Methods for treating cancer including a heterobifunctional degrader of BCL6

WO2026183523A1PCT designated stage Publication Date: 2026-09-03TREELINE BIOSCIENCES INC
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
PCT/US2026/017157
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2025-11-05
Filing Date
2026-02-27
Publication Date
2026-09-03

Smart Images

  • Figure IMGF000002_0001
    Figure IMGF000002_0001
  • Figure IMGF000003_0001
    Figure IMGF000003_0001
  • Figure IMGF000011_0001
    Figure IMGF000011_0001
Patent Text Reader

Abstract

This disclosure provides methods for treating cancer and other diseases using anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, or cyclophosphamide and a compound of Formula (A) (e.g., Formula (A-1)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (Ic- 1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-1)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. This disclosure also provides compositions containing the same.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] Docket No. TRLN-013-037WO1 / TLS-077WO Methods for treating cancer including a heterobifunctional degrader of BCL6

[0002] CROSS-REFERENCE TO RELATED APPLICATIONS

[0003] This application claims priority to U. S. Provisional Application Serial Nos. 63 / 765,309, filed February 28, 2025, 63 / 786,899, filed April 10, 2025, 63 / 794,052, filed April 24, 2025, 63 / 823,420, filed June 13, 2025, 63 / 864,000, filed August 14, 2025, and 63 / 912,207, filed November 5, 2025, each of which is incorporated by reference in its entirety herein.

[0004] SEQUENCE LISTING

[0005] This application contains a Sequence Listing that has been submitted electronically as an XML file named “TRLN-013-037W01_Sequence_Listing. XAIL.” The XML file, created on February 25, 2026, is 3 KB in size. The material in the XML file is hereby incorporated by reference in its entirety.

[0006] TECHNICAL FIELD

[0007] This disclosure provides methods for treating cancer using an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, or cyclophosphamide, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (La) (e.g., Formula (La-1), (La-2), (La-3), or (La-4)), Formula (I-b) (e.g., Formula (Lb-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (Ld-1)), or Formula (I-e) (e.g., Formula (Le-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (Il-aa- 5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. This disclosure also provides methods for treating cancer using a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (La-2), (La-3), or (La-4)), Formula (Lb) (e.g., Formula (Lb-1), (Lb-2), (Lb-3), or (Lb-4)), Formula (Lc) (e.g., Formula (Lc-1) or (Lc-2)), Formula (Ld) (e.g., Formula (Ld-1)), or Formula (I-e) (e.g., Formula (Le-1) or (Le-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (ILaa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (ILa) (e.g., Formula (II-a-1), (II-a-2), (ILa-3), (ILa-4), (ILa-5) or (ILa-6)), or Formula (Il-bb) (e.g., Formula (ILbb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as bridging or maintenance therapy. This disclosure also provides compositions containing the same.Docket No. TRLN-013-037WO1 / TLS-077WO

[0008] BACKGROUND

[0009] Cancers such as B-cell lymphomas are treated with a myriad of different agents and strategies based on factors like prior treatment history', patient characteristics, and biology of the disease, and not every patient responds to every treatment. For example, patients with diffuse large B-cell lymphoma (DLBCL) have approximately a 33% relapse / refractory rate with respect to first- line chemotherapy (Wang, Liang, Lin-rong Li, and Ken H. Young. Journal of Hematology & Oncology 13 (2020), doi: 10.1186 / sl3045-020-01011-z). Despite additional therapies available and in development, such as additional chemotherapy regimens, stem cell transplant, CAR-T therapy, and immunotherapy, there remains a need for development of agents to treat such cancers.

[0010] SUMMARY

[0011] Provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0012] (a) a therapeutically effective amount of cyclophosphamide; and

[0013] (b) a therapeutically effective amount of a compound of Formula (A):

[0014]

[0015] or a pharmaceutically acceptable salt thereof,

[0016] wherein X3, m3, R1, R2, R6, LA4a, LA1, LA4b, and Ring C are as defined herein.

[0017] In some embodiments, a compound of Formula (A) is a compound of Formula (A-l)) or Formula (I) (e.g., Formula (LI), Formula (1-2), Formula (La) (e.g., Formula (La-1), (La-2), (I-a-3), or (La-4)), Formula (Lb) (e.g., Formula (Lb-1), (Lb-2), (Lb-3), or (Lb-4)), Formula (Lc) (e.g., Formula (I-c-1) or (Lc-2)), Formula (Ld) (e.g., Formula (Ld-1)), or Formula (Le) (e.g., Formula (Le-1) or (Le-2))), or a pharmaceutically acceptable salt thereof.

[0018] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0019] (a) a therapeutically effective amount of cyclophosphamide; and

[0020] (b) a therapeutically effective amount of a compound of Formula (B):Docket No. TRLN-013-037WO1 / TLS-077WO

[0021] ^R1

[0022]

[0023] Formula (B)

[0024] or a pharmaceutically acceptable salt thereof,

[0025] wherein X3, m3, R1, R6, L, and Ring C are as defined herein.

[0026] In some embodiments, a compound of Formula (B) is a compound of Formula (B-l)), Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (Il-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2)), or a pharmaceutically acceptable salt thereof.

[0027] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-I)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula ( B-l )), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (ll-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with cyclophosphamide.

[0028] Also provided herein are methods for treating a PTCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone); and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-l)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0029] Also provided herein are methods for treating a PTCL in a subject in need thereof, the methods comprising administering to the subject a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone).

[0030] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti -CD 19 therapy or an anti-CD20 therapy; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II- a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof.

[0031] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy.Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of rituximab; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula ( I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula ( I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-I), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0032] Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

[0033] In some embodiments of any of the methods provided herein, the cancer is BCL6 positive (BCL6+) (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or by a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test).

[0034] To facilitate understanding of the disclosure set forth herein, a number of additional terms are provided. Generally, the nomenclature used herein and the laboratory' procedures in organic chemistry, medicinal chemistry, and pharmacology described are those well-known and commonly employed in the art. Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Each of the patents, applications, published applications, and other publications that are mentioned throughout the specification and the attached appendices are incorporated herein by reference in their entireties. In the case of conflict between the present disclosure and any content incorporated by reference, the present disclosure controls.Docket No. TRLN-013-037WO1 / TLS-077WO The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features and advantages of the invention will be apparent from the description and drawings, and from the claims.

[0035] DETAILED DESCRIPTION

[0036] Provided herein are combination therapeutic regimens comprising administration of a compound of Formula (A) or Formula (B), or a pharmaceutically acceptable salt thereof, and an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen), an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen), a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide (e.g., alone or as part of a cyclophosphamidecontaining regimen), or a combination thereof.

[0037] This disclosure provides methods for treating cancer using an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I ) (e.g., Formula (1-1), Formula (1-2), Formula (La) (e.g., Formula (La-1), (La-2), (La-3), or (La-4)), Formula (Lb) (e.g.. Formula (I-b-1), (Lb-2), (I-b-3), or ( I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (Lc-2)), Formula (Ld) (e.g., Formula (Ld-1)), or Formula (I-e) (e.g., Formula (Le-1) or (Le-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (ILaa) (e.g., Formula (ILaa-1), (ILaa-2), (ILaa-3), (ILaa-4), (ILaa- 5), or (ILaa-6)), Formula (ILa) (e.g., Formula (ILa-1), (ILa-2), (II-a-3), (ILa-4), (II-a-5) or (ILa-6)), or Formula (ILbb) (e.g., Formula (II-bb-1) or (ILbb-2))), or a pharmaceutically acceptable salt thereof. This disclosure also provides compositions containing an anti-CD20 therapy, an anti-CDl 9 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (La-1), (La-2), (La-3), or (La-4)), Formula (Lb) (e.g., Formula (I-b-1), (I-b- 2), (Lb-3), or (Lb-4)), Formula (Lc) (e.g., Formula (Lc-1) or (Lc-2)), Formula (Ld) (e.g., Formula (Ld-1)), or Formula (Le) (e.g., Formula (Le-1) or (Le-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (ILaa) (e.g., Formula (ILaa-1), (ILaa-2), (ILaa-3), (ILaa-4), (II-aa-5), or (ILaa-6)), Formula (ILa) (e.g., Formula (ILa-1), (ILa-2), (II-a-3), (ILa-4), (II-a-5) or (ILa-6)), or Formula (ILbb) (e.g., Formula (II-bb-1) or (ILbb-2))), or a pharmaceutically acceptable salt thereof, as provided herein.

[0038] This disclosure also provides methods for treating cancer using an antibody-drug conjugate (e.g., an antibody-drug conjugate targeting CD19 or CD79b) and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I- a) (e.g., Formula (La-1), (La-2), (La-3), or (La-4)), Formula (Lb) (e.g., Formula (I-b-1), (Lb-Docket No. TRLN-013-037WO1 / TLS-077WO 2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula ( II-bb-1 ) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. This disclosure also provides compositions containing an antibody-drug conjugate (e.g., an antibody-drug conjugate targeting CD19 or CD79b) and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as provided herein.

[0039] This disclosure also provides methods for treating cancer using a CDK4 / 6 inhibitor, a BTK inhibitor, an immunomodulatory imide drug (sometimes called IMiDs™), or a combination thereof, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. This disclosure also provides compositions containing a CDK4 / 6 inhibitor and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g.. Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II~bb~2))), or a pharmaceutically acceptable salt thereof, as provided herein.

[0040] B-cell lymphoma 6 (BCL6) protein is a transcriptional repressor involved in the formationDocket No. TRLN-013-037WO1 / TLS-077WO and maintenance of germinal centers (GCs) within lymphoid follicles. It controls the functions of the GC and coordinates the activities of signaling mediators in the maturation of GC B-cell s. There are over 1000 known or putative BCL6 target genes, including MYC, BCL2, genes related to DNA damage response (e.g., ATR, TP53), and cell cycle checkpoint control (e.g., CDKN1A, CDKN1B). BCL6 is expressed in the dark zone cells of GCs, where somatic hypermutation is allowed to occur to generate high-affinity B-cell receptors. Overexpression or loss of control of BCL6, for example by translocation, can permit maintenance of the pro-hypermutation functions and abrogation of the antitumor functions of BCL6.

[0041] Upon antigen challenge, germinal centers (GCs) are formed in lymphoid follicles, and B-cells in the dark zone of GCs undergo rapid proliferation and somatic hypermutation, both of their immunoglobulin variable genes to generate high-affinity B-cell receptors, as well as of other genes including BCL6. BCL6 is often considered to be a ‘master regulator’ of the GC reaction. In some cancers, BCL6 can be mutated, translocated, and / or BCL6 expression can be upregulated. See, e.g., Leeman-Neill and Bhagat, Expert Opinion on Therapeutic Targets 22.2 (2018): 143-152, doi: 10.1080 / 14728222.2018.1420782; Mlynarczyk and Melnick. Immunological Reviews 288.1 (2019): 214-239, doi: 10.1111 / imr.12755.

[0042] The BCL6 protein has multiple domains, including a BTB domain, an RD2 domain, and a DNA binding domain. The N-terminal BTB domain is the site of homodimerization of BCL6, and the interface of the monomers forms the “lateral groove”, which is a binding site for endogenous co-repressors of BCL6, such as SMRT, NCOR, and BCOR. See, e.g., Cardenas, Mariano G., et al. Clinical Cancer Research 23.4 (2017): 885-893, doi: 10.1158 / 1078-0432. CCR-16-2071.

[0043] BCL6 dimers bind to specific gene promoter sequences, forming a pocket that accommodates the BCL6 corepressor (BCOR). Together, these proteins contribute to the formation of polycomb repressive complex 1 (PRC1). PRC1 prevents the expression of cell cycle checkpoint and DNA damage response genes that would otherwise interfere with the somatic hypermutation and cell proliferation processes essential to affinity maturation. See, e.g., Cattoretti, Giorgio, et al. Blood (1995): 45-53, doi: 10.1182 / blood. V86.1,45.bloodjoumal86145; Phan, Ryan T., and Riccardo Dalla-Favera. Nature 432.7017 (2004): 635-639, doi: 10.1038 / nature03147; Phan, Ryan T., et al. Nature Immunology 6.10 (2005): 1054-1060, doi: 10.1038 / ni 1245; Ranuncolo, Stella Maris, et al. Nature Immunology 8.7 (2007): 705-714, doi: 10.1038 / nil478; and Basso, Katia, and Riccardo Dalla-Favera. Immunological Reviews 247.1 (2012): 172-183, doi: 10.1111 / j.1600-065X.2012.01112.x. While affinity maturation is believed to have evolved to fine tune the antibody response to invasive pathogens, simultaneous somatic hypermutation and cell proliferation can be a dangerous scenario for cancer-driving mutations to arise and expand clonally. Aberrant expression of BCL6 due to gene translocations or mutation have been linked toDocket No. TRLN-013-037WO1 / TLS-077WO lymphomagenesis (see, e.g., Ye, Bihui H., et al. Nature Genetics 16.2 (1997): 161-170, doi: 10.1038 / ng0697-161; and Wang X, Li Z, Naganuma A, Ye BH [published correction appears in Proc Natl Acad Sci U S A. 2002 Dec 24;99(26): 17222.]. Proc Natl Acad Sci U S A.

[0044] 2002;99(23):15018-15023. doi: 10.1073 / pnas.232581199). The majority of LBCLs and FLs arise from B cells exiting the germinal center (GC) reaction and therefore depend on BCL6 to maintain their growth and survival (see, e.g., Hatzi, Katerina, and Ari Melnick. Trends in Molecular Medicine 20.6 (2014): 343-352, doi: 10.1016 / j.molmed.2014.03.00I; and Cardenas, Mariano G, et al. The Journal of Clinical Investigation 126.9 (2016): 3351-3362, doi: 10.1172 / JCI85795).

[0045] Compounds that induce degradation of a target protein are sometimes referred to as heterobifunctional compounds, PROTACs, or degraders. Such compounds generally include a moiety that binds to the target protein and a moiety that binds to a ubiquitin E3 ligase (sometimes referred to as an E3 ligase or simply an E3), these two moieties being optionally separated by a linker. To induce degradation, heterobifunctional compounds are believed to induce formation of a ternary complex between the target protein, the compound, and an E3 ligase. Formation of the ternary complex is then followed by ubiquitination of the target protein and degradation of the ubiquitinated target protein by a proteasome. Several E3 ligases have been used as the partner E3 ligase for heterobifunctional degraders. Herein, the cereblon (CRBN) E3 ligase (also referred to herein as a CRBN protein) is used.

[0046] Heterobifunctional compounds are further described in, for example, International Publication Nos. WO 2021 / 077010; WO 2022 / 221673; WO 2023 / 212147; WO 2023 / 240038; WO 2023 / 244917; WO 2023 / 244918; WO 2024 / 151557; WO 2023 / 114460; McCoull, William, et al., ACS Chemical Biology 13.11 (2018): 3131-3141, doi: 10.1021 / acschembio.8b00698; Chamberlain and Hamann, Nature Chemical Biology 15.10 (2019): 937-944, doi: 10.1038 / s41589-019-0362-y; Li and Song, Journal of Hematology & Oncology 13 (2020), doi: 10.1186 / sl3045-020-00885-3; Wu, et al. Nature Structural & Molecular Biology) 27.7 (2020): 605-614, doi: 10.1038 / s41594-020-0438-0; Dong, et al., Journal of Medicinal Chemistry 64.15 (2021): 10606- 10620, doi: 10.1021 / acs.jmedchem.lc00895; Yang, et al., Targeted Oncology 16.1 (2021): 1-12, doi: 10.1007 / sl 1523-020-00782-2.

