoxin, and one additional dose of Antibody #18 at 10 mg / Kg was administered 2 days post injury.Muscle was harvested 7 days post injury. FIG. 15B shows representative hematoxylin and eosin (H&E) staining of injured muscle sections demonstrated improved histological outcomes including increased myofiber size, reduced interstitial space, and reduced cellular infiltrate with Antibody #18 administration as compared to the PBS control. (Scale Bar 100pm). Representative images from n=2 mice per treatment group from a total of 5 mice per group. FIG. 15C shows serial muscle sections were stained with anti-human 488 secondary to visualize Antibody #18 human antibody (left) in the muscle tissue. Anti-Laminin staining (right) outlined the muscle fibers. Hoecsht marked nuclei. FIG. 15D anti-LTBP4 Antibody #18 treatment significantly increased the average myofiber minimum ferret diameter compared to vehicle (PBS) treated controls. FIG. 15E shows greater tissue exposure of Antibody #18, (increased fluorescence intensity) in muscle positively correlated in vivo efficacy (increased myofiber size - minimum ferret diameter). n=5 mice n=3 sections per mouse. n> 500 fibers per mouse. ****p<0.0001. Scale bar 100pm.
[0082] FIGs. 16A-16C show prophylactic treatment with Antibody #18 stabilized full length LTBP4 in mdx muscle as compared to the PBS control group quantified by immunoblot density analysis. Dystrophic mdx mice were pretreated with PBS or anti-LTBP4 Antibody #18, one loading dose at 30mg / Kg and then one dose every 4 days at lOmg / Kg. After two weeks of treatment, muscle was injured with cardiotoxin, and one additional dose of Antibody #18 at 10 mg / Kg was administered 2 days post injury. Muscle was harvested 7 days post injury. FIG. 16A shows full length LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). Antibody #18 detected increased full length LTBP4 protein in muscle treated with Antibody #18 compared to PBS control. Total protein is shown as a loading control. FIG. 16B shows quantification of full length LTBP4 immunoblot density normalized to total loaded protein revealed a significant increase in LTBP4 with Antibody #18 treatment. FIG. 16C shows the fluorescence intensity of Antibody #18 in muscle positively correlated with the amount of full length LTBP4 present in muscle. * p < 0.05. n=5 mice per group.
[0083] FIGs. 17A-17F show Antibody #18 treatment administered after muscle injury promoted muscle regeneration after Cardiotoxin (CTX)-induced injury in dystrophic mdx mice. FIG. 17A is a schematic showing the dosing regimen where mdx mice were injured with cardiotoxin and subsequently intravenously (RO) administered Antibody #18 at 3 or #14882946v330mg / Kg. A second dose of 3 or 30mg / Kg Antibody #18 was administered intravenously 3 days post cardiotoxin injury. PBS was used as a vehicle control. Muscle was harvested 7 days post injury. FIG. 17B shows representative hematoxylin and eosin (H&E) staining of injured muscle sections demonstrated improved histological outcomes including increased myofiber size, reduced interstitial space, and reduced cellular infiltrate with 30mg / Kg Antibody #18 administration, while minimal effects were seen at 3mg / K Antibody #18. Scale Bar 100pm.FIG. 17C serial sections were stained with anti-human 488 secondary to visualize Antibody #18 human antibody (top) in the muscle tissue. Anti-Laminin staining (bottom) outlined the muscle fibers. Hoecsht marked nuclei. anti-LTBP4. FIG. 17D Antibody #18 fluorescence was significantly increased at 30 mg / Kg compared to 3 mg / Kg and PBS. FIG. 17E Antibody #18 treatment significantly increased the average myofiber minimum ferret diameter by 23% compared to 3mg / Kg Antibody #18 and vehicle (PBS) treated controls. 3mg / Kg was comparable to PBS treated control (0% change). FIG. 17F Antibody #18 fluorescence positively correlated with increased myofiber size (min. feret diameter). n=4-5 mice n=3-4 sections per mouse. n> 500 fibers per mouse. **p<0.01; ****p < 0.0001. Scale bar 100pm.
[0084] FIGs. 18A-18C show treatment with Antibody #18 stabilized full length LTBP4 in mdx muscle as compared to the PBS control group quantified by immunoblot density analysis, mdx mice were injured with cardiotoxin and subsequently intravenously (RO) administered Antibody #18 at 3 or 30mg / Kg. A second dose of 3 or 30mg / Kg Antibody #18 was administered intravenously 3 days post cardiotoxin injury. PBS was used as a vehicle control. Muscle was harvested 7 days post injury. FIG. 18A shows full length LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). Antibody #18 detected increased full length LTBP4 protein in muscle treated with 30mg / Kg Antibody #18 compared to 3mg / Kg Antibody #18 and PBS control. Total protein is shown as a loading control. FIG. 18B shows quantification of full length LTBP4 immunoblot density normalized to total loaded protein revealed a significant increase in LTBP4 with 30mg / Kg Antibody #18 treatment compared to 3mg / Kg Antibody #18 and PBS control. FIG. 18C shows the fluorescence intensity of Antibody #18 in muscle positively correlated with the amount of full length LTBP4 present in muscle. n=4-5 mice per treatment. *** p < 0.001.
[0085] FIGs. 19A-19B show therapeutic treatment with Antibody #18 stabilized full length LTBP4 in vivo in mdx muscle as compared to the PBS control group using immunofluorescence imaging analysis, mdx mice were injured with cardiotoxin and subsequently intravenously (RO) administered Antibody #18 at 30 mg / Kg. A second dose of 30mg / Kg Antibody #18 was administered intravenously 3 days post cardiotoxin injury. PBS #14882946v3was used as a vehicle control. Muscle was harvested 7 days post injury. FIG. 19A shows tissue was stained with Antibody #18. Representative images illustrate “on target” localization of stabilized LTBP4 surrounding the myofibers. FIG. 19B shows mean LTBP4 fluorescence intensity was significantly increased with Antibody #18 administration compared to PBS control, similar to the results shown by immunoblot analysis. n=15 images from n=5 mice per treatment. **** p < 0.0001. Scale Bar 100pm. Images taken at identical exposure.
[0086] FIG. 20 shows a certificate of analysis for monoclonal anti-LTBP4 Antibody #5, confirming it can be expressed and purified from Expi293 cells and behaves as a monomer with no change after freeze thaw.
[0087] FIG. 21 shows a certificate of analysis for monoclonal anti-LTBP4 Antibody #18, confirming it can be expressed and purified from Expi293 cells and behaves as a monomer.
[0088] FIG. 22 shows a certificate of analysis for monoclonal anti-LTBP4 Antibody #18, synthesized in a robust stable pool production of low endotoxin (<1 EU / ml). Antibody #18 was expressed and purified yielding ~0.6g / L of >99% pure antibody.
[0089] FIG. 23 shows immunofluorescence microscopic images illustrating on-target binding of anti-LTBP4 Antibody #4 to endogenous LTBP4 protein in dystrophic mdx muscle fibers. The immunofluorescence imaging shows that Antibody #4 detected the expected striated pattern in isolated mdx muscle fibers, indicating reaction with endogenous LTBP4 in muscle. Staining images confirm the LTBP4 binding occurred in the expected costameric pattern (double arrow) as well as matrix-associated (single arrow). Secondary alone is shown as a negative control.
[0090] FIGs. 24A-24C shows the effect of incubating anti-LTBP4 Antibody #4 (“#4”) to C2C12 myoblasts (FIG.24A). Incubation of the C2C12 cells with Antibody #4 enhanced muscle differentiation, as evidenced by increased MyHC positive myotube area per field (FIG. 24B) and increased average MyHC positive myotube size per field (FIG. 24C). **p < 0.001. ****p < 0.001. n = 2 differentiations with n=4 fields each.
[0091] FIGs. 25A-25C shows a biodistribution assessment of Antibody #4 in muscle using immunofluorescence imaging after a single dose in mdx mice. FIG. 25A is a schematic of the experimental plan. FIGs. 25B-25C show that following a single ascending dose of Antibody #4 injected via subcutaneous (SC) injection at 10 and 30 mg / kg into mdx mice, Antibody #4 muscle tissue levels proportionally increased 7 days after injection with 30 mg / Kg samples displaying significantly more fluorescence signal than 10 mg / Kg samples. Quantification of anti-human secondary fluorescence signal was used as a measure of human IgGl Antibody #14882946v3#4 present within the mouse tissue. n=3 mice per dose with > 3 sections quantified per mouse. ** p < 0. 0005.
[0092] FIGs. 26A-26B shows the results of treatment of dystrophic mdx mice with Antibody #4. Dystrophic mdx mice were treated with PBS or anti-LTBP4 Antibody #4 with one dose on day 0 and a second dose 3 days later. After 7 days of treatment, muscle was harvested. FIG. 26B shows full length LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). Muscle treated with Antibody #4 had 2.4-fold more full-length LTBP4 protein compared to PBS control, indicating that full length LTBP4 was stabilized by antibody treatment. Total protein is shown as a loading control. Treatment resulted in the stabilization of full length LTBP4 in the mdx muscle, as compared to the PBS control group quantified by immunoblot density analysis.
[0093] FIGs. 27A-27C shows the protective effects of anti-LTBP4 Antibody #4 treatment from muscle injury induced by Cardiotoxin (CTX) injury exposure. FIG. 27A is a schematic showing the dosing regimen where mdx mice were administered PBS (control), anti-LTBP4 Antibody #4 or anti-LTBP4 Antibody #18 via intramuscular (IM) administration. Muscle was simultaneously injured with 10pm cardiotoxin. Muscle was harvested 7 days post injury. FIGs. 27B-27C show that representative hematoxylin and eosin (H&E) staining of injured muscle sections demonstrated improved histological outcomes including decreased injury area with Antibody #4 and Antibody #18 administration as compared to the PBS control, n > 5 mice per condition. * p < 0. 05.
[0094] FIGs. 28A-28B shows immunoblot and immunofluorescence microscopic images illustrating on-target binding with anti-LTBP4 Antibody #18. FIG. 28A shows on-target binding of Antibody #18 to human recombinant LTBP4 protein, mouse skeletal muscle LTBP4, and mouse heart muscle LTBP4 demonstrated by the distinct band at the expected size of full length LTBP4 (160 kDa). FIG. 28B shows that Antibody #18 binds to human induced pluripotent stem cell derived-cardiomyocytes (iPSC-CM) in the expected striated pattern and to human fibroblasts demonstrated in immunofluorescence images.
[0095] FIGs. 29A-29C shows the biodistribution assessment in heart of Antibody #18 after a single dose in mdx mice, as detected by immunofluorescence microscopy. FIG. 29A is a schematic of the experimental plan. FIGs. 29B-29C show that following a single dose of Antibody #18 injected via intravenously at 30 mg / kg into mdx mice, there was accumulation of Antibody #18 in the heart. n=3 mice per dose with 3 sections quantified per mouse. **** p < 0. 0001.#14882946v3
[0096] FIGs. 30A-30C shows the biodistribution assessment in heart of Antibody #4 after a single dose in mdx mice. FIG 30A is a schematic of the experimental plan. FIGs. 30B- 30C show that following a single dose of Antibody #4 injected via subcutaneous (SC) injection at 0 mg / kg, 3 mg / kg, 10 mg / kg and 30 mg / kg into mdx mice, Antibody #4 heart tissue levels proportionally increased 7 days after injection, especially in 10 mg / kg and 30 mg / kg samples. n=3 mice per dose with n >3 sections quantified per mouse. ** p < 0.005, **** p < 0. 0001.
[0097] FIG. 31 shows treatment with Antibody #18 stabilized full length LTBP4 in mdx muscle as compared to the PBS control group quantified by immunoblot density analysis. Full length LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). Systemic administration of Antibody #18 showed a dose-dependent increase in full-length LTBP4 in the mdx heart. Antibody #18 given at 30 mg / kg increased full-length LTBP4 by 2.1-fold compared to vehicle control, while 3 mg / kg Antibody #18 administration increased full-length LTBP4 in the heart by 1.7-fold compared to vehicle control, demonstrating dose responsiveness. Total protein is shown as a loading control.