[0047] Enhancer of zeste homolog 2 (EZH2) is an enzymatic subunit of polycomb repressive complex 2 (PRC2), which functions to methylate lysine 27 of histone H3 (H3K27) to promote transcriptional silencing. Point mutations of EZH2 in the C-terminal SET domain of EZH2 can confer gain of function of enzyme activity, resulting in increased levels of trimethylated H3K27 (H3K27me3) and thus repressed expression of PRC2 targets. These types of mutations have been observed in cancers such as germinal center B-cell (GCB) large B-cell lymphomas (LBCLs) and follicular lymphomas (FLs). In addition, EZH2 is overexpressed in many B-cell lymphomas. See,Docket No. TRLN-013-037WO1 / TLS-077WO e.g., Morschhauser, Franck, et al. Blood Reviews 56 (2022): 100988, doi: 10.1016 / j.blre.2O22.100988.

[0048] As part of the PRC2 complex, EZH2 functions to trimethylate lysine residues, both on histone H3 and non-histone targets, such as GATA4 and STAT3. In normal tissues, EZH2 suppresses differentiation by repressing lineage-specifying factors, and expression of EZH2 is believed to be essential to the maintenance of some cancer stem cell populations. In addition, PRC2-independent functions of EZH2 have been implicated in several disease models, including in castration-resistant prostate cancer and breast cancer. See, e.g., Kim, Kimberly H., and Charles WM Roberts. Nature Medicine 22.2 (2016): 128-134, doi: 10.1038 / nm.4036; Duan, Ran, Wenfang Du, andW eijian Guo. Journal of Hematology’ & Oncology 13.1 (2020), doi: 10.1186 / sl3045-020-00907-0. Although BCL6 and EZH2 are not known to interact directly, they cooperate to recruit a non-canonical PRC1 / BCOR complex that represses differentiation gene expression in GC B-cells, leading to acceleration of B-cell lymphoma development. See, e.g., Beguelin, Wendy, et al. Cancer Cell 30.2 (2016): 197-213, doi: 10.1016 / j.ccell.2016.07.006.

[0049] The genes upregulated by inhibition of EZH2 include genes that promote interactions with T-cells, such as Itgb7, Itga7^ Itga3, Itgb3, Cd86, Cd80, Cd.40. Il4ra, TnfsflO, Tnfsf4, IcosI, Icaml, CxcllO, Ccl5, and Ifi35. In certain models, it has been shown that EZH2 inhibition increases the efficacy of adoptive T-cell immunotherapy (e.g., CAR T) and bispecific T-cell recruiting antibodies. See, e.g., Isshiki, Yusuke, et al. Cancer Cell 43 A (2025): 49-68, doi: 10.1016 / j.ccell.2024.11.006; and Porazzi, Patrizia, et al. Cancer Cell43.3 (2025): 537-551, doi: 10.1016 / j.ccell.2025.01.013.

[0050] Methods of Treatment

[0051] Indications

[0052] Provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CDl 9 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; andDocket No. TRLN-013-037WO1 / TLS-077WO (b) a therapeutically effective amount of a compound of Formula (A):

[0053]

[0054] Formula (A)

[0055] or a pharmaceutically acceptable salt thereof,

[0056] wherein X3, m3, R1, R2, R6, LA4a, LA1, LA4b, and Ring C are as defined herein.

[0057] Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen), a multispecific antibody (e.g., a multispecific T-cell recruiting antibody (e.g., a bispecific T-cell recruiting antibody)) or an antigen binding fragment thereof (e.g., alone or as part of a regimen containing a multispecific antibody (e.g., a multispecific T-cell recruiting antibody (e.g., a bispecific T-cell recruiting antibody)) or an antigen binding fragment thereof), CAR T therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen), or a combination thereof; and

[0058] (b) a therapeutically effective amount of a compound of Formula (B):

[0059] ZR1

[0060]

[0061] Formula (B)

[0062] or a pharmaceutically acceptable salt thereof,

[0063] wherein X3, m3, R1, R6, L, and Ring C are as defined herein.

[0064] Additionally provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD19 therapy, anDocket No. TRLN-013-037WO1 / TLS-077WO antibody-drug conjugate (e.g., an antibody-drug conjugate targeting CD19 or CD79b) or a combination thereof; and

[0065] (b) a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof,

[0066] wherein X3, m3, R1, R2, R6, LA4a, LA1, LA4b, and Ring C are as defined herein.

[0067] Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD19 therapy, an antibody-drug conjugate (e.g., an antibody-drug conjugate targeting CD 19 or CD79b) or a combination thereof; and

[0068] (b) a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof,

[0069] wherein X3, m3, R1, R6, L, and Ring C are as defined herein.

[0070] Additionally provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of a CDK4 / 6 inhibitor, a BTK inhibitor, an immunomodulatory imide drug, or a combination thereof; and

[0071] (b) a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof,

[0072] wherein X3, m3, R1, R2, R6, LA4a, LA1, LA4b, and Ring C are as defined herein.

[0073] Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of a CDK4 / 6 inhibitor, a BTK inhibitor, an immunomodulatory imide drug (e.g., alone or as part of an immunomodulatory imide drug-containing regimen), a combination thereof; and

[0074] (b) a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof,

[0075] wherein X3, m3, R1, R6, L, and Ring C are as defined herein.

[0076] In some embodiments of any of the methods in which a therapeutically effective amount of an anti-CD20 therapy and a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof or with a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof, is administered, the method comprises administering a therapeutically effective amount of an EZH2 inhibitor.

[0077] In some embodiments of any of the methods in which a therapeutically effective amount of a multispecific antibody (e.g., a multispecific T-cell recruiting antibody (e.g., a bispecific T-Docket No. TRLN-013-037WO1 / TLS-077WO cell recruiting antibody)) or an antigen binding fragment thereof and a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof or with a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof, is administered, the method comprises administering a therapeutically effective amount of an EZH2 inhibitor.

[0078] In some embodiments of any of the methods in which a therapeutically effective amount of a BCL-2 inhibitor and a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof or with a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof, is administered, the method comprises administering a therapeutically effective amount of an EZH2 inhibitor.

[0079] In some embodiments of any of the methods in which a therapeutically effective amount of an anti-CD19 therapy and a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof or with a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof, is administered, the method comprises administering a therapeutically effective amount of an EZH2 inhibitor.

[0080] In some embodiments of any of the methods in which a therapeutically effective amount of an antibody-drug conjugate (e.g., an antibody-drug conjugate targeting CD 19 or CD79b) and a therapeutically effective amount of a compound of Formula (A), or a pharmaceutically acceptable salt thereof or with a therapeutically effective amount of a compound of Formula (B), or a pharmaceutically acceptable salt thereof, is administered, the method comprises administering a therapeutically effective amount of an EZH2 inhibitor.

[0081] In some embodiments, the cancer is a hematological malignancy.

[0082] In some embodiments, the hematological malignancy is a lymphoma. In some embodiments, the lymphoma is a non-Hodgkin lymphoma.

[0083] In some embodiments, the non-Hodgkin lymphoma is a B-cell lymphoma. In some embodiments, the B-cell lymphoma is a large B-cell lymphoma (LBCL). For example, the large B-cell lymphoma can be DLBCL-NOS. In some embodiments, the B-cell lymphoma is selected from the group consisting of follicular lymphoma (FL) and transformed FL.

[0084] In some embodiments, the non-Hodgkin lymphoma is a T-cell lymphoma. In some embodiments, the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL). For example, the PTCL can be PTCL-NOS. In some embodiments, the PTCL is a nodal T follicular helper cell lymphoma. For example, the nodal T follicular helper cell lymphoma is selected from the group consisting of AITL (also known as nodal T follicular helper cell lymphoma angioimmunoblastic type; angioimmunoblastic T-cell lymphoma; nodal TFH cell lymphoma angioimmunoblastic; or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cellDocket No. TRLN-013-037WO1 / TLS-077WO lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type; follicular type Tfh cell lymphoma; or nodal Tfh cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma-NOS (also known as follicular helper T-cell lymphoma, NOS; nodal Tfh cell lymphoma, NOS; or Tfh not otherwise specified (NOS)). In some embodiments, the T-cell lymphoma is a CTCL.

[0085] In some embodiments, administering a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is first-line therapy, second-line therapy, or third-line (or beyond) therapy. In some embodiments, the second-line therapy can follow any of the first-line therapies provided herein. In some embodiments, the third-line (or beyond) therapy can follow any of the second-line therapies provided herein.

[0086] In some embodiments, the hematological malignancy (e.g., the lymphoma) is relapsed or refractory.

[0087] As used herein, a cancer that is “relapsed or refractory” (sometimes denoted “r / r”, “R / R”, or “relapsed / refractory”) means that the cancer has returned or progressed after a period of remission or the cancer progressed or did not sufficiently respond to a treatment (e.g., a standard-of-care (SOC) treatment or a treatment that is not a combination of (i) an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and (ii) a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (Il-aa- 5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2)))), or a pharmaceutically acceptable salt thereof. In some embodiments, a cancer that is relapsed or refractory has no satisfactory alternative treatments. InDocket No. TRLN-013-037WO1 / TLS-077WO some embodiments, a cancer that is relapsed or refractory has progressed following one or more prior lines of therapy (e.g., systemic therapy) (e.g., at least two prior lines of therapy; at least three prior lines of therapy; etc.). In some embodiments, a subject that has a cancer that is relapsed or refractory has failed at least one prior line of therapy (e.g., systemic therapy) (e.g., at least two prior lines of therapy; at least three prior lines of therapy; etc.).

[0088] LBCL is the most common large B-cell lymphoma and is also the most aggressive. In the US and Western Europe, LBCL accounts for 30 to 58% of all NHL cases (see, e.g., Tilly, H., et al. Annals of Oncology 26 (2015): vl l6-vl25, doi: 10.1093 / annonc / mdv304). The annual incidence of LBCL in the US is approximately 5.5 per 100,000 persons and the death rate is 1.6 per 100,000 persons (SEER Cancer Stat Facts: Diffuse Large B-Cell Lymphoma. National Cancer Institute. Bethesda, MD. Available at: https: / / seer.cancer.gov / statfacts / html / dlbcl.html).

[0089] First-line therapy for LBCL is typically combination chemotherapy with R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone) or R-CHP (rituximab, cyclophosphamide, doxorubicin, and prednisone) in combination with polatuzumab (see, e.g., Tilly, Herve, et al. New England Journal of Medicine 386.4 (2022): 351-363, doi: 10.1056 / NEJMoa2115304). While these therapies are associated with prolonged remissions and / or cure in >60% of patients, 10 to 15% of patients do not respond and 20 to 25% relapse (see, e.g., Abrisqueta, Pau. Journal of Clinical Medicine 13.7 (2024): 192 / ), doi: 10.3390 / jcml3071929). Patients who are refractory or who relapse have a poor prognosis (see, e.g., Vaidya, R., and T. E. Witzig. Annals of Oncology 25.0 (2014): 2124-2133, doi: 10,1093 / annonc / mdul09). Chimeric antigen receptor (CAR) T-cell therapies are approved for patients who are refractory to first-line chemoimmunotherapy or who relapse within 12 months; survival benefits have been reported (see, e.g., Bhaskar, Shakthi T, et al. Clinical Hematology International 6.4 (2024): 93, doi: 10.46989 / OOlc.124277; and Trabolsi, Asaad, Artavazd Arumov, and Jonathan H. Schatz. Blood Cancer Journal 14.1 (2024): 27, doi: 10.1038 / s41408-024-00997-w). However, disease burden, medical comorbidities, logistical challenges surrounding the production of an autologous product, and specialized supportive care requirements have limited the use of this modality (see, e.g., Hoffmann, Marc S., et al. Transplantation and Cellular Therapy 29.7 (2023): 440-448, doi: 10.1016 / j.jtct.2023.04.003). Bispecific antibodies to CD20 and CD3 are approved for LBCL in the third-line setting and trials are underway to explore their role in earlier lines of therapy (see, e.g., Trabolsi, Asaad, Artavazd Arumov, and Jonathan H. Schatz. Blood Cancer Journal 14.1 (2024): 27, doi: 10.1038 / s41408-024-00997-w).

[0090] Follicular lymphoma (FL) is the second most common non-Hodgkin lymphoma (NHL) with an incidence rate of 2.2 cases per 100,000 persons and a death rate of 0.4 per 100,000 (SEER Cancer Stat Facts: Follicular Lymphoma. National Cancer Institute. Bethesda, MD. Available at:Docket No. TRLN-013-037WO1 / TLS-077WO https: / / seer.cancer.gov / statfacts / html / follicular.html). FL exhibits a wide range of clinical behaviors due to its significant mutational heterogeneity. Asymptomatic patients with low disease burden may be managed through a watch and wait approach. Treatment is typically initiated when patients exhibit constitutional symptoms, evidence of organ compromise, or rapid disease progression. FL is generally considered incurable. Therefore, the typical goal of therapy is a long¬ term remission or durable disease control with well-tolerated treatment regimens. FL can transform into LBCL at an annualized risk of 2 to 3%, an outcome that is associated with diminished survival (see, e.g., Link, Brian K., et al. Journal of Clinical Oncology 31.26 (2013): 3272-3278, doi: 10.1200 / JC0.2012.48.3990; and Montoto, Silvia, and Jude Fitzgibbon. Journal of Clinical Oncology 29 A (290) 1827-1834, doi: 10.1200 / JC0.2010.32.7577).

[0091] Standard first-line therapies for FL include immunotherapy with an anti-CD20 antibody with or without chemotherapy (e.g., bendamustine, CHOP, or CVP [cyclophosphamide, vincristine sulfate, and prednisone]). No single treatment option is considered standard of care in the second-line setting. Options include anti-CD20 antibodies (e.g., rituximab or obinutuzumab) as a single agent or in combination with chemotherapy agents such as bendamustine. Lenalidomide and the radioimmunotherapy 90Y-ibritumomab tiuxetan are also approved for the treatment of R / R FL in the US. In later lines, zanubrutinib, bispecific antibodies, tazemetostat, and CAR-T therapies are approved. As patients progress through successive lines of therapy, they typically exhibit diminishing response rates and shorter disease-free intervals (see, e.g., Link, Brian K., et al. British Journal of Haematology 184.4 (2019): 660-663, doi: 10.1111 / bjh.15149; and Rivas-Delgado, Alfredo, et al. British Journal of Haematology’ 184.5 (2019): 753-759, doi: 10.1111 / bjh.15708).

[0092] In some cases, a FL can undergo a histologic transformation, wherein the neoplastic B-cell clone evolves to acquire the morphologic and phenotypic features of a more aggressive lymphoma, referred to herein as a “transformed FL” (also referred to as “transformed lymphoma from FL” or “tFL”). While in most cases, the transformation is to a LBCL, the transformation can also result in a Burkitt lymphoma, lymphoblastic lymphoma, acute lymphoblastic leukemia, and Hodgkin lymphoma. See, e.g., Fischer, Thais, et al. Annals of Hematology 97.1 (2018): 17-29, doi: 10.1007 / s00277-017-3151-2. Patients presenting with a transformed FL are often treated with a rituximab-chemotherapy combination, such as R-CHOP or pola-R-CHP. See, e.g., Parry, Erin M., and Jessica Okosm. Blood 146.15 (2025): 1812-1823, doi: 10.1182 / blood,2024026016.

[0093] Peripheral T-Cell Lymphoma (PTCL) is a rare and heterogenous subgroup of T-cell NHL comprised of over 2 dozen subtypes (see, e.g., Cai, Zhuo Ran, et al. JAMA Oncology 8.11 (2022): 1690-1692, doi: 10.1001 / jamaoncol.2022.3236; Marchi, Enrica, and Owen Ik. O’Connor. CA: A Cancer Journal for Clinicians 70.1 (2020): 47-70, doi: 10.3322 / caac.21589; Adams, Scott V.,Docket No. TRLN-013-037WO1 / TLS-077WO Polly A. Newcomb, and Andrei R. Shustov. Journal of Clinical Oncology 34.9 (2016): 963-971, doi: 10.1200 / JC0.2015.63.5540; and Teras, Lauren R., et al. CA: A Cancer Journal for Clinicians 66.6 (2016): 443-459, doi: 10.3322 / caac.21357). The T-follicular helper (Tfh) cell lymphomas are subtypes of PTCL and include AITL, follicular type, and Tfh not otherwise specified (NOS) (see, e.g., Feldman, Andrew L., et al. Virchows Archiv 482.1 (2023): 265-279, doi: 10.1007 / s00428-022-03412-6; Ngu, Henry S., and Kerry J. Savage. American Society of Clinical Oncology’ Educational Book 43 (2023): e390334, doi: 10.1200 / EDBK _390334; and Epstein-Peterson, Zachary D., and Steven M. Horwitz. Seminars in Hematology’. Vol. 58. No. 2. WB Saunders, 2021, doi: 10.1053 / j.seminhematol,2021,02.004). AITL is the most common of these with an incidence of 0.05 per 100,000 persons in the US (see, e.g., Federico, Massimo, et al. Journal of Clinical Oncology 31.2 (2013): 240-246, doi: 10.1200 / JC0.2011.37.3647). The prognosis after a PTCL diagnosis remains poor, with a 70% relapse rate after initial therapy and 2- and 5-year overall survival (OS) rates of 45% and 35%, respectively (see, e.g., Maurer, Matthew J., et al. Journal of Clinical Oncology 35.36 (2017): 4019-4026, doi: 10.1200 / JC0.2017.73.8195; Bellei, Monica, et al. Haematologica 103.7 (2018): 1191, doi: 10.3324 / haematol.2017.186577; Horwitz, Steven M., et al. Journal of the National Comprehensive Cancer Network 20.3 (2022): 285-308, doi: 10.6004 / jnccn.2022.0015; Sibon, David. Cancers 14.9 (2022): 2332, doi: 10.3390 / cancersl4092332; and Ngu, Henry S,, and Kerry J. Savage. American Society of Clinical Oncology’ Educational Book 43 (2023): e390334, doi: 10.1200 / EDBK 390334).

[0094] First-line therapy for PTCL typically consists of a combination chemotherapy regimen, such as CHOP, CHOEP (cyclophosphamide, doxorubicin, vincristine, etoposide, and prednisone; also called EPOCH) or other multidrug regimens (see, e.g., Horwitz, Steven M., et al. Journal of the National Comprehensive Cancer Network 20.3 (2022): 285-308, doi: 10.6004 / jnccn.2022.0015). For patients with CD30+ PTCL, brentuximab vedotin in combination with chemotherapy was shown to confer a survival benefit compared to chemotherapy alone (Horwitz S, O'Connor OA, Pro B, et al. [published correction appears in Lancet. 2019 Jan 19;393(10168):228. doi: 10.1016 / SO 140-6736( 18)33123-4]. Lancet. 2019;393(10168):229-240. doi:10.1016 / S0140-6736(18)32984-2). In R / R disease, second-line chemotherapy regimens and hematopoietic stem cell transplantation may also be considered (see, e.g., Du, Jun, et al. JAMA Network Open 4.5 (2021): e219807-e219807, doi: 10.1001 / jamanetworkopen.2021.9807). Other therapies for Tfh PTCL subtypes include belinostat and pralatrexate. However, these agents carry modest response rates (-25%) with durations of response less than one year. National Comprehensive Cancer Network (NCCN) guidelines recommend a clinical trial as the preferred option for R / R T-cell lymphoma (see, e.g., National Comprehensive Cancer Network. NCCNDocket No. TRLN-013-037WO1 / TLS-077WO Guidelines: T-cell lymphomas Version 1.2025. 2025. https: / 7www.nccn. org / professi onal s / phy si ci an_gl s / pdf / t-cell.pdf).

[0095] The World Health Organization (WHO) and the International Consensus Classification (ICC) systems emphasize the identification of the tumor cell of origin (COO) — either germinal center derived B-cells (GCB) or activated B-cell (ABC or non-GCB) - -as central to subclassifying B-cell lymphomas (see, e.g., Alaggio, Rita, et al. Leukemia 36 (2022): 1720-1748, doi: 10.1038 / s41375-022-01620-2; Campo E, Jaffe ES, Cook JR, et al. [published correction appears in Btoot / 2023 Jan 26;141(4):437, doi: 10.1182 / blood.2022019016]. Blood. 2022; 140(11): 1229- 1253, doi. TO.l 182 / blood.2022015851; and Cho, Junhun. Blood Research 57, S1 (2022): 55-61, doi: 10.5045 / br.2022.2022037). COO can be determined through immunohistochemical (IHC) testing.

[0096] Pathologists often rely on diagnostic algorithms that include various IHC markers, such as BCL6, CD20, CD10, BCL2, MUM1 and Ki-67 to diagnose and classify NHLs based on COO (see, e.g., Hans, Christine P, et al. Blood 103.1 (2004): 275-282, doi: 10.1182 / blood-2003-05- 1545; Choi, William WL, et al. Clinical Cancer Research 15.17 (2009): 5494-5502, doi: 10.1158 / 1078-0432. CCR-09-0113; Meyer, Paul N., et al. Journal of Clinical Oncology’ 29.2 (2011): 200-207, 10.1200 / JC0.2010.30.0368; and Santhosh, Akhil, and Ajay Gogia. Cancer Research, Statistics, and Treatment 5.4 (2022): 792-793, doi: 10.4103 / crst.crst_247_22 ). Although molecular typing methods provide an alternative, the LHC-based Hans algorithm is a common workup in clinical practice (see, e.g., Meyer, Paul N., et al. Journal of Clinical Oncology 29.2 (2011): 200-207, 10.1200 / JC0.2010.30.0368; and Abdulla, Maysaa, et al. American Journal of Hematology 95.1 (2020): 57-67, doi: 10.1002 / ajh.25666). Hans defines BCL6 positivity as >30% nuclear staining in tumor cells (see, e.g., Hans, Christine P., et al. Blood 103.1 (2004): 275-282, doi: 10.1182 / blood-2003-05-1545). BCL6 status is also generally part of the diagnostic workup of FL. The ICC recommends BCL6 IHC to help distinguish between FL grade 3a and 3b (see, e.g., Alaggio, Rita, et al. Leukemia 36.7 (2022): 1720-1748, doi: 10.1038 / s41375-022-01620-2; Campo E, Jaffe ES, Cook JR, et al. [published correction appears in Blood. 2023 Jan 26; 141(4):437. doi: 10.1182 / blood.2022019016], Blood. 2022; 140(11): 1229- 1253, doi: 10.1182 / blood.2022015851; and Fenu, Elena M., et al. EJHaem 4.4 (2023): 1176, doi: 10.1002 / jha2.737). NCCN guidelines for B-cell lymphomas and T-cell lymphomas list BCL6 staining by IHC as important to establishing a diagnosis for LBCL and FL. National Comprehensive Cancer Network, (see, e.g., NCCN Guidelines: B-Cell Lymphomas Version 1.2025. 2025. https: / 7www. nccn. org / professionals / physician gls / pdf / b-cell. pdf.).

[0097] Additional details of BCL6 and EZH2 biology and chemistry, as well as discussions of the various cancers described herein, are disclosed in, e.g., Cerchietti, Leandro C., et al. CancerDocket No. TRLN-013-037WO1 / TLS-077WO Cell 17.4 (2010): 400-411, doi: 10.1016 / j.ccr.2009.12.050; Pearce, Andrew C., et al. Journal of Biological Chemistry 297.2 (2021), doi: 10.1016 / j.jbc.2021.100928; Li, Chen, et al. Clinical Epigenetics 13 (2021), doi: 10.1186 / s 13148-021 -01045- 1; Straining, Rachael, and William Eighniy. Journal of the Advanced Practitioner in Oncology 13.2 (2022): 158, doi: 10.6004 / jadpro.2022.13.2.7); Drescher, Charles, et \. Journal of Clinical Oncology (2023): 3094- 3094, doi: 10.1200 / JC0.2023.41.16 suppl.3094; Hong, Huangming, et al. Blood 142 (2023): 304, doi: 10.1182 / blood-2023-l 80372; Izutsu, Koji, et al. Blood 141.10 (2023): 1159-1168, doi: 10.1182 / blood.2022016862; Velichutina, Irina, et al. Blood, The Journal of the American Society of Hematology 116.24 (2010): 5247-5255, doi: 10.1182 / blood-2010-04-280149; and Gaganova M, Carrisi C, Varano G, et al. [published correction appears in J Clin Invest. 2014 Apr 1; 124(4): 1869], J Clin Invest. 2013; 123(12):5009-5022. doi:10.1172 / JCI7062; Baron, Beverly W., et al. Proceedings of the National Academy of Sciences 101.39 (2004): 14198-14203, doi: 10.1073 / pnas.0406138101; Cattoretti, Giorgio, et al. Cancer Cell 7.5 (2005): 445-455, doi: 10.1016 / j.ccr.2005.03.037; Caganova M, Carrisi C, Varano G, et al. [published correction appears in J Clin Invest. 2014 Apr 1;124(4): 1869], J Clin Invest. 2013;123(12):5009-5022. doi:10.1172 / JCI7062; McCabe, Michael T., et al. Nature 492.7427 (2012): 108-112; doi: 10.1038 / naturel l606; Knutson, Sarah K., et al. Nature Chemical Biology 8.11 (2012): 890-896, doi: 10.1038 / nchembio.l084; Campo E, Jaffe ES, Cook JR, et al. [published correction appears in Blood. 2023 Jan 26;141(4):437. doi: 10. H82 / blood.2022019016]. Blood. 2022; 140(11): 1229- 1253, doi: 10.1182 / blood.2022015851; Ondrejka, Sarah L,, et al. Virchows Archiv 483,3 (2023): 349-365, doi: 10.1007 / s00428-023-03607-5); de Leval, Laurence, Philippe Gaulard, and Ahmet Dogan. Blood 144.18 (2024): 1855-1872, doi: 10.1182 / blood.2023021786). NCCN guidelines for T-cell lymphomas also list BCL6 staining by IHC as important to establishing a diagnosis for PTCL (see, e.g., National Comprehensive Cancer Network. NCCN Guidelines: T-cell lymphomas Version 1.2025. 2025. https: / / www.nccn.org / professionals / physician_gls / pdf / t-cell.pdf).; Iqbal, Javeed, et al. Leukemia 21.11 (2007): 2332-2343, doi: 10.1038 / sj. leu.2404856; Shustik, Jesse, et al. Haematologica 95,1 (2009): 96, doi: 10.3324 / haematol.2009.007203; Horn, Heike, et al. Blood, The Journal of the American Society of Hematology 121.12 (2013): 2253-2263, doi: 10.1182 / blood-2012-06-435842; Bellas, Carmen, et al. PloS one 9.6 (2014): e98169, doi: 10.1371 / journal. pone.0098169; Szumera-Cieckiewicz, Anna, et al. International Journal of Laboratory Hematology) 42,4 (2020): 453-463, doi: 10.1111 / ijlh.13222; Alaggio, Rita, et al, Leukemia 6.1 (2022): 1720-1748, doi: I0.1038 / s41375-022-01620-2; Sordi, Benedetta, et al. Blood 144 (2024): 4451, doi: 10.1182 / blood-2024-210657; Van Acker, Anna, et al. Cancer Research 85.8_Supplement_l (2025): 1655-1655, doi: 10.1158 / 1538-7445. AM2025-1655; Morschhauser, F., et al. Hematological Oncology 43 (2025): e91 70093, doi:Docket No. TRLN-013-037WO1 / TLS-077WO 10.1002 / hon.70093_91; Van Acker, A., et al. Hematological Oncology 43 (2025): e806__70096, doi: 10.1002 / hon.70096_806; Van Acker, A., et al. Hematological Oncology 43 (2025): e430_70094, doi: 10.1002 / hon.70094_430.

[0098] Various biomarkers can be used to identify subjects as being in need of the methods provided herein and / or to monitor treatment following administration of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof (e.g., in combination with the anti-CD20 therapy, multispecific T-cell recruiting antibody, CAR T therapy, steroid (e.g., prednisone), BCL-2 inhibitor, cyclophosphamide, or a combination thereof). Such bioniarkers include protein expression levels (e.g., BCL6 expression levels), mutation analysis (e.g., EZH2 mutation and / or clonal hematopoiesis (CH)), DNA, RNA, and expression of BCL6 target genes. Exemplary assays used to identify and quantify these biomarkers include immunohistochemistry (IHC), flow cytometry, NanoString, RNA-seq, ctDNA, phased variant enrichment and detection sequencing (PhasED-seq), clonoSEQ, and next-generation sequencing (NGS). Samples from the subject that can be tested include tumor tissues, peripheral blood, and normal tissues. For example, samples can include lymph node biopsies, blood (e.g., whole blood, isolated plasma, peripheral blood, PBMCs), fmgernails / toenails, saliva, buccal swab, and extracted DNA. In some embodiments, a BCL6 expression level can be determined for a sample from a subject. In some embodiments, a BCL6 expression level can be determined by expression profiling (e.g., mRNA expression profiling) (e.g., of a sample of the cancer or from a blood sample). In some embodiments, a BCL6 expression level can be determined by an mRNA-based test, such as RNA sequencing (RNA-seq), reverse transcription polymerase chain reaction (RT-PCR), digital PCR (dPCR), or in-situ hybridization (ISH).

[0099] As used herein, “determining the BCL6 status,” means assessing whether the cancer is BCL6+, e.g., at the mRNA or protein level. In some embodiments, the assessment includes determining the level of BCL6 expression (e.g., BCL6 expression above or below a threshold value). BCL6 expression status can be assessed by a variety of methods (e.g., measuring protein levels, mRNA levels, or both) and can be assessed quantitatively or qualitatively, e.g., using a scale or threshold value accepted by, e.g., a regulatory' agency or by a pathologist. In someDocket No. TRLN-013-037WO1 / TLS-077WO embodiments, the assessment includes consulting the medical record of a subject (e.g., reviewing or searching (e.g., electronic searching) the medical record of a subject). In some embodiments, the BCL6 expression status is positive (e.g., the sample from the subject is BCL6+). Similarly, “determining that the hematological malignancy (e.g., lymphoma) in the subject is BCL6+” means that the BCL6 status of the hematological malignancy (e.g., lymphoma) is positive for BCL6 expression.

[0100] In some embodiments, a BCL.6 status can be determined for a sample from a subject. In some embodiments, the BCL6 status can be determined by expression profiling (e.g., mRNA expression profiling) (e.g., of a sample of the cancer or from a blood sample). In some embodiments, the BCL6 status can be determined by an mRNA-based test, such as RNA sequencing (RNA-seq), reverse transcription polymerase chain reaction (RT-PCR), digital PCR (dPCR), or in-situ hybridization (ISH). In some embodiments, the BCL6 status can be determined by a protein-based test, such as immunohistochemistry (IHC) or liquid chromatography tandem mass spectrometry (LC-MS / MS)). In some embodiments, the BCL6 status can be determined by an IHC test, using any appropriate IHC method and reagents. In some cases, a diagnosis of a mature B-cell neoplasm (e.g., FL or a large B-cell lymphoma (e.g., DLBCL-NOS)) is made by a pathologist using a diagnostic algorithm that includes IHC markers like BCL6, CD20, CD 10, BCL2, MUM1 and / or Ki -67, such as the Hans algorithm. The Hans algorithm includes BCL.6 as a determinant of germinal center cell of origin and defines BCL6 positivity as 30% or greater nuclear staining in tumor cells by IHC. See, e.g., Hans, Christine P., et al. Blood 103,1 (2004): 275-282, doi: 10.1182 / blood-2003-05-1545 and Choi, William WL, et al. Clinical Cancer Research 15.17 (2009): 5494-5502, doi: 10.1158 / 1078-0432. CCR-09-0113.