[0098] FIGs. 32A-32C show treatment with Antibody #4 stabilized full length LTBP4 in mdx heart muscle as compared to the PBS control group quantified by immunoblot density analysis. FIG. 32A shows the treatment schematic. Dystrophic mdx mice were treated with PBS or anti-LTBP4 Antibody #4, one dose on day 0, 3, and 6. After 10 days of treatment, hearts were harvested. FIGs. 32B-32C show full length recombinant human LTBP4 migrates at ~160kDa on gel electrophoresis (arrow). Hearts from mdx mice injected with Antibody #4 had 3-fold more full-length LTBP4 protein compared to PBS control. Total protein is shown as a loading control. n=6 mice per dose. ** p < 0. 005.
[0099] FIG. 33 shows a certificate of analysis for monoclonal anti-LTBP4 Antibody #4, synthesized in a robust stable pool production of low endotoxin (<5 EU / ml). Antibody #4 was expressed and purified yielding ~0.35g / L of >90% pure antibody.[000100] FIGs. 34A-34B show on target binding of anti-LTBP4 Antibody #18 to Sgcg (LGMD 2C) mouse heart and skeletal muscle. FIG. 34A shows an immunoblot for anti-LTBP4 Antibody #18 illustrating that Antibody #18 binds recombinant human LTBP4 protein, and binds the expected size protein in lysates from dystrophic Sgcg mouse heart and muscle (diaphragm and quadriceps (quad)). Full length LTBP4 migrates at 160 kDa. FIG. 34B shows a representative immunofluorescence microscopic image illustrating on-target binding of anti-LTBP4 Antibody #18 to endogenous LTBP4 protein in dystrophic Sgcg muscle tissue, indicating reaction with endogenous LTBP4 in muscle.#14882946v3DETAILED DESCRIPTION[000101] The present disclosure, at least in part, is based on the development of anti-latent transforming growth factor p (TGF-P)-binding protein 4 (LTBP4) antibodies and variants thereof, which showed high binding affinity and specificity to LTBP4. In some embodiments, an LTBP4 antibody described herein binds to the hinge domain of LTBP4. In some embodiments, binding of an anti-LTBP4 antibody described herein to the hinge domain of LTBP4 prevents its cleavage. In some embodiments, binding of an anti-LTBP4 antibody described herein to the hinge domain of LTBP4 prevents its cleavage and in turn prevents latent TGF-3 activation. Accordingly, the present disclosure provides methods and related compositions (e.g., an anti-LTBP4 antibody or a composition thereof) for treating diseases associated with overactivation of TGF-P (e.g., latent TGF-P) (e.g., muscular dystrophy, fibrosis, etc.).[000102] The TGF-P superfamily is a group of structurally and functionally related yet diverse cytokines that include endogenous growth inhibiting proteins. The most prominent members of this family, Transforming Growth Factor beta (TGF-P), include four different isoforms (TGF-P 1 -P4), which are all multifunctional cytokines produced by all white blood cell lineages. TGF-pis involved in numerous cellular processes, such as repair of both chronic and acute injury in muscle, kidney, lung, and brain. TGF-P is also a critical component of regulation of fibroblasts and myofibroblast transdifferentiation via modulation of the ECM. Under normal conditions, release and activity of TGF-P initiates a cascade of downstream signaling, with effects on numerous substrates and regulatory proteins, e.g., as shown in FIG. 1 (left).Activated TGF-P binds to the TGF-P receptors (composed of both type 1 and type 2 receptor subunits) to form a serine / threonine kinase complex. After TGF-P binding, the type 2 receptor phosphorylates and activates the type 1 receptor, which in turn activates a signaling cascade that leads to the activation of numerous downstream substrates and regulatory proteins, inducing transcription of different target genes that function in differentiation, chemotaxis, proliferation, and activation of many immune cells. TGF-P ligands have high affinity to their receptors. In most cases, an activated TGF-P ligand will initiate the TGF-P signaling cascade as long as TGF-P receptors I and II are available for binding. Thus, the TGF-P signaling employs a latency system to mediate / control its signaling.[000103] In particular, after TGF-P secretion by many cell types, including macrophages, it remains in a latent form by complexing with two other polypeptides, the latency- associated#14882946v3peptide (LAP) to form the small latent complex (SLC), which in turn is complexed with the latent TGF-beta binding protein (LTBP) to form the large latent complex (LLC). Activity of serum proteases (e.g., plasmin and elastase) on the hinge domain of LTBP4 catalyze release of active TGF-P from the LLC.[000104] Latency-associated peptide (LAP) is a protein derived from the N-terminal region of the TGF-P gene product. TGF-Ps are synthesized as precursor molecules containing a propeptide region in addition to the TGF-P homodimer. After its synthesis, the TGF-P homodimer interacts with the LAP to form the SLC. This complex remains in the cell until it is bound by LTBP to form the LLC, which is then secreted to the extracellular matrix (ECM).[000105] Latent transforming growth factor p (TGF-P)-binding proteins (LTBPs) are a family of proteins capable of binding TGF-P, and function as mediators of both TGF-P signaling and matrix homeostasis (e.g., elastogenesis). There are four different known LTBP isoforms, LTBP-1, LTBP-2, LTBP-3 and LTBP-4. LTBP4 is a member of the LTBP family that binds to latent TGF-P 1, TGF-P2, and TGF-P3, and it is expressed broadly in many tissues including the heart, aorta, lung, uterus, small intestine, skeletal muscle, and kidney. LTBP4 is anchored to extracellular matrix (ECM) fibrils through its N-terminus and binds to latent TGF-P via its C-terminus (e.g., as shown in FIG. 1A). When bound to TGF-P, LTBP4 forms an LTBP4-TGFP complex, referred to synonymously herein as a large latent complex, through which it sequesters TGF-P and thereby restricts TGF-P activation. After its secretion, TGF-P remains in the ECM as an inactivated complex containing both the LTBP and the LAP which need to be further processed in order to release active TGF-p. The attachment of TGF-P to the LTBP is by disulfide bond which allows it to remain inactive by preventing it from binding to its receptors. Because different cellular mechanisms require distinct levels of TGF-P signaling, the inactive complex of this cytokine gives opportunity for a proper mediation of TGF-P signaling.[000106] The TGF-P activation process involves the release of the LLC from the matrix, followed by further proteolysis of the LAP to release TGF-P to its receptors. Only a few TGF-P activating pathways are currently known, though the full mechanism of such activations remains poorly understood. Plasmin and a number of matrix metalloproteinases (MMP) are involved in the activation process, and play a key role in promoting tumor invasion and tissue remodeling by inducing proteolysis of several ECM components. One critical, common mechanism involves cleavage of a proline-rich “hinge” domain (as shown in FIG. 1A) in LTBP4 as part of the LAP complex. This triggers release of latent TGF-P and enables its activation, and thus may be a potential target for liberation of TGF-p. Despite the #14882946v3fact that MMPs have been shown to play a key role in activating TGF-p, mice with mutations in MMP-9 and MMP-2 genes can still activate TGF-P and do not show any TGF-P deficiency phenotypes. This may reflect redundancy among the activating enzymes, suggesting that other unknown proteases might be involved.[000107] Serum proteinases such as plasmin also catalyze the release of active TGF-P from the LLC complex. This often occurs on the cell surface, such as on the surface of macrophages, where the latent TGF-P complex is bound to CD36 via its ligand, thrombospondin- 1 (TSP-1). Inflammatory stimuli that activate macrophages enhance the release of active TGF-P by promoting the activation of plasmin. Macrophages can also endocytose IgG-bound latent TGF-P complexes that are secreted by plasma cells and then release active TGF-P into the extracellular fluid.[000108] As a key regulator of several inflammatory processes, particularly in the gut, stem cell differentiation, and T-cell regulation and differentiation, TGF-P is a key regulator in multiple disease indications including cancer, auto-immune diseases, and infectious disease. Transforming growth factor p (TGF-P) is also a central mediator of fibrogenesis (Biernacka etal., Growth Factors 29(5): 196-202, 2011). Accordingly, abnormal TGF-P activity, amount, or availability is associated with several diseases and conditions arising thereof.[000109] As a first example, TGF-P is upregulated and activated in fibrotic diseases and modulates fibroblast phenotype and function, inducing myofibroblast transdifferentiation while promoting matrix preservation. In certain disease conditions, excessive TGF-P release and activity is associated with muscular dystrophy (e.g., DMD) and muscle injury (Ceco, E,. and McNally, E.M. The FEBS Journal 280.17 (2013): 4198-4209.). Overexpression of TGFP promotes excessive deposition of ECM, inhibits ECM degradation, and promotes tissue fibrosis by exaggerating normal physiological responses to injury, as in muscular dystrophy. Indeed, TGF-P mRNA levels are elevated in human subjects with Duchenne muscular dystrophy (DMD), and inhibition of TGF-P in mouse models of DMD further suggest a role of excessive TGFP in muscle disease (Gosselin, L.E., et al. Muscle Nerve. 2004; 30:645-653; Nelson C. A., et al. Am J Pathol. 2011; 178:2611-2621.)[000110] Studies in a wide range of experimental models have demonstrated the involvement of the canonical ALK5 / Smad3 pathway in fibrosis. Smad-independent pathways may regulate Smad activation and, under certain conditions, may directly transduce fibrogenic signals. Because of its critical role in the pathogenesis of fibrosis, TGF-P has emerged as an attractive therapeutic target to treat fibrosis. However, the pleiotropic and multifunctional effects of TGF-P and its role in tissue homeostasis, immunity and cell proliferation raise #14882946v3concerns regarding potential side effects that may be caused by TGF-P blockade.[000111] Abnormalities in TGF-P activity, amount, or availability are also associated with the development of other disorders. For example, an increase in expression of TGF-P often correlates with the malignancy of many cancers and a defect in the cellular growth inhibition response to TGF-p. Its immunosuppressive functions then come to dominate, contributing to oncogenesis. The dysregulation of its immunosuppressive functions is also implicated in the pathogenesis of autoimmune diseases, although their effect is mediated by the environment of other cytokines present.[000112] Though poorly understood, numerous potential mechanisms underlying TGF-P activation pathways have been identified. For example, proteases, integrins, pH, and reactive oxygen species (ROS) are all among the few currently known factors that can activate TGF-p. Perturbations of these activating factors can lead to unregulated TGF-P signaling levels that may cause several complications including inflammation, autoimmune disorders, fibrosis, cancer and cataracts.[000113] Mutation or alteration of LAP or LTBP can result in improper TGF-P signaling. Mice lacking LTBP-3 or LTBP-4 demonstrate phenotypes consistent to phenotypes seen in mice with altered TGF-P signaling. Furthermore, specific LTBP isoforms have a propensity to associate with specific LAP*TGF-P isoforms. For example, LTBP-4 is reported to bind to TGF-pi, Myostatin and GDF-11. Thus, mutation in LTBP-4 can lead to TGF-P associated complications which are specific to tissues that predominantly involves factors such as TGF-pi. Moreover, the structural differences within the LAP’S provide different latent TGF-P complexes which are selective but to specific stimuli generated by specific activators.[000114] Despite its potential as a therapeutic target, attempts to directly modulate TGF-P activity in humans (e.g., for therapies for muscular dystrophy) have been largely unsuccessful, due at least in part to its expression in nearly all tissues and cell types. Direct modulation of TGF-P tends to have broad effects on multiple tissues and is thus associated with several undesirable side effects in patients (Huynh, L.K., et al. Biomolecules 9.11 (2019): 743.). Thus, there remains a need to identify additional therapeutic intervention for treating TGF-P-mediated fibrosis and other diseases.[000115] LTBP4, which is also increased in muscular dystrophy and which is a potent regulator of TGF-p, is thus a promising target for muscular dystrophy. Indeed, though LTBP4 was first identified as a genetic modifier of muscular dystrophy in mice (Heydemann, Ahlke, et al. The Journal of Clinical Investigation 119.12 (2009): 3703-3712.), supporting data has since identified a similar association of LTBP4 with muscular dystrophy in humans#14882946v3(Flanigan, Kevin M., et al. Annals of Neurology 73.4 (2013): 481-488.). In both mice and humans, protective alleles of LTBP4 are correlated with muscle that was less prone to injury and degeneration, as well as muscle with reduced fibrosis. For example, an in-frame insertion polymorphism in the murine Ltbp4 gene associates with partial protection against muscular dystrophy. In humans, nonsynonymous single nucleotide polymorphisms in LTBP4 associate with prolonged ambulation in Duchenne muscular dystrophy. The inventors have recognized the importance of this hinge domain in stabilizing the large latent complex, and have developed anti-LTBP4 antibodies which target the hinge domain. It is believed that binding of anti-LTBP4 antibodies to the hinge domain of LTBP4 blocks cleavage of the LTBP4 and thereby reduces release and activation of TGF-P (e.g., as shown in FIG. 1 (right)).[000116] The present disclosure, at least in part, is based on the development of anti-latent transforming growth factor p (TGF-P)-binding protein 4 (LTBP4) antibodies and variants thereof, which showed high binding affinity and specificity to LTBP4. In some embodiments, an LTBP4 antibody described herein binds to the hinge domain of LTBP4. In some embodiments, binding of an anti-LTBP4 antibody described herein to the hinge domain of LTBP4 prevents its cleavage. In some embodiments, binding of an anti-LTBP4 antibody described herein to the hinge domain of LTBP4 prevents its cleavage and in turn prevents latent TGF-P activation. Accordingly, the present disclosure provides methods and related compositions (e.g., an anti-LTBP4 antibody or a composition thereof) for treating diseases associated with overactivation of TGF-P (e.g., latent TGF-P) (e.g., muscular dystrophy, fibrosis, etc.). In related aspects, the disclosure provides compositions and methods for treating muscular dystrophies (e.g., Duchenne muscular dystrophy). Also provided are the use of the anti-LTBP4 antibodies and their variants in research, diagnostic / detection, and therapeutic applications.[000117] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.I. Definitions[000118] Administering: As used herein, the terms “administering” or “administration” means to provide an antibody or a composition thereof to a subject in a manner that is physiologically and / or pharmacologically useful (e.g., to treat a condition in the subject).[000119] Affinity Matured Antibody: “Affinity Matured Antibody” is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an#14882946v3improvement in the affinity (i.e. KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s). Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. A variety of procedures for producing affinity matured antibodies are known in the art, including the screening of a combinatory antibody library that has been prepared using bio-display. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and / or framework residues is described by Barbas et al., Proc. Nat. Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective mutagenesis positions and at contact or hypermutation positions with an activity-enhancing amino acid residue is described in U.S. Pat. No.6,914,128 Bl.[000120] Antibody: As used herein, the term “antibody” refers to a polypeptide that includes at least one immunoglobulin variable domain or at least one site, e.g., paratope, that specifically binds to an antigen. In some embodiments, an antibody is a full-length antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is an antibody fragment (i.e., an antigen-binding fragment thereof), such as a Fab fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having a human germline sequence. In another embodiment, an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgGl, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgAl, IgA2, IgD, IgM, and IgE constant domains. In some embodiments, an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and / or a light (E) chain variable region (abbreviated herein as VL). In some embodiments, an antibody comprises a constant domain, e.g., an Fc region. An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known. With respect to the heavy chain, in some embodiments, the heavy chain of an antibody described herein can be an alpha (a), delta (A), epsilon (E), gamma (y) or mu (p) heavy chain. In some embodiments, the heavy chain of an antibody described herein can#14882946v3comprise a human alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In a particular embodiment, an antibody described herein comprises a human gamma 1 CHI, CH2, and / or CH3 domain. In some embodiments, the amino acid sequence of the VH domain comprises the amino acid sequence of a human gamma (y) heavy chain constant region, such as any known in the art. Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra. In some embodiments, the VH domain comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the variable chain constant regions provided herein. In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecule are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, or a phospholipid unit. In some embodiments, an antibody is a construct that comprises a polypeptide comprising one or more antigen binding fragments of the disclosure linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Examples of linker polypeptides have been reported (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). Still further, an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides. Examples of such immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058).[000121] Approximately: As used herein, the term “approximately” or “about,” as applied to#14882946v3one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).[000122] CDR: As used herein, the term "CDR" refers to the complementarity determining region within antibody variable sequences. A typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding. The VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IMGT definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242; IMGT®, the international ImMunoGeneTics information system® http: / / www.imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); Lefranc, M.P. et al., In Silico Biol., 5, 0006 (2004) 5:45-60 (2005); Lefranc, M.P. et al., Nucleic Acids Res., 33:D593-597 (2005); Lefranc, M.P. et al., Nucleic Acids Res., 37:D1006-1012 (2009);Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J.Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004). See also hgmp.mrc.ac.uk and bioinf.org.uk / abs. As used herein, a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.[000123] In certain embodiments, there are three CDRs in each of the variable regions of a heavy chain and a light chain, which are designated CDR1, CDR2, and CDR3, for each of the #14882946v3variable regions. The term "CDR set" as used herein refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Sub-portions of CDRs may be designated as LI, L2 and L3 or Hl, H2 and H3 where the "L" and the "H" designates the light chain and the heavy chains regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133-139 (1995)) and MacCallum (J Mol Biol 262(5):732-45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.[000124] In certain embodiments, the CDRs of an antibody may have different amino acid sequences when different definition systems are used (e.g., the IMGT definition, the Kabat definition, or the Chothia definition). A definition system annotates each amino acid in a given antibody sequence (e.g., VH or VL sequence) with a number, and numbers corresponding to the heavy chain and light chain CDRs are provided in Table 2. The CDRs listed in Table 1 are defined in accordance with the Kabat definition. One skilled in the art is able to derive the CDR sequences using the different numbering systems for the anti-LTBF4 antibodies provided in Table 1.Table 2. CDR Definitions1IMGT®, the international ImMunoGeneTics information system®, imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999).2Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242.3Chothia et al., J. Mol. #14882946v3Biol. 196:901-917 (1987))[000125] CDR-grafted antibody: The term "CDR-grafted antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and / or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.[000126] Chimeric antibody: The term "chimeric antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.[000127] Complementary: As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base at one position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position. Base pairings may include both canonical Watson-Crick base pairing and non-Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing). For example, in some embodiments, for complementary base pairings, adenosine-type bases (A) are complementary to thymidine-type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T. Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U or T.[000128] Conservative amino acid substitution: As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular#14882946v3Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.[000129] Cross-reactive: As used herein and in the context of a targeting agent (e.g., antibody), the term “cross-reactive,” refers to a property of the agent being capable of specifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity. For example, in some embodiments, an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class (e.g., a human LTBP4 and non-human primate LTBP4) is capable of binding to the human antigen and non-human primate antigens with a similar affinity or avidity. In some embodiments, an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a rodent antigen and a non-human primate antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a human antigen, a non-human primate antigen, and a rodent antigen of a similar type or class.[000130] Effective Amount: As used herein, “an effective amount” refers to the amount of each active agent (e.g., anti-LTBP4 antibody) required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect is decreased level of TGF-p, increased LTBP4 level or activity, and / or alleviated disease conditions (e.g., muscular dystrophy).[000131] Framework: As used herein, the term "framework" or "framework sequence" refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (CDR-L1, CDR-L2, and CDR-L3 of light chain and CDR-H1, CDR-H2, and CDR-H3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region. Human heavy chain and light chain acceptor sequences are known in the art. In one #14882946v3embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.[000132] Human antibody: The term "human antibody", as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.[000133] Humanized antibody: The term "humanized antibody" refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and / or VL sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences. In one embodiment, humanized anti-LTBP4 antibodies and antigen binding portions are provided. Such antibodies may be generated by obtaining murine anti-LTBP4 monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005 / 123126 A2.[000134] Humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some embodiments, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise #14882946v3at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Antibodies may have Fc regions modified as described in WO 99 / 58572. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.[000135] In some embodiments, humanization is achieved by grafting the CDRs (e.g., as shown in Table 1) into the human variable domains (e.g., IGKV1-NL1*O1 and IGHV1-3*O1 human variable domain). In some embodiments, the anti-LTBP4 antibody of the present disclosure is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 1, and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 1.[000136] Isolated antibody: An "isolated antibody", as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds LTBP4 is substantially free of antibodies that specifically bind antigens other than LTBP4). An isolated antibody that specifically binds LTBP4 may, however, have cross -reactivity to other antigens. Moreover, an isolated antibody may be substantially free of other cellular material and / or chemicals.[000137] Kabat numbering: The terms "Kabat numbering", "Kabat definitions and "Kabat labeling" are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.[000138] Recombinant antibody: The term "recombinant antibody", as used herein, is intended to include all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector #14882946v3transfected into a host cell (described in more details in this disclosure), including, for example, antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29:128-145; Hoogenboom H., and Chames P. (2000) Immunology Today 21:371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364-370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. In some embodiments, recombinant human antibodies are provided herein. In certain embodiments, such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. One embodiment of the disclosure provides fully human antibodies capable of binding human LTBP4 which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005 / 007699 A2.[000139] Selective: As used herein, the term “selective” or “selectively” refers to the ability of a molecule to produce an effect (e.g., inhibit, antagonize, agonize, etc) in relation to its target molecule compared to a reference molecule. For example, a molecule that selectively inhibits its target molecule means that this molecule is capable of inhibiting its target molecule with a degree that is distinguishable from a reference molecule in an inhibition assay or other inhibitory context. For example, with respect to an inhibitor, the term, “selectively inhibits,” refers to the ability of the inhibitor to inhibit its target molecule with a degree that is distinguishable from a reference molecule that is not substantially inhibited in an inhibition assay, e.g., to an extent that permit selective inhibition of the target molecule, as described herein. Once the reaction is terminated, the signal produced by inhibiting the target molecule can be measured. The half maximal inhibitor concentration for the target molecule and the reference molecule can be calculated. In some embodiments, a molecule described #14882946v3herein selectively binds to a target molecule. In some embodiments, a molecule described herein selectively binds LTBP4. In some embodiments, a molecule described herein stabilizes the hinge domain of LTBP4 and blocks cleavage of LTBP4. In some embodiments, a molecule described herein reduces activity or availability of TGF-P (e.g., TGF-P-1, TGF-P-2, TGF-P-3). In some embodiments, a molecule described herein reduces activity, amount, or availability of TGF-P (e.g., TGF-P-1, TGF-P-2, TGF-P-3) in a cell. In some embodiments, a molecule described herein reduces activity, amount, or availability of TGF-P (e.g., TGF-P-1, TGF-P-2, TGF-P-3) in a tissue. In some embodiments, a molecule described herein reduces activity, amount, or availability of TGF-P (e.g., TGF-P-1, TGF-P-2, TGF-P-3) in a subject. In some embodiments, the activity, amount, or availability of TGF-P (e.g., TGF-P-1, TGF-P-2, TGF-P-3) is reduced by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% in the cell, tissue or subject, relative to the activity, amount, or availability of TGF-P prior to contact of the molecule with the cell, tissue, or subject.[000140] Specifically binds: As used herein, the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context. With respect to an antibody, the term, “specifically binds,” refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, as described herein. In some embodiments, an antibody specifically binds to a target if the antibody has a KD for binding the target of at least about IO’4M, IO’5M, IO’6M, IO’7M, IO’8M, IO’9M, 10’10M, 1011M, 1012M, 1013M, or less. In some embodiments, an antibody specifically binds LTBP4.[000141] Subject: As used herein, the term “subject” refers to a mammal. In some embodiments, a subject is non-human primate, or rodent. In some embodiments, a subject is a human. In some embodiments, a subject is a patient, e.g., a human patient that has or is suspected of having a disease. In some embodiments, the subject is a human patient who has or is suspected of having muscular dystrophy (e.g., Duchenne muscular dystrophy) and / or one or more conditions arising as a result of muscular dystrophy (e.g., Duchenne muscular dystrophy or fibrosis).[000142] Treatment: As used herein, the term “treating” or “treatment” refers to the#14882946v3application or administration of a composition including one or more active agents (e.g., anti LTBP4 antibodies) to a subject, who has a target disease or disorder, a symptom of the disease / disorder, or a predisposition toward the disease / disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder. Alleviating a target disease / disorder includes delaying or preventing the development or progression of the disease, or reducing disease severity.[000143]II. Anti-LTBP4 Antibodies[000144] In some embodiments, the anti-LTBP4 antibody is an antibody that specifically binds LTBP4. Provided herein, in some aspects, are antibodies that specifically bind to human LTBP4 with high specificity and affinity. In some embodiments, anti-LTBP4 antibodies provided herein bind specifically to LTBP4 from human, non-human primates, mouse, rat, etc. In some embodiments, the anti-LTBP4 antibody described herein binds to an amino acid segment of a human or non-human primate LTBP4. In some embodiments, anti-LTBP4 antibodies provided herein bind to human LTBP4. Exemplary amino acid sequences of human LTBP4 are set forth in NCBI Accession Numbers NP_001036009.1,NP_001036010.1, or NP_003564.2 and UniProt Accession Numbers: Q8N2S1, 000508, 075412, and 075413, the entire sequences of which are incorporated herein by reference. An exemplary amino acid sequence of human LTBP4 is set forth in SEQ ID NO: 286:MPRPGTSGRRPLLLVLLLPLFAAATSAASPSPSPSQWEVPGVPSRPASVAVCRCCP GQTSRRSRCIRAFCRVRSCQPKKCAGPQRCLNPVPAVPSPSPSVRKRQVSLNWQPLT LQEARALLKRRRPRGPGGRGLLRRRPPQRAPAGKAPVLCPLICHNGGVCVKPDRCLC PPDFAGKFCQLHSSGARPPAPAVPGLTRSVYTMPLANHRDDEHGVASMVSVHVEHPQ EASVWHQVERVSGPWEEADAEAVARAEAAARAEAAAP YTVLAQSAPREDGYSDASG FGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPDG PCPTGFERVNGSCEDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQ HVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFR EICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPR PEPRPDPRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTC ACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAEC LDVDECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGR GACKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGF RSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDEC ENHLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTE GSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPG PRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECRERG PALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTP GSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGA#14882946v3RDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTSAG TFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDACDNIL ARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDV DECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGR CVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDR QATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPPAYSPPRPGGFGLPYEYG PDLGPPYQGLPYGPELYPPPALPYDPYPPPPGPFARREAPYGAPRFDMPDFEDDGGP YGESEAPAPPGPGTRWPYRSRDTRRSFPEPEEPPEGGSYAGSLAEPYEELEAEECGI LDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNT DGSFRCICRPGFAPTHQPHHCAPARPRA (SEQ ID NO: 286).[000145] In some embodiments, anti-LTBP4 antibodies provided herein bind to mouse LTBP4. Exemplary amino acid sequences of mouse LTBP4 are set forth in NCBI Accession Numbers NP_001107021.1, NP_001297607.1, NP_783572.2 and UniProt Accession Numbers: Q8K4G1, E9QPD9, and Q8K4G0, the entire sequences of which are incorporated herein by reference.[000146] In some embodiments, the anti-LTBP4 antibody described herein may bind to a fragment of a human LTBP4. The fragment of LTBP4 may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, or between about 75 and about 150 amino acids in length. The fragment may comprise a contiguous number of amino acids from LTBP4.In some embodiments, the anti-LTBP4 antibody described herein specifically binds to an epitope on human LTBP4. In some embodiments, an anti-LTBP4 antibody described herein specifically binds to a hinge-containing fragment of human LTBP4, wherein the hingecontaining fragment contains the hinge domain of human LTBP4. In some embodiments, an anti-LTBP4 antibody described herein specifically binds to an LTBP4 epitope comprised in the hinge-containing fragment of human LTBP4. In some embodiments, the hinge-containing fragment corresponds to residues 356-584 of SEQ ID NO: 286. In some embodiments, the hinge-containing fragment comprises the amino acid sequence set forth in SEQ ID NO: 287:EDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRV LRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSA SDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGPEL PLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTR (SEQ ID NO: 287; e.g., residues 356-584 of SEQ ID NO: 286).[000147] In some embodiments, an anti-LTBP4 antibody described herein specifically binds to the hinge domain of LTBP4. In some embodiments, an anti-LTBP4 antibody described#14882946v3herein specifically binds to an LTBP4 epitope comprised in the hinge domain of human LTBP4. In some embodiments, the LTBP4 epitope comprises the hinge domain of human LTBP4. In some embodiments, the hinge domain of human LTBP4 corresponds to residues 511-529 of SEQ ID NO: 286. In some embodiments, the hinge domain of human LTBP4 comprises the amino acid sequence set forth in SEQ ID NO: 288:EPRPEPRPDPRPGPELPLP (SEQ ID NO: 288; e.g., residues 511-529 of SEQ ID NO: 286.[000148] In some embodiments, an anti-LTBP4 antibody described herein specifically binds to the proline-rich repetitive sequence of the hinge domain of LTBP4. In some embodiments, an anti-LTBP4 antibody described herein specifically binds to an LTBP4 epitope comprised in the proline-rich repetitive sequence of the hinge domain of human LTBP4. In some embodiments, the LTBP4 epitope comprises the proline-rich repetitive sequence of the hinge domain of the hinge domain of human LTBP4.In some embodiments, the proline-rich repetitive sequence of human LTBP4 comprises the amino acid sequence set forth in SEQ ID NO: 289:PRPEPRPDPRP (SEQ ID NO: 289; e.g., residues 512-522 of SEQ ID NO: 286).[000149] In some embodiments, the anti-LTBP4 antibodies described herein are affinity matured clones. In some embodiments, an anti-LTBP4 antibody specifically binds a LTBP4 (e.g., a human or non-human primate LTBP4) with binding affinity (e.g., as indicated by KD) of at least about 10’4M, 10’5M, 10’6M, 10’7M, 10’8M, 10’9M, 10’10M, 10’11M, 10’12M, 10’13M, or less. For example, the anti-LTBP4 antibodies of the present disclosure can bind to a LTBP4 protein e.g., human LTBP4) with an affinity between 5 pM and 500 nM, e.g., between 50 pM and 100 nM, e.g., between 500 pM and 50 nM. The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a LTBP4 protein e.g., human LTBP4) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of the anti-LTBP4 antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, the anti-LTBP4 antibodies described herein binds to LTBP4 with a KD of sub-nanomolar range.