[0101] Accordingly, also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising (a) determining the BCL6 status of the cancer (e.g., by performing an assay or a test, or consulting the subject’s medical record); and (b) administering to the subject a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula ( I-d-1)), or Formula (I-e) (e g., Formula ( I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-Docket No. TRLN-013-037WO1 / TLS-077WO bb-2))), or a pharmaceutically acceptable salt thereof. Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising: (a) determining that the cancer in the subject is BCL6+ (e.g., determining that the cancer is BCL6+ by an IHC test); and (b) administering to the subject a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g.. Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula ( II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. In some embodiments, the cancer in the subject has an EZH2 dysregulation. In some embodiments, the cancer in the subject does not have an EZH2 dysregulation.

[0102] Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))), the methods comprising administering to a subject determined to have a cancer that is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1 % in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or by a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test, or determined by consulting the subject’s medical record) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II~bb~2))), or a pharmaceutically acceptable salt thereof.

[0103] In some embodiments, the hematological malignancy (e.g., the lymphoma) is BCL6 positive (also referred to herein as “BCL6+”, “positive for BCL6 expression”, or “BCL6-Docket No. TRLN-013-037WO1 / TLS-077WO expressing”). As used herein, “BCL6+” means that a sample from the subject is BCL6-expressing as determined by an appropriate test. Non-limiting examples of appropriate tests include IHC, mass spectrometry (e.g., liquid chromatography tandem mass spectrometry (LC-MS / MS)), and RNA-seq. The hematological malignancy (e.g., the lymphoma) can be determined to be BCL6+ by an IHC test, and in some embodiments, the IHC test exhibits a percent nuclear positivity score for BCL6 of greater than or equal to 1% (e.g., greater than or equal to 20%, greater than or equal to 25%, greater than or equal to 30%, greater than or equal to 40%, or greater than or equal to 50%) for the hematological malignancy (e.g., the lymphoma).

[0104] For example, “BCL6+” can mean that (1) a sample from the subject has a percent nuclear positivity score for BCL6 of greater than or equal to 1% (e.g., greater than or equal to 5%, greater than or equal to 10%, greater than or equal to 15%, greater than or equal to 20%, greater than or equal to greater than or equal to 25%, greater than or equal to 30%, greater than or equal to 35%, greater than or equal to 40%, greater than or equal to 50%, greater than or equal to 55%, greater than or equal to 60%, greater than or equal to 65%, greater than or equal to 70%, greater than or equal to 75%, greater than or equal to 80%, greater than or equal to 85%, or greater than or equal to 90% (e.g., greater than or equal to 1%, greater than or equal to 20%, greater than or equal to 30%, or greater than or equal to 90%), as determined by an IHC test; and / or (2) a sample from the subject has an H-score for BCL6 of greater than or equal to 3 (e.g., greater than or equal to 5, greater than or equal to 10, greater than or equal to 20, greater than or equal to 30, greater than or equal to 60, greater than or equal to 90, greater than or equal to 100, greater than or equal to 130, greater than or equal to 150, greater than or equal to 160, greater than or equal to 190, greater than or equal to 200, greater than or equal to 230, greater than or equal to 250, or greater than or equal to 270 (e.g., greater than or equal to 1, greater than or equal to 20, greater than or equal to 30, greater than or equal to 230, or greater than or equal to 270). In some embodiments, the test is an FD / Vapproved test.

[0105] In some embodiments, a sample from the subject has a percent nuclear positivity score for BCL6 of 1% to 29% by IHC. In some embodiments, a sample from the subject has a percent nuclear positivity score for BCL6 of 30% to 100% by IHC. For clarity, a percent nuclear positivity score for BCL6 of 1% to 29% by IHC is sometimes referred to by those of skill in the art as “BCL6 negative” or “BCL6 low”, as compared to a percent nuclear positivity score for BCL6 of 30% or greater by IHC that is sometimes referred to as “BCL6 positive” by those of skill in the art (see, e.g., Hans, Christine P., et al. Blood 103.1 (2004): 275-282, doi: 10.1182 / blood-2003-05-I545; and Franco, Renato, et al. Oncotarget 7.37 (2016): 59158, doi: 10.18632 / oncotarget.10993). In some embodiments, a sample from the subject has a percent nuclear positivity score for BCL6 of 0% by IHC.Docket No. TRLN-013-037WO1 / TLS-077WO In some embodiments, the hematological malignancy (e.g., lymphoma) is BCL6 positive (BCL6+). For example, the lymphoma can be BCL6+- as determined by an IHC test. In some embodiments, the IHC test exhibits a percent nuclear positivity score for BCL6 of greater than or equal to 25% (e.g., greater than or equal to 30%) for the hematological malignancy (e.g., the lymphoma). In some embodiments, the hematological malignancy (e.g., the lymphoma) has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the hematological malignancy (e.g., the lymphoma) is BCL6+ (e.g., as determined by an IHC test) and has an EZH2 dysregulation (e.g., an EZH2 mutation).

[0106] As another example, an IHC test can result in a percent nuclear positivity score for BCL6 from 0% to 100%. In some such embodiments, BCL6+ status can be indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% (e.g., greater than or equal to 5%, greater than or equal to 10%, greater than or equal to 15%, or greater than or equal to 20%) (e.g., as determined by a pathologist or an automated system). In some embodiments, BCL6+ status can be indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 30% (e.g., greater than or equal to 35%, greater than or equal to 40%, or greater than or equal to 50%) (e.g., as determined by a pathologist or an automated system). See, e.g., Hans, Christine P., et al. Blood 103.1 (2004): 275-282, doi: 10.1182 / blood-2003-05- 1545. In some embodiments, the sample from the subject can have a BCL.6 percent nuclear positivity score for BCL6 of greater than or equal to 75% (e.g., greater than or equal to 80%, greater than or equal to 90%, or greater than or equal to 95%) (e.g., as determined by a pathologist or an automated system). As another example, an IHC test can result in an H-score from 0 to 300; in some such embodiments, BCL6+ status can be indicated by an H-score of greater than or equal to 10 (e.g., greater than or equal to 50, greater than or equal to 75, greater than or equal to 100, greater than or equal to 150, greater than or equal to 200). In some embodiments, an H-score is calculated as 3 x percentage of strongly staining nuclei + 2 x percentage of moderately staining nuclei + percentage of weakly staining nuclei.

[0107] For example, a pathologist or an automated system (e.g., the BOND RX system (Leica), the BOND-PRIME system (Leica), the AutoStainer Link 48 system (Agilent), the AutoStainer PLUS system (Agilent), the Dako Omnis system (Agilent), the BenchMark ULTRA system (Roche), or the BenchMark ULTRA PLUS system (Roche)) can determine that a sample of the cancer (e.g., a biopsy sample (e.g., a fresh biopsy sample or an archival biopsy sample)) from the subject subjected to IHC with an appropriate BCL6 antibody is BCL6+. In some embodiments, the sample can be an archival biopsy sample (e.g., an archival biopsy sample collected after the last previous line of therapy and prior to the first dose of a compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1 ), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof). Nonlimiting examples of antibodies suitable for an IHC test of BCL6 expression include clone PG-B6p (e.g., Dako / Agilent product number IR625), clone GI191E / A8 (e.g., Roche / Ventana product number 760-4241), clone LN22 (e.g., Leica Biosystems product number PA0204), clone GI191E / A8 (e.g., Sigma / Cell Marque product number 227M-98), and clone EP278 (e.g., Sigma / Cell Marque product number 227R-27). An IHC test can result in a percent nuclear positivity score from 0% to 100%.

[0108] Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))), the methods comprising administering to a subject who has a record (e.g., a medical record) that indicates that the cancer in the subject is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity7score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or by a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (l-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c~2)), Formula (I-d) (e.g., Formula (I-d-l)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (Il-aa- 5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (H-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0109] Also provided herein are methods for treating a cancer (e g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))), the methods comprising administering a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)),Docket No. TRLN-013-037WO1 / TLS-077WO Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to a subject determined to have a cancer that is BCL6+ (e g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or by a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test).

[0110] In some embodiments, provided herein are methods for treating a cancer (e g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject that include performing an assay on a sample (e.g., a tumor sample) obtained from the subject to determine that the cancer in the subject is BCL6+, and administering a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II- aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (H-bb-2))), or a pharmaceutically acceptable salt thereof, to the subject having a cancer determined to be BCL6+.

[0111] In some embodiments, provided herein are methods for treating a cancer (e g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject that include performing an assay on a sample (e.g., a tumor sample) obtained from the subject to determine the BCL6 expression status of the cancer, and administering a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e g.. Formula (A-l)), or Formula (I) (e g.. Formula (1-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa-Docket No. TRLN-013-037WO1 / TLS-077WO 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to the subject.

[0112] In some embodiments of the methods herein, the cancer (e.g., the hematological malignancy (e.g., the lymphoma (e.g., the NHL))) in the subject is BCL6+. In some embodiments, the cancer in the subject has an EZH2 dysregulation. In some embodiments, the cancer in the subject does not have an EZH2 dysregulation.

[0113] In some embodiments, provided herein are methods for treating a relapsed or refractory B-cell lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A ) (e.g., Formula ( A-l )), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g.. Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the relapsed or refractory B-cell lymphoma is selected from the group consisting of: a relapsed or refractory large B-cell lymphoma (LBCL), a relapsed or refractory follicular lymphoma (FL), and a relapsed or refractory transformed FL.

[0114] In some embodiments, provided herein are methods for treating a relapsed or refractory BCL6+ B-cell lymphoma in a subject in need thereof, the methods comprising i) determining that the subject has a relapsed or refractory BCL6+ B-cell lymphoma; and ii) based on i), administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1 ), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.Docket No. TRLN-013-037WO1 / TLS-077WO In some embodiments, provided herein are methods for treating a relapsed or refractory 13-cell lymphoma in a subject in need thereof, the methods comprising i) determining that the subject has a relapsed or refractory B-cell lymphoma having an EZH2 dysregulation; and ii) based on i), administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), ( II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the relapsed or refractory B-cell lymphoma is a relapsed or refractory large B-cell lymphoma (LBCL) or a relapsed or refractory FL.

[0115] In some embodiments, provided herein are methods for treating a relapsed or refractory T- cell lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I- a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0116] In some embodiments, provided herein are methods for treating a relapsed or refractory BCL6+ T-cell lymphoma in a subject in need thereof, the methods comprising i) determining that the subject has a relapsed or refractory BCL6+ T-cell lymphoma; and ii) based on i), administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I- a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0117] In some embodiments, provided herein are methods for treating a relapsed or refractory PTCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1 ), (I-b-2), (I-b-3), or ( I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-e-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (Il-aa- 5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0118] In some embodiments, provided herein are methods for treating a relapsed or refractory BCL6+ PTCL in a subject in need thereof, the methods comprising i) determining that the subject has a relapsed or refractory BCL6+ PTCL; and ii) based on i), administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (Il-aa- 5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0119] In some embodiments, provided herein are methods for treating a CTCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof

[0120] In some embodiments, provided herein are methods for treating a BCL6+ CTCL in a subject in need thereof, the methods comprising i) determining that the subject has a BCL6 + CTCL; and ii) based on i), administering to the subject: (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0121] In some embodiments, the cancer is a LBCL (e.g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with 11 q aberrations, or HGBCL-NOS).

[0122] In some embodiments, the cancer is a transformed indolent B-cell lymphoma (e.g., transformed FL or Richter transformation of CLL).

[0123] In some embodiments, the cancer is follicular lymphoma (FL).

[0124] In some embodiments, the cancer is transformed FL.

[0125] In some embodiments, the cancer is BL.

[0126] In some embodiments, the cancer is nodular lymphocyte predominant Hodgkin lymphoma (NLPHL).

[0127] In some embodiments, the cancer is a peripheral T-cell lymphoma (PTCL) (e.g., anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (also referredDocket No. TRLN-013-037WO1 / TLS-077WO to herein as nodal Tfh cell lymphoma) (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as nodal T follicular helper cell lymphoma angioimmunoblastic type; angioimmunoblastic T-cell lymphoma; nodal Tfh cell lymphoma angioimmunoblastic; or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type; follicular type Tfh cell lymphoma; or nodal Tfh cell lymphoma, follicular type), or nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS; nodal Tfh cell lymphoma, NOS; or Tfh not otherwise specified (NOS)))) or a primary cutaneous T-cell lymphoid proliferation or lymphoma (cutaneous T-cell lymphoma (CTCL)) (e.g., primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, or primary cutaneous gamma-delta T-cell lymphoma).

[0128] In some embodiments, the cancer is BCL6+ as determined by an IHC test (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test).

[0129] In some embodiments, the cancer (e.g., the hematological malignancy (e.g., the lymphoma (e g., the NHL))) in the subject has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the cancer in the subject has wild-type EZH2. In some embodiments, the cancer in the subject does not have an EZH2 dysregulation.

[0130] Also provided herein are methods for treating a hematological malignancy (e.g., a relapsed or refractory hematological malignancy or a lymphoma) in a subject in need thereof, the methods comprising administering to the subject:

[0131] (a) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (Il-a-6)), or Formula (H-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0132] In some embodiments, the hematological malignancy (e.g., the lymphoma) has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the hematological malignancyDocket No. TRLN-013-037WO1 / TLS-077WO (e.g., the lymphoma) is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1 % in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or by a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test) and has an EZH2 dysregulation (e g., an EZH2 mutation).

[0133] In some embodiments, the EZH2 dysregulation comprises an EZH2 mutation. In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof. For example, the EZH2 dysregulation can be an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof. In some embodiments, the EZH2 dysregulation comprises an EZH2 mutation selected from the group consisting of an EZH2 Y646X mutation, an EZH2 A682X mutation, and an EZH2 Y692X mutation. For example, the EZH2 dysregulation comprises an EZH2 mutation selected from the group consisting of an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 A682G mutation, and an EZH2 Y692V mutation.

[0134] In some embodiments, the hematological malignancy (e.g., the lymphoma) in the subject has wild-type EZH2. In some embodiments, the hematological malignancy (e.g., the lymphoma) in the subject does not have an EZH2 dysregulation.

[0135] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula ( I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (H-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 50 mg, 100 mg, 150 mg, 160 mg, 240 mg, 250 mg, 300 mg, and 310 mg. In some embodiments, the dose is administered once a day. In some embodiments, the dose is administered twice per day.

[0136] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) orDocket No. TRLN-013-037WO1 / TLS-077WO (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 nig, 350 mg, or 400 mg (e.g., 25 mg, 50 mg, 75 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg) once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 25 mg, 50 mg, 75 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg) twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula ( B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (I I-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, or 150 mg (e.g., 25 mg, 50 mg, 75 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) once per day. For example, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II- aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) orDocket No. TRLN-013-037WO1 / TLS-077WO (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 130 mg, 140 mg, or 150 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, or 150 mg (e.g., 25 mg, 50 mg, 75 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) twice per day. For example, the compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (I l-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 nig, 80 mg, 90 mg, or 100 mg twice per day.

[0137] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg, 50 mg, 75 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg, 50 mg, 75 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg twice per day.

[0138] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg, 50 mg, 75 mg, 100 mg, or 150 nig once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II- a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg, 50 mg, 75 mg, 100 mg, or 150 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II- aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable saltthereof, is administered at a dose of 25 mg, 50 mg, 75 mg, 100 mg, or 150 mg twice per day.

[0139] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-Docket No. TRLN-013-037WO1 / TLS-077WO 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula ( Il-bb ) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I- a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b- 2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 25 mg twice per day.

[0140] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a- 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b- 4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), orDocket No. TRLN-013-037WO1 / TLS-077WO Formula (I-e) (e.g, Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g, Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g. Formula (I-d-1)), or Formula (I-e) (e.g. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g. Formula (B-l)), or Formula (II) (e.g. Formula (Il-aa) (e.g. Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g. Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg twice per day.

[0141] In some embodiments, the compound of Formula (A) (e.g. Formula (A-l)), or Formula (I) (e.g. Formula (1-1), Formula (1-2), Formula (I-a) (e.g. Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g. Formula (I-d-1)), or Formula (I-e) (e.g. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g. Formula (B-l)), or Formula (II) (e.g. Formula (Il-aa) (e.g. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g. Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g. Formula (A-l)), or Formula (I) (e.g. Formula (1-1), Formula (1-2), Formula (I-a) (e.g. Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g. Formula (I-d-1)), or Formula (I-e) (e.g. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g. Formula (Il-aa) (e.g. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g. Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg once per day. In some embodiments, the compound of Formula (A) (e.g. Formula (A-l)), or Formula (I) (e.g. Formula (1-1), Formula (1-2), Formula (I-a) (e.g. Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g. Formula (I-d-1)), or Formula (I-e) (e.g. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g. Formula (B-l)), or Formula (II) (e.g. Formula (Il-aa) (e.g. Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-Docket No. TRLN-013-037WO1 / TLS-077WO 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg twice per day.

[0142] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I- a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b- 2), (l-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceuti cally acceptable salt thereof, is administered at a dose of 70 mg twice per day.

[0143] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a- 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 75 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 75 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b- 2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 75 mg twice per day.

[0144] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a- 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (I I-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg once per day. In some embodiments,Docket No. TRLN-013-037WO1 / TLS-077WO the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg twice per day.

[0145] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a- 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg once or twice per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (I I-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered with food. For example, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, can be administered within 30 minutes of starting a meal. In some embodiments, administration of any acid reducing agent (e.g., antacids, H2 blockers, and proton pump inhibitors (PPIs)) is stopped at least 1 week prior to the first dose of the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I- a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, through the duration of treatment with the compound of Formula (A) (e g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.Docket No. TRLN-013-037WO1 / TLS-077WO Provided herein are methods for treating a hematological malignancy (e.g., a relapsed or refractory hematological malignancy or a lymphoma) in a subject in need thereof, the methods comprising administering to the subject a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1 ), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0146] In some embodiments, the hematological malignancy is a lymphoma. In some embodiments, the lymphoma is a non-Hodgkin lymphoma.

[0147] In some embodiments, the non-Hodgkin lymphoma is a B-cell lymphoma. In some embodiments, the B-cell lymphoma is a large B-cell lymphoma (LBCL). For example, the large B-cell lymphoma can be DLBCL-NOS. In some embodiments, the B-cell lymphoma is selected from the group consisting of follicular lymphoma (FL) and transformed FL.

[0148] In some embodiments, the non-Hodgkin lymphoma is a T-cell lymphoma. In some embodiments, the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL). For example, the PTCL can be PTCL-NOS, In some embodiments, the PTCL is a nodal T follicular helper cell lymphoma. For example, the nodal T follicular helper cell lymphoma is selected from the group consisting of AITL, nodal T follicular helper cell lymphoma follicular type, and nodal T follicular helper cell lymphoma-NOS. In some embodiments, the T-cell lymphoma is CTCL.

[0149] As used herein a “nodal T follicular helper cell lymphoma” (also referred to as a “Tfh PTCL” or “Tfh lymphoma” or “nodal Tfh cell lymphoma”, where “Tfh” and “TFH” are used interchangeably) is a T-cell lymphoma that is positive for at least two of the following Tfh cell markers by an IHC assay: CD10, BCL6, PD1 (also known as CD279), CXCL13, and ICOS. See, e.g., National Comprehensive Cancer Network. NCCN Guidelines: T-cell lymphomas Version 1.2025. 2025. https: / / www.nccn.org / professionals / physician_gls / pdf / t-cell.pdf.

[0150] In some embodiments, the hematological malignancy (e.g., the lymphoma) is relapsed or refractory.

[0151] In some embodiments, the hematological malignancy (e.g., the lymphoma) has wild-type EZH2. In some embodiments, the hematological malignancy (e.g., the lymphoma) does not have an EZH2 dysregulation.Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject in need thereof, the methods comprising: (a) determining that the cancer in the subject has an EZH2 dysregulation (e.g., an EZH2 mutation); and (b) administering to the subject: (i) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof; and (ii) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), ( II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0152] In some embodiments, the cancer has an EZH2 dysregulation (e.g., an EZH2 mutation). In an aspect of this embodiment, the EZH2 dysregulation is a mutation at residue 27, residue 34, residue 59, residue 141, residue 162, residue 172, residue 197, residue 238, residue 239, residue 246, residue 395, residue 401, residue 452, residue 510, residue 516, residue 556, residue 583, residue 618, residue 644, residue 646, residue 666, residue 682, residue 690, residue 692, residue 716, residue 732, residue 744, residue 745, or a combination thereof, relative to Sl'. Q ID NO. 1. In another aspect of this embodiment, the EZH2 dysregulation is a fusion or translocation. In another aspect of this embodiment, the EZH2 mutation is R27*, R34*, E59*, Q141*, E162*, V172Cfs*ll, E197Rfs*12, E238*, E239*, E246*, G395Efs*29, E401Kfs*22, E401*, Y452*, K510Yfs*3, X516 splice, S556*, R583*, X618 splice, S644*, Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, R690G, R690H, A692V, F716Lfs*24, X732_splice, I744Mfs*25, E745Afs*24, EZH2-AUTS2, EZH2-TMEM176B, GALNT11-EZH2, or a combination thereof.

[0153] In some embodiments, the cancer has an EZH2 mutation at a residue selected from the group consisting of residue 646, residue 666, residue 682, and residue 692 (e.g., an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation). In some embodiments, the cancer has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the cancer is a lymphoma (e.g., FL or a large B-cell lymphoma (e.g., DLBCL-NOS)) and has EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V.Docket No. TRLN-013-037WO1 / TLS-077WO In some embodiments, the cancer has an EZH2 mutation at a residue selected from the group consisting of residue 646, residue 682, and residue 692 (e.g., an EZH2 Y646X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation). In some embodiments, the EZH2 mutation comprises a mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, A682G, and / X692V relative to SEQ ID NO: 1. In some embodiments, the cancer is a lymphoma (e.g., FL or a large B-cell lymphoma (e g., DLBCL-NOS)) and the EZH2 mutation comprises a mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, A682G, and A692V relative to SEQ ID NO: 1.

[0154] In some embodiments, the subject has been identified or diagnosed as having a cancer with an EZH2 dysregulation (e.g., an EZH2 mutation) (e.g., as determined using a regulatory agency-approved, e.g., FDA-approved, assay or kit). In some embodiments, the subject has a tumor that is positive for an EZH2 dysregulation (e.g., an EZH2 mutation) (e.g., as determined using a regulator' agency-approved assay or kit). The subject can be a subject with a tumor(s) that is positive for an EZH2 dysregulation (e.g., an EZH2 mutation) (e.g., identified as positive using a regulatory agency-approved, e.g., FDA-approved, assay or kit). In some embodiments, the subject has a medical record indicating that the subject has a tumor that has an EZH2 dysregulation (e.g., an EZH2 mutation).

[0155] In some embodiments, the subject is treatment naive with respect to the cancer (e.g., the hematological malignancy (e.g., the lymphoma (e.g., the NHL))). In some embodiments, the subject has received one or more lines of therapy for the cancer. In some embodiments, the subject has received two or more lines of therapy for the cancer.

[0156] In some embodiments, the methods provided herein include performing an assay on a sample obtained from the subject to determine whether the subject has an EZH2 dysregulation (e.g., an EZH2 mutation). In some such embodiments, the method includes administering to a subject determined to have an EZH2 dysregulation (e.g., an EZH2 mutation) a therapeutically effective amount of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-I)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula ( B-l )), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-Docket No. TRLN-013-037WO1 / TLS-077WO a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0157] In some embodiments, the methods include determining that the subject has an EZH2 dysregulation (e.g., an EZH2 mutation) via an assay performed on a sample obtained from the subject.

[0158] In some embodiments of any of the methods described herein, the subject’s medical record is used to determine whether the subject has an EZFI2 dysregulation (e.g., an EZH2 mutation). For example, reference is made to the results of an assay performed on a sample obtained from the subject.

[0159] In some embodiments of any of the methods described herein, an assay is used to determine whether the subject has an EZH2 dysregulation (e g., an EZH2 mutation). In some embodiments, the assay can use a sample from a subject and can include, for example, next generation sequencing, immunohistochemistry, fluorescence microscopy, Southern blotting, Western blotting, FACS analysis, Northern blotting, and PCR-based amplification (e.g., RT-PCR or quantitative real-time RT-PCR). The assays are typically performed, e g., with at least one labelled nucleic acid probe or at least one labelled antibody or antigen-binding fragment thereof. Assays can utilize other detection methods known in the art for detecting an EZH2 dysregulation (e.g., an EZI 12 mutation). In some embodiments, the sample is a biological sample or a biopsy sample (e.g., a fresh biopsy sample, or an archival biopsy sample) from the subject.

[0160] In some embodiments, an EZH2 dysregulation (e.g., an EZH2 mutation) can be identified using a liquid biopsy (variously referred to as a fluid biopsy or fluid phase biopsy). See, e.g., Karachaliou, Niki, et al. Annals of Translational Medicine 3.3 (2015), doi: 10.3978 / j.issn.2305- 5839.2015.01.16. Liquid biopsy methods can be used to detect total tumor burden and / or the EZH2 dysregulation (e.g., the EZH2 mutation). In some embodiments, the biological sample can include blood, plasma, urine, cerebrospinal fluid, saliva, sputum, broncho-alveolar lavage, bile, lymphatic fluid, cyst fluid, stool, ascites, and combinations thereof. In some embodiments, a liquid biopsy¬ can be used to detect circulating tumor cells (CTCs). In some embodiments, a liquid biopsy can be used to detect cell-free DNA. In some embodiments, cell-free DNA detected using a liquid biopsy is circulating tumor DNA (ctDNA) that is derived from tumor cells. Analysis of ctDNA (e.g., using sensitive detection techniques such as, without limitation, next-generation sequencing (NGS), traditional PCR, digital PCR, or microarray analysis) can be used to identify an EZI 12 dysregulation (e.g., EZH2 mutation).

[0161] The phrases “EZH2 dysregulation” or ‘‘dysregulation of EZH2” as used herein refer to: (i) a genetic mutation in an EZH2 gene (e.g., a mutation in an EZH2 gene that results in the expression of an EZH2 protein that includes a deletion of at least one amino acid as compared to a wild typeDocket No. TRLN-013-037WO1 / TLS-077WO EZH2 protein, a mutation in an EZH2 gene that results in the expression of an EZH2 protein with one or more point mutations as compared to a wild type EZH2 protein, a mutation in an EZH2 gene that results in the expression of an EZH2 protein with at least one inserted amino acid as compared to a wild type EZH2 protein, a gene amplification (e.g., duplication) that results in an increased level of EZH2 protein in a cell, a mutation in a regulatory sequence (e.g., a promoter and / or enhancer) that results in an increased level of EZH2 protein in a cell, or a partial or full fusion of an EZFI2 gene with another partial or full gene), (ii) an alternative spliced version of an EZH2 mRNA that results in an EZH2 protein having an insertion or a deletion of at least one amino acid in the EZH2 protein as compared to the wild type EZH2 protein, (iii) increased expression (e.g., increased levels) of a wild type EZH2 protein in a mammalian cell due to aberrant cell signaling and / or dysregulated signaling (e.g., as compared to a control non-cancerous cell), or (iv) an epigenetic alteration that results in an increased level of an EZH2 protein in the cell.

[0162] A “dysregulated EZH2 protein” as used herein refers to (i) an EZH2 protein having a mutation (e.g., a deletion of at least one amino acid as compared to a wild type EZH2 protein, one or more point mutations as compared to a wild type EZH2 protein, an insertion of at least one amino acid as compared to a wild type EZH2 protein), (ii) an EZH2 protein resulting from a gene duplication event, e.g., of the gene encoding the EZH2 protein (e.g., the wild type EZH2 protein), thus resulting in an increased level and / or activity of the EZFI2 protein (e.g., the wild type EZH2 protein) in a cell, (iii) an EZH2 protein resulting from a mutation in a regulator ' sequence (e.g., a promoter and / or enhancer) that can also result in an increased level and / or activity of the EZH2 protein (e.g., the wild type EZH2 protein) in a cell), (iv) an EZH2 protein resulting from an alternative spliced version of an EZH2 mRNA that results in an EZH2 protein having an insertion or a deletion of at least one amino acid in the EZH2 protein as compared to the wild type EZH2 protein, or (v) an EZH2 protein resulting from increased expression (e.g., increased levels) of a wild type EZH2 protein in a mammalian cell due to aberrant cell signaling, dysregulated autocrine / paracrine signaling, or epigenetic changes (e.g., as compared to a control non-cancerous cell). In some embodiments, a dysregulated EZH2 protein is a dysregulated human EZH2 protein.

[0163] An exemplary' wild type human EZH2 sequence is shown below. This is one of several isoforms of EZH2, and it will be understood that residue numbering may change based on the reference isoform.

[0164] SEQ ID NO: 1 (UniParc ID UPI000006D77C):

[0165] MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERT EILNQEWKQRRIQPWILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWS PLQQNFMVEDETVLH IP MGDEVLDQDG1TIEELIKNYDGKVHGDRECGFINDE1FVEL VNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDDocket No. TRLN-013-037WO1 / TLS-077WO KGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYD CFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPP KRPGGRRRGRLPNN SSRPS I PTINVLESKDT DSDREAGTETGGENN DKEEEEKKDE TSSS SEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVY EFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHP RQPCDS SCPC VIAQNFCEKFCQC S SECQNRFPGCRCKAQCNTKQCPC YL AVRECDPDLC LTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGE IISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMM VNGDHRIGIF AKRAIQTGEEI, FFD YRYSQADA1 YVGIEREMEIP

[0166] A ‘’mutant EZH2 protein” as used herein refers to an EZH2 protein including a substitution, an insertion, a deletion, a truncation and / or a fusion relative to the wild type human EZH2 sequence shown in SEQ ID NO:1. For example, a mutant human EZH2 protein includes a substitution at any amino acid position (relative to SEQ ID NO: 1).

[0167] The term “wild type” or “wild-type” describes a nucleic acid (e.g., an EZH2 gene or a EZH2 mRNA) or protein (e.g., a EZH2 protein) sequence that is typically found in a subject that does not have a disease or disorder related to the reference nucleic acid or protein. Although a wild type nucleic acid or protein sequence is the sequence that is typically found in a subject that does not have a disease or disorder related to the reference nucleic acid or protein, it is not necessarily the case that a subject that has a disease or disorder related to the reference nucleic acid or protein lacks wild type sequence. For example, a subject with a gene duplication of the reference gene may have the wild type sequence but could still have a disease or disorder related to the reference nucleic acid or protein due to the duplication event. As another example, a subject with a disease or disorder related to the reference nucleic acid or protein may have one allele that encodes wild type protein, and another allele that encodes a mutant protein.