[000150] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), fluorescence activated cell sorting (FACS) or spectroscopy (e.g., using a#14882946v3fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (lOmM PO4-3, 137mM NaCl, and 2.7mM KC1). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([[Bound]]) is generally related to the concentration of free target protein ([[Free]]) by the following equation:[000151] [[Bound]] = [[Free]] / (Kd+[[Free]])[000152] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.[000153] The heavy chain (HC) and light chain (LC) sequences, heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences, and heavy chain and light chain constant region sequences of non-limiting examples of anti-LTBP4 antibodies are provided in Table 1.Table 1. Exemplary anti-LTBP4 antibodies#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3#14882946v3[000154] In some embodiments, the anti-LTBP4 antibodies of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-LTBP4 antibodies selected from Table 1. In some embodiments, the anti-LTBP4 antibodies of the present disclosure comprise the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the anti-LTBP4 antibodies of the present disclosure comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-LTBP4 antibodies selected from Table 1. In some embodiments, the anti-LTBP4 antibodies of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 s provided for any one of the anti-LTBP4 antibodies selected from Table 1.[000155] In some embodiments, the anti-LTBP4 antibodies of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-LTBP4 antibodies selected from Table 1. In some#14882946v3embodiments, antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, the anti-LTBP4 antibodies of the disclosure may include at least the heavy and / or light chain CDR3s of any one of the anti-LTBP4 antibodies selected from Table 1.[000156] In some embodiments, the isolated anti-LTBP4 antibody comprises a heavy chain variable region that comprises a heavy chain CDR1 (HC CDR1), a heavy chain CDR2 (HC CDR2), and a heavy chain CDR3 (HC CDR3).[000157] Also within the scope of the present disclosure are functional variants of any of the exemplary anti-LTBP4 antibodies as disclosed herein. A functional variant may contain one or more amino acid residue variations in the VH and / or VL, or in one or more of the HC CDRs and / or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.[000158] In some embodiments, any of the anti-LTBP4 antibodies of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 sequences from one of the anti-LTBP4 antibodies selected from Table 1. In some embodiments, the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). For example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immuno specific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is#14882946v3maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).[000159] Accordingly, in some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immuno specific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immunospecific binding to LTBP4 (e.g., #14882946v3human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-LTBP4 antibodies selected from Table 1) so long as immuno specific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whether immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained, for example, using binding assays and conditions described in the art.[000160] In some examples, any of the anti-LTBP4 antibodies of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti-LTBP4 antibodies selected from Table 1. For example, the antibodies may include one or more CDR sequence(s) from any of the anti-LTBP4 antibodies selected from Table 1 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-LTBP4 antibodies selected from Table 1) so long as immunospecific binding to LTBP4 (e.g., human LTBP4) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a LTBP4 protein (e.g., a human LTBP4 protein), for example, as determined based on a crystal structure. Some aspects of the disclosure provide anti-LTBP4 antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of the CDR-H sequences provided in any one of the anti-LTBP4 selected from Table 1. In some embodiments, any of the VL domains provided herein include one or more of the CDR-L sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-LTBP4 antibodies selected from #14882946v3Table 1.[000161] In some embodiments, the anti-LTBP4 antibodies of the disclosure include any antibody that includes a heavy chain variable domain and / or a light chain variable domain of any one of the anti-LTBP4 antibodies selected from Table 1, and variants thereof. In some embodiments, anti-LTBP4 antibodies of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-LTBP4 antibodies selected from Table 1.[000162] Aspects of the disclosure provide anti-LTBP4 antibodies having a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, the anti-LTBP4 antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the heavy chain variable sequence and / or any light chain variable sequence of any one of the anti-LTBP4 antibodies selected from Table 1. In some embodiments, the homologous heavy chain variable and / or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) may occur within a heavy chain variable and / or a light chain variable sequence excluding any of the CDR sequences provided herein. In some embodiments, any of the anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-LTBP4 antibodies selected from Table 1.[000163] In some embodiments, the anti-LTBP4 antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Table 1). In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Table 1, and comprises a humanized heavy chain variable region and / or a humanized light chain variable region.[000164] In some embodiments, the anti-LTBP4 antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-LTBP4 antibodies listed in Table 1. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure is a#14882946v3humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-LTBP4 antibodies listed in Table 1.[000165] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 8.[000166] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3 a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000167] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. "Collectively," as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000168] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: #14882946v33. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000169] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6[000170] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 8.[000171] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, #14882946v39, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 7 and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 8.[000172] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 7, and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 8.[000173] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 15. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 16.#14882946v3[000174] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:9, a HC CDR2 having the amino acid sequence of SEQ ID NO: 10, a HC CDR3 having the amino acid sequence of SEQ ID NO: 11 a LC CDR1 having the amino acid sequence of SEQ ID NO: 12, a LC CDR2 having the amino acid sequence of SEQ ID NO: 13, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 14.[000175] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 9, HC CDR2 having the amino acid sequence of SEQ ID NO: 10, and HC CDR3 having the amino acid sequence of SEQ ID NO: 11. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 12, LC CDR2 having the amino acid sequence of SEQ ID NO: 13, and LC CDR3 having the amino acid sequence of SEQ ID NO: 14.[000176] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 9, HC CDR2 having the amino acid sequence of SEQ ID NO: 10, and HC CDR3 having the amino acid sequence of SEQ ID NO: 11. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 12, LC CDR2 having the amino acid sequence of SEQ ID NO: 13, and LC CDR3 having the amino acid sequence of SEQ ID NO: 14.[000177] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 9; a HC CDR2 having no more than 3 amino acid variations (e.g., no more #14882946v3than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 10; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 11. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 12; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 13; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 14.[000178] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 15. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 15.[000179] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 15. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 16. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 15 and / or a VL of SEQ ID NO: 16 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 15, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 16.[000180] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises #14882946v3a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 15. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 16. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 15, and / or a VL of SEQ ID NO: 16 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 15, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 16.[000181] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 23. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 24.[000182] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 17, a HC CDR2 having the amino acid sequence of SEQ ID NO: 18, a HC CDR3 having the amino acid sequence of SEQ ID NO: 19, a LC CDR1 having the amino acid sequence of SEQ ID NO: 20, a LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 22.[000183] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 17, HC CDR2 having the amino #14882946v3acid sequence of SEQ ID NO: 18, and HC CDR3 having the amino acid sequence of SEQ ID NO: 19. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 20, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 22.[000184] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 17, HC CDR2 having the amino acid sequence of SEQ ID NO: 18, and HC CDR3 having the amino acid sequence of SEQ ID NO: 19. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 20, LC CDR2 having the amino acid sequence of SEQ ID NO: 21, and LC CDR3 having the amino acid sequence of SEQ ID NO: 22.[000185] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 17; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 18; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 19. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 20; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 21; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino #14882946v3acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 22.[000186] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 23. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 24.[000187] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 23. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 24. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 23, and / or a VL of SEQ ID NO: 24, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 23, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 24.[000188] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 23. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 24. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may #14882946v3occur within a VH of SEQ ID NO: 23, and / or a VL of SEQ ID NO: 24, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 23, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 24.[000189] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 32.[000190] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:25, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 27, a LC CDR1 having the amino acid sequence of SEQ ID NO: 28, a LC CDR2 having the amino acid sequence of SEQ ID NO: 29, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 30.[000191] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 25, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 28, LC CDR2 having the amino acid sequence of SEQ ID NO: 29, and LC CDR3 having the amino acid sequence of SEQ ID NO: 30.[000192] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least #14882946v395%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 25, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 28, LC CDR2 having the amino acid sequence of SEQ ID NO: 29, and LC CDR3 having the amino acid sequence of SEQ ID NO: 30.[000193] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 25; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 26; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 28; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 29; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 30.[000194] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 32.[000195] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 31. Alternatively or in addition, the anti-LTBP4 antibody of #14882946v3the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 32. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 31, and / or a VL of SEQ ID NO: 32, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 31, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 32.[000196] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 31. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 32. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 31, and / or a VL of SEQ ID NO: 32, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 31, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 32.[000197] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises #14882946v3a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 39. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 40.[000198] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:33, a HC CDR2 having the amino acid sequence of SEQ ID NO: 34, a HC CDR3 having the amino acid sequence of SEQ ID NO: 35 a LC CDR1 having the amino acid sequence of SEQ ID NO: 36, a LC CDR2 having the amino acid sequence of SEQ ID NO: 37, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 38.[000199] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 33, HC CDR2 having the amino acid sequence of SEQ ID NO: 34, and HC CDR3 having the amino acid sequence of SEQ ID NO: 35. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 36, LC CDR2 having the amino acid sequence of SEQ ID NO: 37, and LC CDR3 having the amino acid sequence of SEQ ID NO: 38.[000200] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 33, HC CDR2 having the amino acid sequence of SEQ ID NO: 34, and HC CDR3 having the amino acid sequence of SEQ ID NO: 35. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 36, LC CDR2 having the amino acid sequence of SEQ ID NO: 37, and LC CDR3 having the amino acid sequence of SEQ ID NO: 38.#14882946v3[000201] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 33; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 34; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 35. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 36; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 37; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 38.[000202] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 39. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 40.[000203] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 39. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 40. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 39, and / or a VL of SEQ ID NO: 40, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 39, and / or a light chain variable sequence that comprises a #14882946v3framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 40.[000204] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 39. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 40. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 39, and / or a VL of SEQ ID NO: 40, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 39, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 40.[000205] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 47. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 48.[000206] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 41, a HC CDR2 having the amino acid sequence of SEQ ID NO: 42, a HC CDR3 having the amino acid sequence of SEQ ID NO: 43 a LC CDR1 having the amino acid sequence of SEQ ID NO: 44, a LC CDR2 having the amino acid sequence of SEQ ID NO: 45, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 46.#14882946v3[000207] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 41, HC CDR2 having the amino acid sequence of SEQ ID NO: 42, and HC CDR3 having the amino acid sequence of SEQ ID NO: 43. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 44, LC CDR2 having the amino acid sequence of SEQ ID NO: 45, and LC CDR3 having the amino acid sequence of SEQ ID NO: 46.[000208] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 41, HC CDR2 having the amino acid sequence of SEQ ID NO: 42, and HC CDR3 having the amino acid sequence of SEQ ID NO: 43. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 44, LC CDR2 having the amino acid sequence of SEQ ID NO: 45, and LC CDR3 having the amino acid sequence of SEQ ID NO: 46.[000209] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 41; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 42; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 43. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with #14882946v3the LC CDR1 having the amino acid sequence of SEQ ID NO: 44; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 45; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 46.[000210] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 47. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 48.[000211] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 47, and / or a VL of SEQ ID NO: 8, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 48.[000212] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at #14882946v3least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 47, and / or a VL of SEQ ID NO: 48 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 48.[000213] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 55. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 56.[000214] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, a HC CDR3 having the amino acid sequence of SEQ ID NO: 51 a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 54.[000215] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid #14882946v3sequence of SEQ ID NO: 54.[000216] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid sequence of SEQ ID NO: 54.[000217] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 49; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 50; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 52; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 53; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 54.[000218] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 55. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 56.#14882946v3[000219] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 55. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 56. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 55, and / or a VL of SEQ ID NO: 56, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 55, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 56.[000220] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 55. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 56. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 55, and / or a VL of SEQ ID NO: 56, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 55, and / or a light chain variable sequence that comprises a framework sequence that #14882946v3is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 56.[000221] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 63. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 64.[000222] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:57, a HC CDR2 having the amino acid sequence of SEQ ID NO: 58, a HC CDR3 having the amino acid sequence of SEQ ID NO: 59 a LC CDR1 having the amino acid sequence of SEQ ID NO: 60, a LC CDR2 having the amino acid sequence of SEQ ID NO: 61, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 62.[000223] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 57, HC CDR2 having the amino acid sequence of SEQ ID NO: 58, and HC CDR3 having the amino acid sequence of SEQ ID NO: 59. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 60, LC CDR2 having the amino acid sequence of SEQ ID NO: 61, and LC CDR3 having the amino acid sequence of SEQ ID NO: 62.[000224] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 57, HC CDR2 having the amino acid sequence of SEQ ID NO: 58, and HC CDR3 having the amino acid sequence of SEQ ID NO: 59. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least #14882946v395%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 60, LC CDR2 having the amino acid sequence of SEQ ID NO: 61, and LC CDR3 having the amino acid sequence of SEQ ID NO: 62.[000225] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 57; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 58; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 59. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 60; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 61; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 62.[000226] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 63. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 64.[000227] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 63. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 64. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 63, and / or a VL of SEQ ID NO: 64, excluding any of the CDR sequences therein. In some #14882946v3embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 63, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 64.[000228] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 63. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 64. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 63, and / or a VL of SEQ ID NO: 64, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 63, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 64.[000229] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 71. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 72.[000230] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of #14882946v3SEQ ID NO:65, a HC CDR2 having the amino acid sequence of SEQ ID NO: 66, a HC CDR3 having the amino acid sequence of SEQ ID NO: 67 a LC CDR1 having the amino acid sequence of SEQ ID NO: 68, a LC CDR2 having the amino acid sequence of SEQ ID NO: 69, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 70.[000231] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 65, HC CDR2 having the amino acid sequence of SEQ ID NO: 66, and HC CDR3 having the amino acid sequence of SEQ ID NO: 67. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 68, LC CDR2 having the amino acid sequence of SEQ ID NO: 69, and LC CDR3 having the amino acid sequence of SEQ ID NO: 70.[000232] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 65, HC CDR2 having the amino acid sequence of SEQ ID NO: 66, and HC CDR3 having the amino acid sequence of SEQ ID NO: 67. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 68, LC CDR2 having the amino acid sequence of SEQ ID NO: 69, and LC CDR3 having the amino acid sequence of SEQ ID NO: 70.[000233] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 65; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 66; and / or a HC CDR3 having no more than 3 amino acid#14882946v3variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 67. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 68; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 69; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 70.[000234] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 71. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 72.[000235] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 71. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 72. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 71, and / or a VL of SEQ ID NO: 72, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 71, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 72.[000236] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least #14882946v396%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 71. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 72. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 71, and / or a VL of SEQ ID NO: 72, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 71, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 72.[000237] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 80.[000238] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:73, a HC CDR2 having the amino acid sequence of SEQ ID NO: 74, a HC CDR3 having the amino acid sequence of SEQ ID NO: 75 a LC CDR1 having the amino acid sequence of SEQ ID NO: 76, a LC CDR2 having the amino acid sequence of SEQ ID NO: 77, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 78.[000239] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 73, HC CDR2 having the amino acid sequence of SEQ ID NO: 74, and HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure #14882946v3comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 76, LC CDR2 having the amino acid sequence of SEQ ID NO: 77, and LC CDR3 having the amino acid sequence of SEQ ID NO: 78.[000240] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 73, HC CDR2 having the amino acid sequence of SEQ ID NO: 74, and HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 76, LC CDR2 having the amino acid sequence of SEQ ID NO: 77, and LC CDR3 having the amino acid sequence of SEQ ID NO: 78.[000241] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 73; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 74; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 76; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 77; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 78.#14882946v3[000242] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 80.[000243] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 79. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 80. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 79, and / or a VL of SEQ ID NO: 80, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 79, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 80.[000244] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 79. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 80. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 79, and / or a VL of SEQ ID NO: 80, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein #14882946v3comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 79, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 80.[000245] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 87. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 88.[000246] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:81, a HC CDR2 having the amino acid sequence of SEQ ID NO: 82, a HC CDR3 having the amino acid sequence of SEQ ID NO: 83 a LC CDR1 having the amino acid sequence of SEQ ID NO: 84, a LC CDR2 having the amino acid sequence of SEQ ID NO: 85, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000247] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 81, HC CDR2 having the amino acid sequence of SEQ ID NO: 82, and HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 84, LC CDR2 having the amino acid sequence of SEQ ID NO: 85, and LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000248] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 81, HC CDR2 having the amino acid #14882946v3sequence of SEQ ID NO: 82, and HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 84, LC CDR2 having the amino acid sequence of SEQ ID NO: 85, and LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000249] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 81; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 82; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 84; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 85; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000250] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 87. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 88.[000251] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 87. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid #14882946v3variation) as compared with the VL as set forth in SEQ ID NO: 88. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 87, and / or a VL of SEQ ID NO: 88, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 87, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 88.[000252] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 87. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 88. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 87, and / or a VL of SEQ ID NO: 88, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 87, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 88.[000253] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 95. Alternatively or in addition, the anti-LTBP4 antibody of #14882946v3the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 96.[000254] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:89, a HC CDR2 having the amino acid sequence of SEQ ID NO: 90, a HC CDR3 having the amino acid sequence of SEQ ID NO: 91 a LC CDR1 having the amino acid sequence of SEQ ID NO: 92, a LC CDR2 having the amino acid sequence of SEQ ID NO: 93, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 94.[000255] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 89, HC CDR2 having the amino acid sequence of SEQ ID NO: 90, and HC CDR3 having the amino acid sequence of SEQ ID NO: 91. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 92, LC CDR2 having the amino acid sequence of SEQ ID NO: 93, and LC CDR3 having the amino acid sequence of SEQ ID NO: 94.[000256] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 89, HC CDR2 having the amino acid sequence of SEQ ID NO: 90, and HC CDR3 having the amino acid sequence of SEQ ID NO: 91. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 92, LC CDR2 having the amino acid sequence of SEQ ID NO: 93, and LC CDR3 having the amino acid sequence of SEQ ID NO: 94.[000257] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, #14882946v3or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 89; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 90; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 91. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 92; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 93; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 94.[000258] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 95. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 96.[000259] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 95. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 96. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 95, and / or a VL of SEQ ID NO: 96, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 95, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID #14882946v3NO: 96.[000260] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 95. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 96. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 95, and / or a VL of SEQ ID NO: 96, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 95, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 96.[000261] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 103. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 104.[000262] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO:97, a HC CDR2 having the amino acid sequence of SEQ ID NO: 98, a HC CDR3 having the amino acid sequence of SEQ ID NO: 99 a LC CDR1 having the amino acid sequence of SEQ ID NO: 100, a LC CDR2 having the amino acid sequence of SEQ ID NO: 101, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 102.[000263] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino #14882946v3acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 97, HC CDR2 having the amino acid sequence of SEQ ID NO: 98, and HC CDR3 having the amino acid sequence of SEQ ID NO: 99. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 100, LC CDR2 having the amino acid sequence of SEQ ID NO: 101, and LC CDR3 having the amino acid sequence of SEQ ID NO: 102.[000264] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 97, HC CDR2 having the amino acid sequence of SEQ ID NO: 98, and HC CDR3 having the amino acid sequence of SEQ ID NO: 99. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 100, LC CDR2 having the amino acid sequence of SEQ ID NO: 101, and LC CDR3 having the amino acid sequence of SEQ ID NO: 102.[000265] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 97; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 98; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 99. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 100; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as #14882946v3compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 101; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 102.[000266] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 103. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 104.[000267] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 103. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 104. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 103, and / or a VL of SEQ ID NO: 104, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 103, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 104.[000268] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 103. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 104. In some embodiments, the degree of sequence variation #14882946v3(e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 104, and / or a VL of SEQ ID NO: 104, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 103, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 104.[000269] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 111. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 112.[000270] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 105, a HC CDR2 having the amino acid sequence of SEQ ID NO: 106, a HC CDR3 having the amino acid sequence of SEQ ID NO: 107 a LC CDR1 having the amino acid sequence of SEQ ID NO: 108, a LC CDR2 having the amino acid sequence of SEQ ID NO: 109, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 110.[000271] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 105, HC CDR2 having the amino acid sequence of SEQ ID NO: 106, and HC CDR3 having the amino acid sequence of SEQ ID NO: 107. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 108, LC CDR2 having the amino acid sequence of SEQ ID NO: 109, and LC CDR3 having the amino acid sequence of SEQ ID NO: 110.[000272] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises #14882946v3a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 105, HC CDR2 having the amino acid sequence of SEQ ID NO: 106, and HC CDR3 having the amino acid sequence of SEQ ID NO: 107. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 108, LC CDR2 having the amino acid sequence of SEQ ID NO: 109, and LC CDR3 having the amino acid sequence of SEQ ID NO: 110.[000273] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 105; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 106; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 107. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 108; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 109; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 110.[000274] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 111. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 112.[000275] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, #14882946v315, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 111. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 112. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 111, and / or a VL of SEQ ID NO: 112, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 111, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 112.[000276] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 111. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 112. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 111, and / or a VL of SEQ ID NO: 112, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 111, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% #14882946v3identical to the framework sequence of a VL of SEQ ID NO: 112.[000277] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 119. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 120.[000278] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 113, a HC CDR2 having the amino acid sequence of SEQ ID NO: 114, a HC CDR3 having the amino acid sequence of SEQ ID NO: 115 a LC CDR1 having the amino acid sequence of SEQ ID NO: 116, a LC CDR2 having the amino acid sequence of SEQ ID NO: 117, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 118.[000279] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 113, HC CDR2 having the amino acid sequence of SEQ ID NO: 114, and HC CDR3 having the amino acid sequence of SEQ ID NO: 115. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 116, LC CDR2 having the amino acid sequence of SEQ ID NO: 117, and LC CDR3 having the amino acid sequence of SEQ ID NO: 118.[000280] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 113, HC CDR2 having the amino acid sequence of SEQ ID NO: 114, and HC CDR3 having the amino acid sequence of SEQ ID NO: 115. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 116, LC CDR2 having the #14882946v3amino acid sequence of SEQ ID NO: 117, and LC CDR3 having the amino acid sequence of SEQ ID NO: 118.[000281] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 113; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 114; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 115. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 116; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 117; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 118.[000282] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 119. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 120.[000283] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 119. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 120. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 119, and / or a VL of SEQ ID NO: 120, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, #14882946v316, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 119, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 120.[000284] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 119. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 120. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 119, and / or a VL of SEQ ID NO: 120, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 119, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 120.[000285] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 127. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 128.[000286] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 121, a HC CDR2 having the amino acid sequence of SEQ ID NO: 122, a HC CDR3 having the amino acid sequence of SEQ ID NO: 123 a LC CDR1 having the amino #14882946v3acid sequence of SEQ ID NO: 124, a LC CDR2 having the amino acid sequence of SEQ ID NO: 125, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 126.[000287] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 121, HC CDR2 having the amino acid sequence of SEQ ID NO: 122, and HC CDR3 having the amino acid sequence of SEQ ID NO: 123. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 124, LC CDR2 having the amino acid sequence of SEQ ID NO: 125, and LC CDR3 having the amino acid sequence of SEQ ID NO: 126.[000288] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 121, HC CDR2 having the amino acid sequence of SEQ ID NO: 122, and HC CDR3 having the amino acid sequence of SEQ ID NO: 123. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 124, LC CDR2 having the amino acid sequence of SEQ ID NO: 125, and LC CDR3 having the amino acid sequence of SEQ ID NO: 126.[000289] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 121; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 122; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 123. Alternatively or in addition, the anti-#14882946v3LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 124; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 125; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 126.[000290] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 127. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 128.[000291] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 127. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 128. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 127, and / or a VL of SEQ ID NO: 128 excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 127, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 128.[000292] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 127. Alternatively or in addition, the anti-LTBP4 antibody of the present #14882946v3disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 128. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 127, and / or a VL of SEQ ID NO: 128, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 127, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 128.[000293] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 135. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 136.[000294] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 129, a HC CDR2 having the amino acid sequence of SEQ ID NO: 130, a HC CDR3 having the amino acid sequence of SEQ ID NO: 131 a LC CDR1 having the amino acid sequence of SEQ ID NO: 132, a LC CDR2 having the amino acid sequence of SEQ ID NO: 133, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 134.[000295] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 129, HC CDR2 having the amino acid sequence of SEQ ID NO: 130, and HC CDR3 having the amino acid sequence of SEQ ID NO: 131. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as #14882946v3compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 132, LC CDR2 having the amino acid sequence of SEQ ID NO: 133, and LC CDR3 having the amino acid sequence of SEQ ID NO: 134.[000296] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 129, HC CDR2 having the amino acid sequence of SEQ ID NO: 130, and HC CDR3 having the amino acid sequence of SEQ ID NO: 131. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 132, LC CDR2 having the amino acid sequence of SEQ ID NO: 133, and LC CDR3 having the amino acid sequence of SEQ ID NO: 134.[000297] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 129; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 130; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 131. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 132; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 133; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 134.[000298] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 135. Alternatively or in addition, #14882946v3the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 136.[000299] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 135. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 136. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 135, and / or a VL of SEQ ID NO: 136, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 135, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 136.[000300] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 135. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 136. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 135, and / or a VL of SEQ ID NO: 136, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at #14882946v3least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 135, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 136.[000301] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 143. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 144.[000302] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 137, a HC CDR2 having the amino acid sequence of SEQ ID NO: 138, a HC CDR3 having the amino acid sequence of SEQ ID NO: 139 a LC CDR1 having the amino acid sequence of SEQ ID NO: 140, a LC CDR2 having the amino acid sequence of SEQ ID NO: 141, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 142.[000303] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 137, HC CDR2 having the amino acid sequence of SEQ ID NO: 138, and HC CDR3 having the amino acid sequence of SEQ ID NO: 139. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 140, LC CDR2 having the amino acid sequence of SEQ ID NO: 141, and LC CDR3 having the amino acid sequence of SEQ ID NO: 142.[000304] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 137, HC CDR2 having the amino acid sequence of SEQ ID NO: 138, and HC CDR3 having the amino acid sequence of SEQ ID NO: 139. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure #14882946v3comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 140, LC CDR2 having the amino acid sequence of SEQ ID NO: 141, and LC CDR3 having the amino acid sequence of SEQ ID NO: 142.[000305] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 137; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 138; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 139. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 140; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 141; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 142.[000306] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 143. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 144.[000307] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 143. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 144. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, #14882946v310, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 143, and / or a VL of SEQ ID NO: 144, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 143, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 144.[000308] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 143. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 144. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 143, and / or a VL of SEQ ID NO: 144, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 143, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 144.[000309] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 151. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 152.#14882946v3[000310] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 145, a HC CDR2 having the amino acid sequence of SEQ ID NO: 146, a HC CDR3 having the amino acid sequence of SEQ ID NO: 147 a LC CDR1 having the amino acid sequence of SEQ ID NO: 148, a LC CDR2 having the amino acid sequence of SEQ ID NO: 149, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 150.[000311] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 145, HC CDR2 having the amino acid sequence of SEQ ID NO: 146, and HC CDR3 having the amino acid sequence of SEQ ID NO: 147. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 148, LC CDR2 having the amino acid sequence of SEQ ID NO: 149, and LC CDR3 having the amino acid sequence of SEQ ID NO: 150.[000312] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 145, HC CDR2 having the amino acid sequence of SEQ ID NO: 146, and HC CDR3 having the amino acid sequence of SEQ ID NO: 147. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 148, LC CDR2 having the amino acid sequence of SEQ ID NO: 149, and LC CDR3 having the amino acid sequence of SEQ ID NO: 150.[000313] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 145; a HC CDR2 having no more than 3 amino acid variations (e.g., no more #14882946v3than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 146; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 147. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 148; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 149; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 150.[000314] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 151. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 152.[000315] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 151. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 152. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 151, and / or a VL of SEQ ID NO: 152, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 151, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 152.[000316] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises #14882946v3a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 151. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 152. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may occur within a VH of SEQ ID NO: 151, and / or a VL of SEQ ID NO: 152, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 151, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 152.[000317] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, HC CDR2, and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 159. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, LC CDR2, and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 160.[000318] In some embodiments, according to the Kabat definition system, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 153, a HC CDR2 having the amino acid sequence of SEQ ID NO: 154, a HC CDR3 having the amino acid sequence of SEQ ID NO: 155 a LC CDR1 having the amino acid sequence of SEQ ID NO: 156, a LC CDR2 having the amino acid sequence of SEQ ID NO: 157, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 158.[000319] In some embodiments, anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 153, HC CDR2 having the amino #14882946v3acid sequence of SEQ ID NO: 154, and HC CDR3 having the amino acid sequence of SEQ ID NO: 155. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 156, LC CDR2 having the amino acid sequence of SEQ ID NO: 157, and LC CDR3 having the amino acid sequence of SEQ ID NO: 158.[000320] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 153, HC CDR2 having the amino acid sequence of SEQ ID NO: 154, and HC CDR3 having the amino acid sequence of SEQ ID NO: 155. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 156, LC CDR2 having the amino acid sequence of SEQ ID NO: 157, and LC CDR3 having the amino acid sequence of SEQ ID NO: 158.[000321] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 153; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 154; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 155. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 156; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 157; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino #14882946v3acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 158.[000322] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 159. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 160.[000323] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 159. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 160. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 159, and / or a VL of SEQ ID NO: 160, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 159, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 160.[000324] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 159. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% % (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 160. In some embodiments, the degree of sequence variation (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) may #14882946v3occur within a VH of SEQ ID NO: 159, and / or a VL of SEQ ID NO: 160, excluding any of the CDR sequences therein. In some embodiments, an anti-LTBP4 antibody provided herein comprise a heavy chain variable sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VH of SEQ ID NO: 159, and / or a light chain variable sequence that comprises a framework sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the framework sequence of a VL of SEQ ID NO: 160.[000325] In some embodiments, the anti-LTBP4 antibody of the present disclosure is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species.Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a nonhuman mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.[000326] In some embodiments, the anti-LTBP4 antibody described herein is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.[000327] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a VL domain and / or VH domain of any one of the anti-LTBP4 antibodies selected from Table 1, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described #14882946v3in the art, e.g., see Kabat E A et al., (1991) supra.[000328] In some embodiments, the light chain of any of the anti-LTBP4 antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art. In some examples, the CL is a kappa light chain. In other examples, the CL is a lambda light chain. In some embodiments, the CL is a kappa light chain.[000329] Other antibody heavy and light chain constant regions are well known in the art, e.g., those provided in the IMGT database (www.imgt.org) or at www.vbase2.org / vbstat.php., both of which are incorporated by reference herein.[000330] In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 201:ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 201)[000331] In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising any one of the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 201. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising any one of the VL as listed in Table 1 or any variants thereof and a heavy chain constant region set forth in SEQ ID NO: 201. In some embodiments, the heavy chain constant region set forth in SEQ ID NO: 201 is encoded by a nucleic acid comprising the nucleotide sequence set forth in SEQ ID NO: 203:GCTAGCACAAAAGGACCAAGCGTGTTTCCACTGGCACCTAGCAGCAAATCCACCAGC GGCGGAACAGCAGCCCTCGGGTGCCTGGTGAAGGATTACTTCCCTGAGCCAGTCACA GTGTCCTGGAACTCCGGAGCCCTGACATCCGGCGTGCACACCTTCCCCGCTGTGCTG CAATCCAGCGGACTGTATAGCCTCAGCTCCGTCGTGACAGTCCCTTCCAGCAGCCTG GGCACACAGACTTACATTTGCAACGTGAACCACAAACCTTCCAACACTAAGGTGGAC AAAAAGGTGGAACCCAAATCCTGTGATAAGACCCATACATGCCCACCTTGTCCCGCT CCTGAGGCTGCTGGGGGACCTTCCGTCTTTCTGTTTCCTCCAAAACCAAAAGACACA CTCATGATCAGCCGGACCCCCGAAGTCACCTGTGTGGTGGTGGACGTCAGCCACGAA GATCCAGAGGTCAAGTTCAATTGGTACGTGGATGGAGTGGAAGTCCACAACGCAAAA ACCAAACCTAGAGAAGAACAGTACAATAGCACATACAGGGTGGTGTCCGTCCTGACA GTGCTCCACCAGGACTGGCTCAATGGCAAAGAGTATAAGTGCAAGGTGAGCAACAAG GCCCTGCCTGCACCAATTGAGAAAACAATTAGCAAGGCAAAGGGGCAGCCACGGGAA#14882946v3CCCCAGGTGTATACCCTGCCCCCAAGCCGGGATGAACTGACCAAAAACCAGGTCAGC CTGACATGCCTGGTGAAAGGGTTTTACCCAAGCGATATTGCCGTCGAGTGGGAGAGC AACGGACAGCCAGAAAACAATTACAAAACCACCCCACCTGTGCTGGACTCCGATGGG AGCTTTTTCCTGTACAGCAAGCTCACAGTGGACAAGTCCAGATGGCAACAGGGCAAC GTGTTTTCCTGCTCCGTGATGCACGAGGCCCTCCACAACCACTATACACAAAAGTCC CTAAGCTTAAGCCCAGGA (SEQ ID NO: 203).[000332] In some embodiments, the anti-LTBP4 antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 202:RTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 202)[000333] In some embodiments, the heavy chain constant region set forth in SEQ ID NO: 202 is encoded by a nucleic acid comprising the nucleotide sequence set forth in SEQ ID NO: 204:CGTACGGTGGCTGCACCTTCCGTCTTTATCTTTCCACCTTCCGATGAGCAGCTGAAG AGCGGAACAGCAAGCGTGGTGTGTCTGCTGAACAACTTTTATCCCCGGGAGGCAAAG GTGCAGTGGAAAGTCGACAATGCTCTCCAGTCCGGCAATTCCCAAGAGAGCGTGACA GAGCAAGATTCCAAGGACTCCACTTACAGCCTGTCCAGCACCCTCACACTGAGCAAG GCTGATTACGAGAAACACAAAGTGTACGCTTGTGAAGTCACCCACCAAGGCCTGAGC AGCCCAGTCACTAAGTCCTTTAACCGGGGCGAATGT (SEQ ID NO: 204).[000334] In some embodiments, the anti-LTBP4 antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 202. In some embodiments, the anti-LTBP4 antibody described herein comprises a light chain comprising any one of the VL as listed in Table 1 or any variants thereof and a light chain constant region set forth in SEQ ID NO: 202.[000335] Examples of IgG heavy chain and light chain amino acid sequences of the anti-LTBP4 antibodies described are provided in Table 1 above.[000336] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 161. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO:#14882946v3162. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 161. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 162. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 161. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 162.[000337] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 163. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 164. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 163. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 164. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 163. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 164.[000338] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 165. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 166. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, #14882946v398%, or 99%) identical to SEQ ID NO: 165. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 166. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 165. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 166.[000339] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 167. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 168. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 167. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 168. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 167. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 168.[000340] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 169. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 170. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 169. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is #14882946v3at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 170. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 169. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 170.[000341] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 171. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 172. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 171. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 172. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 171. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 172.[000342] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 173. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 174. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 173. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 174. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain #14882946v3comprising the amino acid sequence of SEQ ID NO: 173. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 174.[000343] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 175. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 176. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 175. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 176. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 175. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 176.[000344] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 177. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 178. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 177. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 178. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 177. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid #14882946v3sequence of SEQ ID NO: 178.[000345] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 179. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 180. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 179. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 180. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 179. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 180.[000346] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 181. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 182. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 181. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 182. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 181. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 182.[000347] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises #14882946v3a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 183. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 184. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 183. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 184. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 183. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 184.[000348] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 185. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 186. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 185. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 186. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 185. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 186.[000349] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared #14882946v3with the heavy chain as set forth in SEQ ID NO: 187. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 188. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 187. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 188. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 187. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 188.[000350] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 189. Alternatively or in addition, the anti-LTBP4 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 190. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 189. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 190. In some embodiments, the anti-LTBP4 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 189. Alternatively or in addition, the anti-LTBP4 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 190.[000351] In some embodiments, the anti-LTBP4 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10,...
Claims
CLAIMSWhat is claimed is:
1. An antibody or antibody fragment that specifically binds to latent transforming growth factor p (TGF-P) binding protein 4, the antibody comprising:(a) a heavy chain (HC) complementarity determining region (CDR) 1 (HC CDR1), HC CDR2, and HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7, and a light chain (LC) CDR1, LC CDR2, and LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 8;(b) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 15, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 16;(c) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 23, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 24; or(d) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 31, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 32; or(e) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 39, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 40; or(f) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 47, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 48; or(g) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 55, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 56; or(h) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 63, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 64; or(i) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 71, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 72; orj) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence #14882946v3of SEQ ID NO: 79, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 80; or(k) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 87, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 88; or(l) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 95, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 96; or(m) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 103, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 104; or(n) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 111, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 112; or(o) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 119, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 120; or(p) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 127, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 128; or(q) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 135, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 136; or(r) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 143, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 144; or(s) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 151, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 152; or(t) a HC CDR1, HC CDR2, and HC CDR3 of a VH having the amino acid sequence of SEQ ID NO: 159, and a LC CDR1, LC CDR2, and LC CDR3 of a VL having the amino acid sequence of SEQ ID NO: 160.
2. The antibody or antibody fragment of claim 1, wherein the antibody comprises: #14882946v3(a) a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR1 having the amino acid sequence of SEQ ID NO: 5, a LC CDR1 having the amino acid sequence of SEQ ID NO: 6;(b) a HC CDR1 having the amino acid sequence of SEQ ID NO: 9, a HC CDR2 having the amino acid sequence of SEQ ID NO: 10, a HC CDR3 having the amino acid sequence of SEQ ID NO: 11, a LC CDR1 having the amino acid sequence of SEQ ID NO: 12, a LC CDR1 having the amino acid sequence of SEQ ID NO: 13, a LC CDR1 having the amino acid sequence of SEQ ID NO: 14;(c) a HC CDR1 having the amino acid sequence of SEQ ID NO: 17, a HC CDR2 having the amino acid sequence of SEQ ID NO: 18, a HC CDR3 having the amino acid sequence of SEQ ID NO: 19, a LC CDR1 having the amino acid sequence of SEQ ID NO: 20, a LC CDR1 having the amino acid sequence of SEQ ID NO: 21, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22;(d) a HC CDR1 having the amino acid sequence of SEQ ID NO: 25, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 27, a LC CDR1 having the amino acid sequence of SEQ ID NO: 28, a LC CDR1 having the amino acid sequence of SEQ ID NO: 29, a LC CDR1 having the amino acid sequence of SEQ ID NO: 30;(e) a HC CDR1 having the amino acid sequence of SEQ ID NO: 33, a HC CDR2 having the amino acid sequence of SEQ ID NO: 34, a HC CDR3 having the amino acid sequence of SEQ ID NO: 35, a LC CDR1 having the amino acid sequence of SEQ ID NO: 36, a LC CDR1 having the amino acid sequence of SEQ ID NO: 37, a LC CDR1 having the amino acid sequence of SEQ ID NO: 38;(f) a HC CDR1 having the amino acid sequence of SEQ ID NO: 41, a HC CDR2 having the amino acid sequence of SEQ ID NO: 42, a HC CDR3 having the amino acid sequence of SEQ ID NO: 43, a LC CDR1 having the amino acid sequence of SEQ ID NO: 44, a LC CDR1 having the amino acid sequence of SEQ ID NO: 45, a LC CDR1 having the amino acid sequence of SEQ ID NO: 46;(g) a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, a HC CDR3 having the amino acid sequence of SEQ ID NO: 51, a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR1 having the amino acid sequence of SEQ ID NO: 53, a LC CDR1 having the #14882946v3amino acid sequence of SEQ ID NO: 54;(h) a HC CDR1 having the amino acid sequence of SEQ ID NO: 57, a HC CDR2 having the amino acid sequence of SEQ ID NO: 58, a HC CDR3 having the amino acid sequence of SEQ ID NO: 59, a LC CDR1 having the amino acid sequence of SEQ ID NO: 60, a LC CDR1 having the amino acid sequence of SEQ ID NO: 61, a LC CDR1 having the amino acid sequence of SEQ ID NO: 62;(i) a HC CDR1 having the amino acid sequence of SEQ ID NO: 65, a HC CDR2 having the amino acid sequence of SEQ ID NO: 66, a HC CDR3 having the amino acid sequence of SEQ ID NO: 67, a LC CDR1 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR1 having the amino acid sequence of SEQ ID NO: 70;j) a HC CDR1 having the amino acid sequence of SEQ ID NO: 73, a HC CDR2 having the amino acid sequence of SEQ ID NO: 74, a HC CDR3 having the amino acid sequence of SEQ ID NO: 75, a LC CDR1 having the amino acid sequence of SEQ ID NO: 76, a LC CDR1 having the amino acid sequence of SEQ ID NO: 77, a LC CDR1 having the amino acid sequence of SEQ ID NO: 78;(k) a HC CDR1 having the amino acid sequence of SEQ ID NO: 81, a HC CDR2 having the amino acid sequence of SEQ ID NO: 82, a HC CDR3 having the amino acid sequence of SEQ ID NO: 83, a LC CDR1 having the amino acid sequence of SEQ ID NO: 84, a LC CDR1 having the amino acid sequence of SEQ ID NO: 85, a LC CDR1 having the amino acid sequence of SEQ ID NO: 86;(l) a HC CDR1 having the amino acid sequence of SEQ ID NO: 89, a HC CDR2 having the amino acid sequence of SEQ ID NO: 90, a HC CDR3 having the amino acid sequence of SEQ ID NO: 91, a LC CDR1 having the amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR1 having the amino acid sequence of SEQ ID NO: 94;(m) a HC CDR1 having the amino acid sequence of SEQ ID NO: 97, a HC CDR2 having the amino acid sequence of SEQ ID NO: 98, a HC CDR3 having the amino acid sequence of SEQ ID NO: 99, a LC CDR1 having the amino acid sequence of SEQ ID NO: 100, a LC CDR1 having the amino acid sequence of SEQ ID NO: 101, a LC CDR1 having the amino acid sequence of SEQ ID NO: 102;(n) a HC CDR1 having the amino acid sequence of SEQ ID NO: 105, a HC CDR2 having the amino acid sequence of SEQ ID NO: 106, a HC CDR3 having the amino acid sequence of SEQ ID NO: 107, a LC CDR1 having the amino acid sequence of SEQ ID NO: #14882946v3108, a LC CDR1 having the amino acid sequence of SEQ ID NO: 109, a LC CDR1 having the amino acid sequence of SEQ ID NO: 110;(o) a HC CDR1 having the amino acid sequence of SEQ ID NO: 113, a HC CDR2 having the amino acid sequence of SEQ ID NO: 114, a HC CDR3 having the amino acid sequence of SEQ ID NO: 115, a LC CDR1 having the amino acid sequence of SEQ ID NO: 116, a LC CDR1 having the amino acid sequence of SEQ ID NO: 117, a LC CDR1 having the amino acid sequence of SEQ ID NO: 118;(p) a HC CDR1 having the amino acid sequence of SEQ ID NO: 121, a HC CDR2 having the amino acid sequence of SEQ ID NO: 122, a HC CDR3 having the amino acid sequence of SEQ ID NO: 123, a LC CDR1 having the amino acid sequence of SEQ ID NO: 124, a LC CDR1 having the amino acid sequence of SEQ ID NO: 125, a LC CDR1 having the amino acid sequence of SEQ ID NO: 126;(q) a HC CDR1 having the amino acid sequence of SEQ ID NO: 129, a HC CDR2 having the amino acid sequence of SEQ ID NO: 130, a HC CDR3 having the amino acid sequence of SEQ ID NO: 131, a LC CDR1 having the amino acid sequence of SEQ ID NO: 132, a LC CDR1 having the amino acid sequence of SEQ ID NO: 133, a LC CDR1 having the amino acid sequence of SEQ ID NO: 134;(r) a HC CDR1 having the amino acid sequence of SEQ ID NO: 137, a HC CDR2 having the amino acid sequence of SEQ ID NO: 138, a HC CDR3 having the amino acid sequence of SEQ ID NO: 139, a LC CDR1 having the amino acid sequence of SEQ ID NO: 140, a LC CDR1 having the amino acid sequence of SEQ ID NO: 141, a LC CDR1 having the amino acid sequence of SEQ ID NO: 142;(s) a HC CDR1 having the amino acid sequence of SEQ ID NO: 145, a HC CDR2 having the amino acid sequence of SEQ ID NO: 146, a HC CDR3 having the amino acid sequence of SEQ ID NO: 147, a LC CDR1 having the amino acid sequence of SEQ ID NO: 148, a LC CDR1 having the amino acid sequence of SEQ ID NO: 149, a LC CDR1 having the amino acid sequence of SEQ ID NO: 150; or(t) a HC CDR1 having the amino acid sequence of SEQ ID NO: 153, a HC CDR2 having the amino acid sequence of SEQ ID NO: 154, a HC CDR3 having the amino acid sequence of SEQ ID NO: 155, a LC CDR1 having the amino acid sequence of SEQ ID NO: 156, a LC CDR1 having the amino acid sequence of SEQ ID NO: 157, a LC CDR1 having the amino acid sequence of SEQ ID NO: 158.