[0168] The term “wild type EZH2” or “wild-type EZH2” describes a EZH2 nucleic acid (e.g., a EZH2 gene or a EZH2 mRNA) or EZH2 protein that is found in a subject that does not have a disease or disorder associated with EZH2 dysregulation, e.g., a cancer having an EZFI2 dysregulation (and optionally also does not have an increased risk of developing a disease or disorder with an EZH2 dysregul ation and / or is not suspected of having a disease or disorder with an EZH2 dysregulation), or is found in a cell or tissue from a subject that does not have a disease or disorder associated with EZH2 dysregulation, e.g., a cancer having an EZH2 dysregulation (and optionally also does not have an increased risk of developing a disease or disorder with an EZH2 dysregulation and / or is not suspected of having a disease or disorder with an EZH2 dysregulation). / Although a wild type EZH2 nucleic acid or protein sequence is the sequence that is typically found in a subject that does not have a disease or disorder associated with an EZH2 dysregulation, it isDocket No. TRLN-013-037WO1 / TLS-077WO not necessarily the case that a subject that has a disease or disorder associated with EZH2 dysregulation lacks the wild type EZII2 sequence. For example, a subject with an EZH2 gene duplication may have the wild type sequence but could still have a disease or disorder associated with an EZH2 dysregulation due to the duplication event. As another example, a subject with a disease or disorder associated with an EZH2 dysregulation may have one allele that encodes wild type EZH2 protein, and another allele that encodes a mutant EZH2 protein.

[0169] An “EZII2 Y646X mutant protein” as used herein refers to an EZII2 protein including substitution of a tyrosine to any other amino acid at the 646thamino acid position relative to SEQ ID NO: 1.

[0170] An “EZH2 Y646C mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to cysteine at the 646thamino acid position relative to SEQ ID NO. 1.

[0171] An “EZH2 Y646F mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to phenylalanine at the 646thamino acid position relative to SEQ ID NO: 1.

[0172] An “EZH2 Y646H mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to histidine at the 646thamino acid position relative to SEQ ID NO: 1.

[0173] An “EZH2 Y646N mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to asparagine at the 646thamino acid position relative to SEQ ID NO: 1.

[0174] An “EZH2 Y646S mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to serine at the 646thamino acid position relative to SEQ ID NO: 1.

[0175] An “EZH2 Y666X mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to any other amino acid at the 666thamino acid position relative to SEQ ID NO: 1.

[0176] An “EZH2 Y666N mutant protein” as used herein refers to an EZH2 protein including substitution of a tyrosine to asparagine at the 666thamino acid position relative to SEQ ID NO: 1.

[0177] An “EZH2 A682X mutant protein” as used herein refers to an EZH2 protein including substitution of an alanine to any other amino acid at the 682ndamino acid position relative to SEQ ID NO: 1.

[0178] An “EZII2 A682G mutant protein” as used herein refers to an EZII2 protein including substitution of an alanine to glycine at the 682ndamino acid position relative to SEQ ID NO: 1.

[0179] An “EZH2 A692X mutant protein” as used herein refers to an EZU2 protein including substitution of an alanine to any other amino acid at the 692ndamino acid position relative to SEQ ID NO: 1.

[0180] An “EZH2 / X692V mutant protein” as used herein refers to an EZH2 protein including substitution of an alanine to valine at the 692ndamino acid position relative to SEQ ID NO: 1.Docket No. TRLN-013-037WO1 / TLS-077WO

[0181] As used herein, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) can include treatment of a primary tumor (i.e., non-metastatic cancer) (e.g., as first, second, third, or later line of therapy, including, but not limited to, the relapsed / refractory setting), treatment of a metastatic (or secondary ) tumor, neoadjuvant therapy (e.g., before treatment with an additional therapy or therapeutic agent, such as surgery, radiation, chemotherapy, or a line of therapy), adjuvant therapy (e.g., following treatment with an additional therapy or therapeutic agent, such as surgery', radiation, chemotherapy, or a line of therapy), maintenance therapy (e.g., treatment following response to an additional therapy or therapeutic agent, such as surgery, radiation, chemotherapy, or a line of therapy), or bridging therapy.

[0182] As used herein, the terms “treat” or “treatment” refer to therapeutic or palliative measures. Beneficial or desired clinical results include, but are not limited to, alleviation, in whole or in part, of symptoms associated with a disease or disorder or condition, diminishment of the extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state (e g., one or more symptoms of the disease), and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment.

[0183] In some embodiments, different phases of a treatment can be distinct. For example, as used herein, a “treatment phase” of a treatment refers to a treatment regimen intended to elicit a response or remission of the disease in the subject. As another example, a “maintenance phase” of a treatment refers to a treatment regimen (sometimes called a “maintenance therapy”) intended to maintain the state of disease achieved in the subject during the treatment phase (e.g., the state of response, remission, or stable disease). In some embodiments, a maintenance phase of a treatment can include one or more of the same therapeutic agents used in the treatment phase. In some such embodiments, a maintenance phase can have fewer therapeutic agents than used in the treatment phase. In some embodiments, a maintenance phase of a treatment can use a lower dose of one or more of the therapeutic agent(s) than used in the treatment phase. In some embodiments, a maintenance phase of a treatment can include one or more different therapeutic agents compared to the therapeutic agent(s) used in the treatment phase. For example, a maintenance phase can include none of the therapeutic agent(s) used in the treatment phase. In some embodiments, the state of the disease achieved in the subject during the treatment phase is a response (e.g., a complete response or a partial response), a remission, or stable disease. As another example, a “bridging phase” of a treatment refers to a treatment regimen (sometimes called a “bridging therapy”) intended to maintain or improve the state of disease achieved in the subject (e.g., during a treatment phase) (e.g., the state of response, remission, or stable disease) until another therapyDocket No. TRLN-013-037WO1 / TLS-077WO (e.g., CAR T therapy) is available. It is understood that some therapies (e.g., CAR T therapy) take time to prepare and / or deliver, and in some cases, a bridging phase is needed. In some embodiments, when a subject is receiving a bridging therapy to a CAR T therapy, the bridging therapy includes leukapheresis. In some embodiments, when a subject is receiving a bridging therapy to a CAR T therapy, the subject receives the CAR T therapy in the treatment phase after the bridging therapy (e.g., the bridging therapy and the CAR T therapy are both part of first-line therapy, the bri dging therapy is part of first-line therapy and the CAR-T therapy is part of second-line therapy, or the bridging therapy and the CAR T therapy are both part of second-line therapy).

[0184] As used herein “remission” refers to the absence of or a significant reduction of disease signs or symptoms. In some embodiments, remission may be determined by the subject’s physician. In some embodiments, remission can be determined by objective criteria, such as by criteria such as RECIST 1.1 or the Lugano 2014 criteria (Cheson, Bruce D., et al. Journal of Clinical Oncology 32.27 (2014): 3059-3067; doi: 10.1200 / JC0.2013.54.8800) or the Global Response Criteria (Olsen, Elise A., et al. Blood, The Journal of the American Society of Hematology’ 140.5 (2022): 419-437; doi: 10.1182 / blood.2021012057).

[0185] As used herein, the terms “prevent” or “prevention” refer to prophylactic measures. Beneficial or desired clinical results include, but are not limited to, the delay, arrest, or preclusion of the onset, recurrence or spread, in whole or in part, of a disease or condition, or a symptom thereof, such as any of those provided herein.

[0186] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include treatment of a primary tumor with a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), ( I-a-2), ( I-a-3 ), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula ( I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, and an anti-CD20 therapy, an anti-CDI9 therapy, a steroid (e.g., prednisone), aBCL-2 inhibitor, cyclophosphamide, or a combination thereof. In some embodiments, the subject is treatment naive with respect to the cancer. In some embodiments, the methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to a subject who is treatment naive with respect to the cancer. In some embodiments, the subject has received one or more lines of therapy for the cancer. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR-modified NK cells)) or antibody-armed cell therapy), or both. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA-EPOCH-R, cell-based therapy, or two or more thereof. In some embodiments, the subject has received a rituximab-containing regimen. In some embodiments, the subject has received an obinutuzumab-containing regimen. In some embodiments, the subject has received a mosunetuzumab-containing regimen. In some embodiments, the subject has received a glofitamab-containing regimen. In some embodiments, the subject has received an epcoritamab -containing regimen. In some embodiments, the methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CDl 9 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-l), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (H-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to a subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD 19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-l), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), ( I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)),Docket No. TRLN-013-037WO1 / TLS-077WO or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-l), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, are to a subject who has received two or more lines of therapy for the cancer.

[0187] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include treatment of a metastatic tumor with an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula ( I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-e) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-l), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof. In some embodiments, the subject is treatment naive with respect to the metastatic tumor. In some embodiments, the subject has received one or more lines of therapy for the metastatic tumor. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR-modified NK cells)) or antibody-armed cell therapy), or both. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA- EPOCH-R, cell-based therapy, or two or more thereof. In some embodiments, the subject has received a rituximab -containing regimen. In some embodiments, the subject has received an obinutuzumab-containing regimen. In some embodiments, the subject has received a mosunetuzumab-containing regimen. In some embodiments, the subject has received a glofitamab-containing regimen. In some embodiments, the subject has received an epcoritamab -containing regimen. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula ( A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) orDocket No. TRLN-013-037WO1 / TLS-077WO (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD 19 therapy, a steroid (e.g., prednisone), aBCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula ( I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l )), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to a subject who has received two or more lines of therapy for the cancer.

[0188] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include administration of an anti-CD20 therapy, an anti-CD 19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as adjuvant therapy. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR-modified NK cells)) or antibody-armed cell therapy), or both. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA-EPOCH- R, cell -based therapy, or two or more thereof. In some embodiments, the subject has received a rituximab-containing regimen. In some embodiments, the subject has received an obinutuzumab-containing regimen. In some embodiments, the subject has received a mosunetuzumab-containing regimen. In some embodiments, the subject has received aDocket No. TRLN-013-037WO1 / TLS-077WO glofitamab-containing regimen. In some embodiments, the subject has received an epcoritamab-containing regimen. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula ( II-bb-1 ) or ( II-bb-2))), or a pharmaceutically acceptable salt thereof as adjuvant therapy to a subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as adjuvant therapy to a subject who has received two or more lines of therapy for the cancer. In some embodiments, the adjuvant therapy follows surgery (e.g., surgical resection, such as partial surgical resection or complete, total, or full surgical resection). In some embodiments, the adjuvant therapy follows radiation therapy. In some embodiments, the adjuvant therapy follows chemotherapy.

[0189] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-e-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) orDocket No. TRLN-013-037WO1 / TLS-077WO (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as maintenance therapy. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR -modified NK cells)) or antibody-armed cell therapy), a stem cell transplant, or a combination thereof in a treatment phase. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA-EPOCH-R, cell¬ based therapy, or two or more thereof in a treatment phase. In some embodiments, the subject has received a rituximab -containing regimen in a treatment phase. In some embodiments, the subject has received an obinutuzumab-containing regimen in a treatment phase. In some embodiments, the subject has received a mosunetuzumab-containing regimen in a treatment phase. In some embodiments, the subject has received an epcoritamab -containing regimen in a treatment phase. In some embodiments, the subject has received a stem cell transplant in a treatment phase. In some embodiments, the subject has received a cell-based therapy (e.g., CAR T therapy) in a treatment phase. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase to a subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of an anti-CD20 therapy, an anti-CD19 therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide, or a combination thereof, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), orDocket No. TRLN-013-037WO1 / TLS-077WO Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase to a subject who has received two or more lines of therapy for the cancer.

[0190] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include administration of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, as maintenance therapy. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR-modified NK cells)) or antibody-armed cell therapy), a stem cell transplant, or a combination thereof in a treatment phase. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA-EPOCH-R, cell-based therapy, or two or more thereof in a treatment phase. In some embodiments, the subject has received a rituximab -containing regimen in a treatment phase. In some embodiments, the subject has received an obinutuzumab -containing regimen in a treatment phase. In some embodiments, the subject has received a mosunetuzumab-containing regimen in a treatment phase. In some embodiments, the subject has received an epcoritamab-containing regimen in a treatment phase. In some embodiments, the subject has received a stem cell transplant in a treatment phase. In some embodiments, the subject has received a cell-based therapy (e g., CAR T therapy) in a treatment phase. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of a compound of Formula (A) (e g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase to a subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject include administration of a compound of Formula (A) (e.g., Formula (A-1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase to a subject who has received two or more lines of therapy for the cancer.

[0191] In some embodiments of any of the methods wherein the subject is administered a compound of Formula (A) (e.g.. Formula (A-1)), or Formula (I) (e.g.. Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (H-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase, the duration of treatment with the compound of Formula (A) (e.g., Formula (A-1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1 ), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase can be, for example 1 month to two years (e.g., 1 month, 2 months, 3 months, 6 months, 1 year, 3 to 6 months, or 6 months to 1 year).

[0192] In some embodiments, methods for treating a cancer (e.g., a hematological malignancy (e.g., a lymphoma (e.g., a NHL))) in a subject can include administration of an anti-CD20 therapy, a multispecific antibody (e.g., a multispecific T-cell recruiting antibody (e.g., a bispecific T-cell recruiting antibody)) or an antigen binding fragment thereof, CAR T therapy, a steroid (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO prednisone), a BCL-2 inhibitor, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a bridging phase. In some embodiments, the subject has received chemotherapy, cell-based therapy (e.g., adoptive cell therapy (e.g., CAR T therapy, cytokine-induced killer cells (CIKs), natural killer cells (e.g., CAR -modified NK cells)) or antibody-armed cell therapy), a stem cell transplant, or a combination thereof, in a treatment phase. In some embodiments, the subject has received R-CHOP, G-CHOP, R-EPOCH, CVP, CVAD, R2, R-CODOX-M, R-IVAC, DA-EPOCH-R, cell¬ based therapy, or two or more thereof, in a treatment phase. In some embodiments, the subject has received a rituximab -containing regimen in a treatment phase. In some embodiments, the subject has received an obinutuzumab-containing regimen in a treatment phase. In some embodiments, the subject has received a mosunetuzumab -containing regimen in a treatment phase. In some embodiments, the subject has received a glofitamab-containing regimen in a treatment phase. In some embodiments, the subject has received an epcoritamab-containing regimen in a treatment phase. In some embodiments, the subject has received a stem cell transplant in a treatment phase. In some embodiments, the subject has received a cell-based therapy (e.g., CAR T therapy) in a treatment phase. In some embodiments, methods for treating a cancer in a subject include administration of an anti-CD20 therapy, a multispecific antibody (e.g., a multispecific T-cell recruiting antibody (e.g., a bispecific T-cell recruiting antibody)) or an antigen binding fragment thereof, CAR T therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, and the Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula ( Il-bb ) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a bridging phase to a subject who has received one or more lines of therapy for the cancer. In some embodiments, methods for treating a cancer in a subject include administration of an anti-CD20 therapy, a multispecific antibody (e.g., a multispecific T-cell recruiting antibodyDocket No. TRLN-013-037WO1 / TLS-077WO (e.g., a bispecific T-cell recruiting antibody)) or an antigen binding fragment thereof, CAR T therapy, a steroid (e.g., prednisone), a BCL-2 inhibitor, and the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a bridging phase to a subject who has received two or more lines of therapy for the cancer.