3. The antibody or antibody fragment of claim 1 or 2, wherein the antibody comprises: #14882946v3(a) a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8;(b) a VH comprising the amino acid sequence of SEQ ID NO: 15 and a VL comprising the amino acid sequence of SEQ ID NO: 16;(c) a VH comprising the amino acid sequence of SEQ ID NO: 23 and a VL comprising the amino acid sequence of SEQ ID NO: 24;(d) a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO: 32;(e) a VH comprising the amino acid sequence of SEQ ID NO: 39 and a VL comprising the amino acid sequence of SEQ ID NO: 40;(f) a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48;(g) a VH comprising the amino acid sequence of SEQ ID NO: 55 and a VL comprising the amino acid sequence of SEQ ID NO: 56;(h) a VH comprising the amino acid sequence of SEQ ID NO: 63 and a VL comprising the amino acid sequence of SEQ ID NO: 64;(i) a VH comprising the amino acid sequence of SEQ ID NO: 71 and a VL comprising the amino acid sequence of SEQ ID NO: 72;j) a VH comprising the amino acid sequence of SEQ ID NO: 79 and a VL comprising the amino acid sequence of SEQ ID NO: 80;(k) a VH comprising the amino acid sequence of SEQ ID NO: 87 and a VL comprising the amino acid sequence of SEQ ID NO: 88;(l) a VH comprising the amino acid sequence of SEQ ID NO: 95 and a VL comprising the amino acid sequence of SEQ ID NO: 96;(m) a VH comprising the amino acid sequence of SEQ ID NO: 103 and a VL comprising the amino acid sequence of SEQ ID NO: 104;(n) a VH comprising the amino acid sequence of SEQ ID NO: 111 and a VL comprising the amino acid sequence of SEQ ID NO: 112;(o) a VH comprising the amino acid sequence of SEQ ID NO: 119 and a VL comprising the amino acid sequence of SEQ ID NO: 120;(p) a VH comprising the amino acid sequence of SEQ ID NO: 127 and a VL comprising the amino acid sequence of SEQ ID NO: 128;(q) a VH comprising the amino acid sequence of SEQ ID NO: 135 and a VL comprising the amino acid sequence of SEQ ID NO: 136;#14882946v3(r) a VH comprising the amino acid sequence of SEQ ID NO: 143 and a VL comprising the amino acid sequence of SEQ ID NO: 144;(s) a VH comprising the amino acid sequence of SEQ ID NO: 151 and a VL comprising the amino acid sequence of SEQ ID NO: 152; or(t) a VH comprising the amino acid sequence of SEQ ID NO: 159 and a VL comprising the amino acid sequence of SEQ ID NO: 160.
4. An antibody or antibody fragment comprising:a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 of any one of the antibodies listed in Table 1; ora VH and / or VL of any one of the antibodies listed in Table 1.
5. The antibody or antibody fragment of any one of claims 1 to 4, wherein the antibody is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv, optionally wherein the antibody is a full-length IgG comprising a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.
6. The antibody or antibody fragment of any one of claims 1 to 5, wherein the antibody comprises:(a) an HC comprising the amino acid sequence of SEQ ID NO: 161 and an LC comprising the amino acid sequence of SEQ ID NO: 162;(b) an HC comprising the amino acid sequence of SEQ ID NO: 163 and an LC comprising the amino acid sequence of SEQ ID NO: 164;(c) an HC comprising the amino acid sequence of SEQ ID NO: 165 and an LC comprising the amino acid sequence of SEQ ID NO: 166;(d) an HC comprising the amino acid sequence of SEQ ID NO: 167 and an LC comprising the amino acid sequence of SEQ ID NO: 168;(e) an HC comprising the amino acid sequence of SEQ ID NO: 169 and an LC comprising the amino acid sequence of SEQ ID NO: 170;(f) an HC comprising the amino acid sequence of SEQ ID NO: 171 and an LC comprising the amino acid sequence of SEQ ID NO: 172;(g) an HC comprising the amino acid sequence of SEQ ID NO: 173 and an LC comprising the amino acid sequence of SEQ ID NO: 174;(h) an HC comprising the amino acid sequence of SEQ ID NO: 175 and an LC #14882946v3comprising the amino acid sequence of SEQ ID NO: 176;(i) an HC comprising the amino acid sequence of SEQ ID NO: 177 and an LC comprising the amino acid sequence of SEQ ID NO: 178;(j) an HC comprising the amino acid sequence of SEQ ID NO: 179 and an LC comprising the amino acid sequence of SEQ ID NO: 180;(k) an HC comprising the amino acid sequence of SEQ ID NO: 181 and an LC comprising the amino acid sequence of SEQ ID NO: 182;(l) an HC comprising the amino acid sequence of SEQ ID NO: 183 and an LC comprising the amino acid sequence of SEQ ID NO: 184;(m) an HC comprising the amino acid sequence of SEQ ID NO: 185 and an LC comprising the amino acid sequence of SEQ ID NO: 186;(n) an HC comprising the amino acid sequence of SEQ ID NO: 187 and an LC comprising the amino acid sequence of SEQ ID NO: 188;(o) an HC comprising the amino acid sequence of SEQ ID NO: 189 and an LC comprising the amino acid sequence of SEQ ID NO: 190;(p) an HC comprising the amino acid sequence of SEQ ID NO: 191 and an LC comprising the amino acid sequence of SEQ ID NO: 192;(q) an HC comprising the amino acid sequence of SEQ ID NO: 193 and an LC comprising the amino acid sequence of SEQ ID NO: 194;(r) an HC comprising the amino acid sequence of SEQ ID NO: 195 and an LC comprising the amino acid sequence of SEQ ID NO: 196;(s) an HC comprising the amino acid sequence of SEQ ID NO: 197 and an LC comprising the amino acid sequence of SEQ ID NO: 198; or(t) an HC comprising the amino acid sequence of SEQ ID NO: 199 and an LC comprising the amino acid sequence of SEQ ID NO: 200.
7. The antibody or antibody fragment of any one of claims 1 to 6, wherein the antibody reduces an amount of active TGF-P in a subject.
8. The antibody or antibody fragment of any one of claims 1 to 7, wherein the antibody reduces activity of TGF-P in a subject.
9. The antibody or antibody fragment of claim 7 or 8, wherein the TGF-P comprises TGF-P 1, TGF-P2, TGF-P3, or any combination thereof.#14882946v310. The antibody or antibody fragment of any one of claims 1 to 9, wherein the antibody stabilizes the hinge region of LTBP4.
11. An isolated nucleic acid encoding the antibody or antibody fragment of any one of claims 1 to 10.
12. An expression vector comprising the isolated nucleic acid of claim 11.
13. An isolated cell comprising the antibody or antibody fragment of any one of claims 1 to 10, the isolated nucleic acid of claim 11, or the expression vector of claim 12.
14. A composition comprising the antibody or antibody fragment of any one of claims 1 to 10, the isolated nucleic acid of claim 11, the expression vector of claim 12, or the isolated cell of claim 13,optionally wherein the composition further comprises a pharmaceutically acceptable carrier.
15. A method of making the antibody or antibody fragment of any one of claims 1 to 10, the method comprising:(i) culturing the isolated cell of claim 14, under a condition allowing expression of the antibody or antibody fragment by the isolated cell; and(ii) harvesting the antibody or antibody fragment;optionally wherein the method further comprises:(iii) purifying the antibody or antibody fragment.
16. A method of treating a subject having muscular dystrophy, the method comprising administering to the subject an effective amount of the antibody or antibody fragment of any one of claims 1 to 10, the isolated nucleic acid of claim 11, the expression vector of claim 12, the isolated cell of claim 13, or the composition of claim 14,optionally wherein the muscular dystrophy is Duchenne muscular dystrophy or limbgirdle muscular dystrophy.
17. A method of delaying, preventing, or treating fibrosis in a subject in need thereof, the #14882946v3method comprising administering to the subject an effective amount of the antibody or antibody fragment of any one of claims 1 to 10, the isolated nucleic acid of claim 11, the expression vector of claim 12, the isolated cell of claim 13, or the composition of claim 14.
18. A method of reducing activity of transforming growth factor p (TGF-P) in a subject in need thereof, the method comprising administering to the subject an effective amount of the antibody or antibody fragment of any one of claims 1 to 10, the isolated nucleic acid of claim 11, the expression vector of claim 12, the isolated cell of claim 13, or the composition of claim 14 or 15,optionally wherein the subject has or is suspected of having a muscular dystrophy, further optionally wherein the muscular dystrophy is Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), congenital muscular dystrophy, distal muscular dystrophy, Emery-Dreifuss muscular dystrophy, Facioscapulohumeral muscular dystrophy, limb-girdle muscular dystrophy (LGMD), myotonic dystrophy, or oculopharyngeal muscular dystrophy,further optionally wherein the subject has DMD or LGMD.
19. A method of stabilizing the hinge region of LTBP4 in muscle tissue, the method comprising contacting the muscle tissue with the antibody or antibody fragment of any one of claims 1 to 10 or the composition of claim 14 or 15.
20. The method of claim 19, wherein the contacting comprises administering the antibody or antibody fragment or the composition to a subject in need thereof,further optionally wherein the muscular dystrophy is Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), congenital muscular dystrophy, distal muscular dystrophy, Emery-Dreifuss muscular dystrophy, Facioscapulohumeral muscular dystrophy, limb-girdle muscular dystrophy (LGMD), myotonic dystrophy, or oculopharyngeal muscular dystrophy,further optionally wherein the muscular dystrophy is DMD or LGMD.#14882946v3