[0193] In some embodiments of any of the methods wherein a subject has received an anti-CD20 therapy, an anti-CD20 and anti-CD3 bispecific antibody, or a CD20 targeting CAR T therapy, the hematological malignancy (e.g., the lymphoma) is CD20+ prior to being administered a compound of Formula (A) (e g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0194] In some embodiments of any of the methods wherein a subject has received an anti-CD20 therapy, an anti-CD20 and anti-CD3 bispecific antibody, or a CD20 targeting CAR T therapy, the hematological malignancy (e.g., the lymphoma) is not CD20+ prior to being administered a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0195] As used herein, “CD20+” means that a sample from the subject is CD20-expressing as determined by an appropriate test. Non-limiting examples of appropriate tests include flowDocket No. TRLN-013-037WO1 / TLS-077WO cytometry, IHC, mass spectrometry (e.g., liquid chromatography tandem mass spectrometry (LC-MS / MS)), and RNA-seq. The hematological malignancy (e.g., the lymphoma) can be determined to be CD20+ by a flow cytometry assay, and in some embodiments, the assay exhibits greater than or equal to 20% (e.g., greater than or equal to 30%, or greater than or equal to 50%) of the cancer cells (e.g., cancer cells in peripheral blood, or cancer cells from a biopsy) expressing the CD20 antigen. The hematological malignancy (e.g., the lymphoma) can be determined to be CD20+ by an IHC test, and in some embodiments, the IHC test exhibits a percent positivity score for CD20 of greater than or equal to 10% (e.g., greater than or equal to 20%, greater than or equal to 30%, greater than or equal to 40%, or greater than or equal to 50%) for the hematological malignancy (e.g., the lymphoma). The hematological malignancy (e.g., the lymphoma) can be determined to be CD20+ by an IHC test, and in some embodiments, the IHC test is determined to be CD20+ by a pathologist.

[0196] In some embodiments of any of the methods wherein a subject has received an anti-CD19 therapy, an anti-CD19 and anti-CD3 bispecific antibody, or a CD19 targeting CAR T therapy, the hematological malignancy (e.g., the lymphoma) is CD 19+ prior to being administered a compound of Formula (A) (e.g., Formula (A-1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d- 1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0197] In some embodiments of any of the methods wherein a subject has received an anti-CD19 therapy, an anti-CD19 and anti-CD3 bispecific antibody, or a CD19 targeting CAR T therapy, the hematological malignancy (e.g., the lymphoma) is not CD19+ prior to being administered a compound of Formula (A) (e.g.. Formula (A-1)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1 ) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (H-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.Docket No. TRLN-013-037WO1 / TLS-077WO As used herein, “CD19+” means that a sample from the subject is CD19-expressing as determined by an appropriate test. Non-limiting examples of appropriate tests include flow cytometry, IHC, mass spectrometry (e g., liquid chromatography tandem mass spectrometry (LC- MS / MS)), and RNA-seq. The hematological malignancy (e.g., the lymphoma) can be determined to be CD 19+ by a flow cytometry assay, and in some embodiments, the assay exhibits greater than or equal to 20% (e.g., greater than or equal to 30%, or greater than or equal to 50%) of the cancer cells (e.g., cancer cells in peripheral blood, or cancer cells from a biopsy) expressing the CD19 antigen. The hematological malignancy (e.g., the lymphoma) can be determined to be CD 19+ by an IHC test, and in some embodiments, the IHC test exhibits a percent positivity score for CD 19 of greater than or equal to 20% (e.g., greater than or equal to greater than or equal to 30%, greater than or equal to 50%, greater than or equal to 60%, or greater than or equal to 70%) for the hematological malignancy (e.g., the lymphoma). The hematological malignancy (e.g., the lymphoma) can be determined to be CD 19+ by an IHC test, and in some embodiments, the IHC test is determined to be CD19+ by a pathologist.

[0198] As used herein, “monotherapy”, when referring to a compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, means that the compound of Formula (A) (e.g.. Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c~l) or (I-e-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is the only therapeutic agent or therapy (e.g., anticancer agent or therapy) administered to the subject during the treatment cycle (e.g., no additional targeted therapeutics, anti cancer agents, chemotherapeutics, or checkpoint inhibitors are administered to the subject during the treatment cycle). Monotherapy does not exclude the co-administration of medicaments (including, for example, over the counter or prescription medications, vitamins, and / or herbal supplements) for the treatment of side effectsDocket No. TRLN-013-037WO1 / TLS-077WO (e.g., adverse events), concurrent illnesses, or general symptoms associated with the cancer or treatment, such as pain, rash, edema, photosensitivity, pruritus, skin discoloration, hair brittleness, hair loss, brittle nails, cracked nails, discolored nails, swollen cuticles, fatigue, weight loss, general malaise, shortness of breath, infection, anemia, or gastrointestinal symptoms, including nausea, diarrhea, and lack of appetite. These types of medicaments are sometimes referred to as “supportive care” or “supportive therapy”. In some embodiments, transfusion with blood products and / or administration of granulocyte colony-stimulating factor (G-CSF) is considered to be supportive care.

[0199] As used herein, administration of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula ( I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, “in combination with” an additional therapeutic agent(s) means that the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II- aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered in the same line of treatment and the same phase of treatment as the additional therapeutic agent(s). The compound of Formula (A) (e g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula ( Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, can be administered prior to, simultaneously with, or following the administration of the additionalDocket No. TRLN-013-037WO1 / TLS-077WO therapeutic agent(s), on the same or a different dosing schedule, and by the same or different route of administration.

[0200] In some embodiments, when an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen), an anti-CD 19 therapy (e.g., alone or as part of an anti-CD19 therapy¬ containing regimen), a steroid (e.g., prednisone), a BCL-2 inhibitor, cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen), or a combination thereof, and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, are administered to the subject, and this combination is the only therapy (e.g., anticancer agent or therapy) administered to the subject during the treatment cycle (e.g., no additional targeted therapeutics, anticancer agents, chemotherapeutics, or checkpoint inhibitors are administered to the subject during the treatment cycle). Such a combination is referred to herein as a “BCL6 combination therapy”. This combination therapy does not exclude the coadministration of medicaments for the treatment of side effects or general symptoms associated with the cancer or treatment, such as pain, rash, edema, photosensitivity, pruritus, skin discoloration, hair brittleness, hair loss, brittle nails, cracked nails, discolored nails, swollen cuticles, fatigue, weight loss, general malaise, shortness of breath, infection, anemia, or gastrointestinal symptoms, including nausea, diarrhea, and lack of appetite. For example, a subject receiving a “BCL6 combination therapy” of an anti-CD20 therapy and a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g.. Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II- aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, could receive anti-nausea medication, but not, e.g., an anti-PD-1 therapy.

[0201] As used herein, ‘The subject has received one or more lines of therapy for the cancer” or “the subject has previously received one or more lines of therapy for the cancer” means that the subject has been previously administered one or more therapeutic agents or therapies (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO anticancer agent or therapy (e.g., systemic therapies)) for the cancer other than a compound of Formula (A) (e.g., Formula (A-I)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula ( I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula ( I-e-1) or (I-e-2))), or Formula ( B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, during a prior treatment cycle. In some embodiments, at least one of the one or more therapeutic agents or therapies was administered systemically. In some embodiments, the subject cannot tolerate the one or more therapeutic agents or therapies previously administered for the cancer. In some embodiments, the subject did not respond to the one or more therapeutic agents or therapies previously administered for the cancer. In some embodiments, the subject did not adequately respond to one or more therapeutic agents or therapies previously administered for the cancer. In some embodiments, the subject has stopped responding to the one or more therapeutic agents or therapies previously administered for the cancer. In some embodiments, a lack of response, an inadequate response, or a discontinued response can be determined by objective criteria (e.g., tumor volume, or by criteria such as RECIST 1.1, the Lugano 2014 criteria (Cheson, Bruce D., et al. Journal of Clinical Oncology’ 32.27 (2014): 3059-3067; doi: 10.1200 / JCO.2013.54.8800) or the Global Response Criteria (Olsen, Elise A., et al. Blood, The Journal of the American Society of Hematology’ 140.5 (2022): 419-437; doi: 10.1182 / blood.2021012057)). In some embodiments, a lack of response, an inadequate response, or a discontinued response can be determined by the subject’s physician.

[0202] As used herein, “the subject is treatment naive with respect to the cancer”, “the subject is treatment-naive”, or that the subject was “previously untreated” for the cancer means that the subject has not been previously administered one or more therapeutic agents or therapies for the cancer. Treatment of a subject who is treatment naive with respect to the cancer is often referred to as “first-line” therapy.

[0203] For any of the solid tumors described herein, the solid tumors can be primary tumors or metastatic (or secondary) tumors. As used herein, “primary” tumors are those located at the site where the tumor began to grow (i.e., where it originated). As used herein, “metastatic” (or “secondary”) tumors are those that have spread to other parts of body from the original tumor site. In some embodiments, the metastatic or secondary tumors are the same type of cancer as the primary tumor. In some embodiments, the metastatic or secondary tumors are not genetically identical to the primary tumor.Docket No. TRLN-013-037WO1 / TLS-077WO In some embodiments of any of the methods or uses described here, the cancer is a hematological cancer (e.g., lymphoma (e.g., non-Hodgkin lymphoma (e.g., B-cell lymphoid proliferations and lymphomas (eg., mature B-cell neoplasms (also called herein B-cell lymphomas) (e.g., large B-cell lymphoma (e.g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), or primary mediastinal large B-cell lymphoma (primary mediastinal LBCL)), follicular lymphoma (FL), or transformations of indolent B-cell lymphomas (e.g., transformed FL. or Richter transformation of CLL,)))), T-cell and NK-cell lymphoid proliferations and lymphomas (e.g., mature T-cell and NK-cell neoplasms (e.g., primary cutaneous T-cell lymphoid proliferations and lymphomas (cutaneous T-cell lymphoma (CTCL)) (e.g., primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, or Sezary syndrome), or peripheral T-cell lymphoma (PTCL) (e.g., nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), or nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)), or other peripheral T-cell lymphomas (e.g., peripheral T-cell lymphoma NOS)))))).

[0204] In some embodiments, the cancer is a mature B-cell neoplasm (e.g., chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), Burkitt lymphoma (BL), large B-cell lymphoma (e.g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), T-cell / histiocyte-rich large B-cell lymphoma, diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL- MYC / BCL-2)), primary large B-cell lymphoma of immune-privileged sites (primary LBCL of immune-privileged sites), intravascular large B-cell lymphoma (IVLBCL), primary mediastinal large B-cell lymphoma (primary mediastinal LBCL), or high grade B-cell lymphoma NOS (HGBCL-NOS)), follicular lymphoma (FL), mantle cell lymphoma (MCL), marginal zone lymphoma (MZL), or transformations of indolent B-cell lymphomas (e.g., transformed FL or Richter transformation of CLL)), a peripheral T-cell lymphoma (PTCL) (e.g., anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), or nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS))), a primary cutaneous T-cell lymphoid proliferation or lymphomaDocket No. TRLN-013-037WO1 / TLS-077WO (cutaneous T-cell lymphoma (CTCL)) (e.g., primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, or primary cutaneous gamma-delta T-cell lymphoma), nodular lymphocyte predominant Hodgkin lymphoma ( NLPHL), diffuse histiocytic lymphoma (DHL), acute lymphocytic leukemia (ALL), chronic myeloid leukemia (CML), or early T-precursor lymphoblastic leukemia. In some embodiments, the cancer is a mature B-cell neoplasm (e.g., BL, large B-cell lymphoma (e.g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL- MYC / BCL-2)), primary LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with 11 q aberrations, or HGBCL-NOS), FL, MCL, MZL, or transformations of indolent B-cell lymphomas (e g., transformed FL or Richter transformation of CLL)), a peripheral T-cell lymphoma (PTCL) (e.g., anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK -negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), or nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS))), a primary cutaneous T-cell lymphoid proliferation or lymphoma (cutaneous T-cell lymphoma (CTCL)) (e.g., primary' cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary' syndrome, or primary cutaneous gamma-delta T-cell lymphoma), or ALL (e.g., B-ALL). In some embodiments, the cancer is a mature B-cell neoplasm (e.g., a large B-cell lymphoma (e g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with llq aberrations, or HGBCL-NOS), FL, or transformations of indolent B-cell lymphomas (e.g., transformed FL or Richter transformation of CLL)). In some embodiments, the cancer is a mature B-cell neoplasm (e.g., large B-cell lymphoma (e.g., diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary / mediastinal LBCL, HGBCL with l lq aberrations, or HGBCL-NOS), FL, MCL, MZL, or transformations of indolent B-cell lymphomas (e.g., transformed FL or Richter transformation of CLL)), or / ALL (e.g., B-ALL). In some embodiments, the cancer is a peripheral T-cell lymphoma (PTCL) (e.g., anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cellDocket No. TRLN-013-037WO1 / TLS-077WO lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e g,, nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), or nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS))). See, e.g., Leeman-Neill and Bhagat, Expert Opinion on Therapeutic Targets 22.2 (2018): 143-152, doi: 10.1080 / 14728222.2018.1420782; Mlynarczyk and Melnick. Immunological Reviews 288.1 (2019): 214-239, doi: 10.1111 / imr.12755; Kurtz, Christian, et al., Journal of Experimental Medicine 208.11 (2011): 2163-2174, doi: 10.1084 / jem.20110304; Deb, Dhruba, et al. Cancer Research 77.11 (2017): 3070-3081, doi: 10.1158 / 0008-5472. CAN- 15-3052; Cardenas, Mariano G., etal., Clinical Cancer Research 2.4 (2017): 885-893, doi: 10.1158 / 1078-0432. CCR-16-2071; Walker, Sarah R., et al., Oncogene 34.9 (2015): 1073-1082, doi: 10.1038 / onc.2014.61; Alaggio, Rita, et al. Leukemia 36.7 (2022): 1720-1748, doi: 10.1038 / s41375-022-01620-2; Paik, Jin Ho, et al. Human Pathology 131 (2023): 47-60, doi: 10.1016 / j. humpath.2022.12.003; and International Publication Nos. WO 2021 / 080950, WO 2021 / 077010, and WO 2022 / 221673.

[0205] In The 5th edition of the World Health Organization Classification of Haematolymphoid Tumours: Lymphoid Neoplasms, Alaggio and colleagues noted that a group of lymphomas previously known as “diffuse large B-cell lymphomas” (DLBCLs) had been renamed to “large B-cell lymphomas” (LBCLs), as not all diseases in the class had a detectable diffuse growth pattern. See, e.g., Alaggio, Rita, et al. Leukemia 36.7 (2022): 1720-1748, doi: 10.1038 / s41375-022-01620-2. However, in clinical and / or regulatory practice, the term “diffuse large B-cell lymphomas” (DLBCLs) may still be in common use to refer to large B-cell lymphomas, and in some cases, DLBCL-NOS is referred to as “DLBCL”. As used herein, “DLBCL-NOS” is used to refer to the specific subclass, and “large B-cell lymphoma” is used to refer to the class.

[0206] In some embodiments, the cancer is a non-Hodgkin lymphoma (NHL). In some embodiments, the non-Hodgkin lymphoma is a mature B-cell neoplasm. In some embodiments, the mature B-cell neoplasm is a large B-cell lymphoma (LBCL). In some embodiments, the large B-cell lymphoma is DLBCL-NOS. In some embodiments, the mature B-cell neoplasm is FL. In some embodiments, the FL is grade l-3a. In some embodiments, the FL is grade 3b. (sometimes called FLBCL). In some embodiments, the non-Hodgkin lymphoma is a T-cell lymphoma. In some embodiments, the cancer is relapsed or refractory. In some embodiments, the cancer is BCL6+ (e.g., a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test). In some embodiments, the cancer is relapsed or refractory and BCL6+. In some embodiments, theDocket No. TRLN-013-037WO1 / TLS-077WO cancer has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation. In some embodiments, the cancer has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the cancer is BCL6+ and has an EZH2 dysregulation. In some embodiments, the cancer is relapsed or refractory, BCL6+, and has an EZH2 dysregulation. In some embodiments, the cancer has been treated with at least one line of therapy. In some embodiments, the cancer has been treated with at least two lines of therapy.

[0207] In some embodiments, the cancer is a non-Hodgkin lymphoma, for example, any of the non-Hodgkin lymphomas described herein. In some embodiments, the non-Hodgkin lymphoma is relapsed or refractory. In some embodiments, the non-Hodgkin lymphoma is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test). In some embodiments, the non-Hodgkin lymphoma is relapsed or refractory and BCL6+. In some embodiments, the non-Hodgkin lymphoma has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation. In some embodiments, the non-Hodgkin lymphoma has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the non- Hodgkin lymphoma is BCL6+ and has an EZH2 dysregulation. In some embodiments, the non- Hodgkin lymphoma is relapsed or refractory, BCL6+, and has an EZH2 dysregulation. In some embodiments, the non-Hodgkin lymphoma is previously untreated. In some embodiments, the non-Hodgkin lymphoma has been treated with at least one line of therapy. In some embodiments, the non-Hodgkin lymphoma has been treated with at least two lines of therapy.

[0208] Provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d- 1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2) ) ), or Formula ( B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceuticallyDocket No. TRLN-013-037WO1 / TLS-077WO acceptable salt thereof, to the subject. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (l-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) twice per day.

[0209] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0210] (a) a therapeutically effective amount of a compound of Formula (A) (e g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following a treatment phase. In some embodiments, the treatment phase is first- line therapy. In some embodiments, the treatment phase is second-line therapy. In someDocket No. TRLN-013-037WO1 / TLS-077WO embodiments, the treatment phase is cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen) (e.g., first-line cyclophosphamide or second-line cyclophosphamide). In some embodiments, the treatment phase is anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen) (e.g., first-line anti-CD20 therapy or second-line anti-CD20 therapy). In some embodiments, the treatment phase is anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen) (e.g., first-line anti-CD19 therapy or second-line anti-CDI9 therapy). In some embodiments, the method comprises administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) in the maintenance phase. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (Il-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered as a monotherapy in the maintenance phase.

[0211] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0212] (a) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, following a treatment phase in a bridging phase prior to CAR T therapy. In some embodiments, the treatment phase is first-line therapy. In some embodiments, the treatment phase is second-line therapy. In some embodiments, the treatment phase is cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen) (e.g., first-line cyclophosphamide or second-line cyclophosphamide). In some embodiments, the treatment phase is anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen) (e.g., first-line anti-CD20 therapy or second-line anti-CD20 therapy). In some embodiments, the treatment phase is anti-CD19 therapyDocket No. TRLN-013-037WO1 / TLS-077WO (e.g., alone or as part of an anti-CD19 therapy-containing regimen) (e.g., first-line anti-CD19 therapy or second-line anti-CD19 therapy). In some embodiments, the method comprises administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) in the bridging phase. In some embodiments, the compound of Formula (A ) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered as a monotherapy in the bridging phase.

[0213] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0214] (a) a therapeutically effective amount of an anti-CD20 therapy (e g., alone or as part of an anti-CD20 therapy-containing regimen); and

[0215] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the non-Hodgkin lymphoma in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0216] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0217] (a) a therapeutically effective amount of an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen);

[0218] (b) a therapeutically effective amount of a compound of Formula (A) (e g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0219] (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0220] wherein the non-Hodgkin lymphoma in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0221] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0222] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen); and

[0223] (b) a therapeutically effective amount of a compound of Formula (A) (e g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l )), or Formula (II) (e.g.. Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the non-Hodgkin lymphoma in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0224] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0225] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen);

[0226] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0227] (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0228] wherein the non-Hodgkin lymphoma in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0229] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject:

[0230] (a) a therapeutically effective amount of cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen (e.g., CHOP));

[0231] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0232] (c) a therapeutically effective amount of an EZH2 inhibitor (e g., any of the EZH2 inhibitors provided herein),

[0233] wherein the non-Hodgkin lymphoma in the subject is previously untreated. In some such embodiments, the non-Hodgkin lymphoma is non-CD30+.

[0234] Also provided herein are methods for treating a non-Hodgkin lymphoma in a geriatric subject in need thereof, the methods comprising administering to the subject:

[0235] (a) a therapeutically effective amount of (i) mini-R-CHOP or (ii) mini-G-CHOP; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the non-Hodgkin lymphoma in the geriatric subject is previously untreated.Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of cyclophosphamide; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1 ), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0236] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of cyclophosphamide.

[0237] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-e-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, and the cyclophosphamide are administered in a treatment phase. In some such embodiments, the methods comprise administering a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I- c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) orDocket No. TRLN-013-037WO1 / TLS-077WO (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following the treatment phase. In some embodiments, the methods further comprise administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) (e.g., in the treatment phase and / or the maintenance phase). In some embodiments, the cyclophosphamide is administered as part of a cyclophosphamidecontaining regimen.

[0238] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone); and (b ) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula ( I-a-1 ), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or ( I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0239] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l )), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP.

[0240] Different dosing regimens of CHOP have been used in the clinical setting and the choice of dosing regimen may differ between indications. One example of a CHOP dosing regimen is: 6 to 821-day cycles of cyclophosphamide 750 mg / m2, doxorubicin 50 mg / m², vincristine 1.4 mg / m2, and prednisone 100 mg on days 1-5, for, e.g., PTCL (see, e.g., ECHELON-2 (NCT01777152);Docket No. TRLN-013-037WO1 / TLS-077WO POLARIX (NCT03274492; Tilly, Herve, et al. New England Journal of Medicine 386.4 (2022): 351-363, doi: 10.1056 / NEJMoa2115304). Both the length of cycles (e.g., 14-day cycles) and the number of cycles (e.g., 4 to 6 cycles) can be independently altered. When rituximab is added to CHOP, it can be dosed, for example, at 375 mg / m2(see, e.g., Tilly, Herve, et al. New England Journal of Medicine 386.4 (2022): 351-363, doi: 10.1056 / NEJMoa2115304).

[0241] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, and the CHOP are administered in a treatment phase. In some such embodiments, the methods comprise administering to the subject a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following the treatment phase. In some embodiments, the methods further comprise administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) (e.g., in the treatment phase and / or the maintenance phase).

[0242] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-Docket No. TRLN-013-037WO1 / TLS-077WO a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0243] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula ( 1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CD 19 therapy or an anti-CD20 therapy.

[0244] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, and the anti-CD 19 therapy or the anti-CD20 therapy are administered in a treatment phase. In some such embodiments, the methods comprise administering to the subject a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, optionally in combination with a therapeutically effective amount of an anti-CD 19 therapy or an anti-CD20 therapy, in a maintenance phase following the treatment phase. In some embodiments, the methods further comprise administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) (e.g., in the treatment phase and / or the maintenance phase). In some embodiments, the anti-CD 19 therapyDocket No. TRLN-013-037WO1 / TLS-077WO or the anti-CD20 therapy is administered as part of a regimen containing an anti-CD19 therapy or an anti-CD20 therapy.

[0245] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of rituximab; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0246] Also provided herein are methods for treating a non-Hodgkin lymphoma in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II- a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

[0247] In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, and the rituximab are administered in a treatment phase. In some such embodiments, the methods comprise administering to the subject a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-Docket No. TRLN-013-037WO1 / TLS-077WO 4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, optionally in combination with a therapeutically effective amount of rituximab, in a maintenance phase following the treatment phase. In some embodiments, the methods further comprise administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) (e.g., in the treatment phase and / or the maintenance phase). In some embodiments, the rituximab is administered as part of a regimen containing rituximab.

[0248] In some embodiments, the cancer is a mature B-cell neoplasm, for example, any of the mature B-cell neoplasms described herein. In some embodiments, the mature B-cell neoplasm is relapsed or refractory. In some embodiments, the mature B-cell neoplasm is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test). In some embodiments, the mature B-cell neoplasm is relapsed or refractory and BCL6+. In some embodiments, the mature B-cell neoplasm has an EZH2 dysregulation (e g., an EZH2 mutation). In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation. In some embodiments, the mature B-cell neoplasm has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the mature B-cell neoplasm is BCL6+ and has an EZH2 dysregulation. In some embodiments, the mature B-cell neoplasm is relapsed or refractory, BCL6+, and has an EZH2 dysregulation. In some embodiments, the mature B-cell neoplasm is previously untreated. In some embodiments, the mature B-cell neoplasm has been treated with at least one line of therapy. In some embodiments, the mature B-cell neoplasm has been treated with at least two lines of therapy.

[0249] Provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to the subject. In some embodiments, the compound of Formula (A) (e.g., Formula (A-1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I- a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b- 2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d- 1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) twice per day.

[0250] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject:

[0251] (a) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula ( I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb)Docket No. TRLN-013-037WO1 / TLS-077WO (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following a treatment phase. In some embodiments, the treatment phase i s first-line therapy. In some embodiments, the treatment phase is second-line therapy. In some embodiments, the treatment phase is cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen) (e.g., first-line cyclophosphamide or second-line cyclophosphamide). In some embodiments, the maintenance phase follows anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen) (e.g., first-line anti-CD20 therapy or second-line anti-CD20 therapy). In some embodiments, the maintenance phase follows anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen) (e.g., first-line anti-CDl 9 therapy or second-line anti-CDl 9 therapy). In some embodiments, the method comprises administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) in the maintenance phase. In some embodiments, the compound of Formula (A) (e g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1 ), (I-a-2), (I-a-3), or ( I-a-4) ), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, is administered as a monotherapy in the maintenance phase.

[0252] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject:

[0253] (a) a therapeutically effective amount of an anti-CD20 therapy (e g., alone or as part of an anti-CD20 therapy-containing regimen); and

[0254] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof,Docket No. TRLN-013-037WO1 / TLS-077WO wherein the mature B-cell neoplasm in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0255] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject:

[0256] (a) a therapeutically effective amount of an anti-CD20 therapy (e g., alone or as part of an anti-CD20 therapy-containing regimen);

[0257] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1 ) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (H-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0258] wherein the mature B-cell neoplasm in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0259] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject:

[0260] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen); and

[0261] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (H-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the mature B-cell neoplasm in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject:

[0262] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen);

[0263] (b) a therapeutically effective amount of a compound of Formula (A) (e g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l )), or Formula (II) (e.g.. Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or ( II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0264] (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0265] wherein the mature B-cell neoplasm in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0266] Also provided herein are methods for treating a mature B-cell neoplasm in a geriatric subject in need thereof, the methods comprising administering to the subject:

[0267] (a) a therapeutically effective amount of (i) mini-R-CHOP or (ii) mini-G-CHOP; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the mature B-cell neoplasm in the geriatric subject is previously untreated.

[0268] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of cyclophosphamide; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b- 2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0269] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l )), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II- a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of cyclophosphamide.

[0270] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone); and (b) a therapeutically effective amount of a compound of Formula (A) (e.g.. Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0271] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-Docket No. TRLN-013-037WO1 / TLS-077WO a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP.

[0272] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1 ), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g.. Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0273] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy.

[0274] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of rituximab; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g.. Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (I l-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) orDocket No. TRLN-013-037WO1 / TLS-077WO (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0275] Also provided herein are methods for treating a mature B-cell neoplasm in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula ( A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II- bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

[0276] In some embodiments, the cancer is a large B-cell lymphoma (LBCL), for example, any of the large B-cell lymphomas described herein. In some embodiments, the large B-cell lymphoma (LBCL) is relapsed or refractory. In some embodiments, the large B-cell lymphoma is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test). In some embodiments, the large B-cell lymphoma (LBCL) is relapsed or refractory and BCL6+. In some embodiments, the large B-cell lymphoma (LBCL) has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation. In some embodiments, the large B-cell lymphoma (LBCL) has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the large B-cell lymphoma (LBCL) is BCL6+ and has an EZH2 dysregulation. In some embodiments, the large B-cell lymphoma (LBCL) is relapsed or refractory, BCL6+, and has an EZH2 dysregulation. In some embodiments, the large B-cell lymphoma (LBCL) has been treated with at least one line of therapy. In some embodiments, the large B-cell lymphoma (LBCL) is previously untreated. In some embodiments, the large B-cell lymphoma (LBCL) has been treated with at least two lines of therapy.

[0277] Also provided herein are methods for treating a large B-cell lymphoma in a subject in need thereof, the methods comprising administering a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g.. Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to the subject. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 nig, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (Il-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) twice per day.

[0278] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject:

[0279] (a) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g.,Docket No. TRLN-013-037WO1 / TLS-077WO Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following a treatment phase. In some embodiments, the treatment phase is first- line therapy. In some embodiments, the treatment phase is second-line therapy. In some embodiments, the treatment phase is cyclophosphamide (e g., alone or as part of a cyclophosphamide-containing regimen) (e.g., first-line cyclophosphamide or second-line cyclophosphamide). In some embodiments, the treatment phase is anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen) (e.g., first-line anti-CD20 therapy or second-line anti-CD20 therapy). In some embodiments, the treatment phase is anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen) (e.g., first-line anti-CD19 therapy or second-line anti-CD20 therapy). In some embodiments, the method comprises administering to the subject a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein) in the maintenance phase. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II- a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered as a monotherapy in the maintenance phase.

[0280] Also provided herein are methods for treating a LBCL in a geriatric subject in need thereof, the methods comprising administering to the subject:

[0281] (a) a therapeutically effective amount of (i) mini-R-CHOP or (ii) mini-G-CHOP; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof,Docket No. TRLN-013-037WO1 / TLS-077WO wherein the LBCL in the geriatric subject is previously untreated.

[0282] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of cyclophosphamide; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1 )), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0283] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of cyclophosphamide.

[0284] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone); and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g.. Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g.. Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4 )), Formula (I-c) (e.g., Formula (I-c-1) or ( I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP

[0285] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy; and (b) a therapeutically effective amount of a compound of Formula (A) (e g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (H-aa- 4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II- a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0286] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-1), Formula (I-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1 ), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II- a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy.

[0287] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: (a) a therapeutically effective amount ofDocket No. TRLN-013-037WO1 / TLS-077WO rituximab; and (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I- a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof.

[0288] Also provided herein are methods for treating a LBCL in a subject in need thereof, the methods comprising administering to the subject: a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (I-I), Formula (I- 2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g.. Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (Il-aa- 3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II- a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

[0289] In some embodiments, the cancer is a FL. In some embodiments, the FL is grade l-3a. In some embodiments, the FL is grade 3b (sometimes called follicular large B-cell lymphoma (FLBCL)). In some embodiments, the FL is relapsed or refractory. In some embodiments, the FL is BCL6+ (e.g., indicated by a percent nuclear positivity score for BCL6 of greater than or equal to 1% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 20% in an IHC test, by a percent nuclear positivity score for BCL6 of greater than or equal to 25% in an IHC test, or a percent nuclear positivity score for BCL6 of greater than or equal to 30% in an IHC test)). In some embodiments, the FL is relapsed or refractory and BCL6+ In some embodiments, the FL has an EZH2 dysregulation (e.g., an EZH2 mutation). In some embodiments, the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, or an EZH2 A692X mutation. In some embodiments, the FL has an EZH2 mutation selected from the group consisting of Y646C, Y646F, Y646H, Y646N, Y646S, Y666N, A682G, and A692V. In some embodiments, the FL is BCL6+ and has an EZH2 dysregul tion. In some embodiments, the FL is relapsed or refractory, BCL6+, and has an EZH2 dysregulation. In some embodiments, the FL is previously untreated. In some embodiments, the FL has been treatedDocket No. TRLN-013-037WO1 / TLS-077WO with at least one line of therapy. In some embodiments, the FL has been treated with at least two lines of therapy.

[0290] Provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, to the subject. In some embodiments, the compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4 )), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) once per day. In some embodiments, the compound of Formula (A) (e.g., Formula (A-l)), or Formula (I) (e g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a-2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g.. Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (Il-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, is administered at a dose of 10 mg, 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, or 400 mg (e.g., 20 mg, 25 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 125 mg, 130 mg, 140 mg, or 150 mg) twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject:

[0291] (a) a therapeutically effective amount of an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen); and

[0292] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l )), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or ( II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the FL in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0293] Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject:

[0294] (a) a therapeutically effective amount of an anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen);

[0295] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0296] (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0297] wherein the FL in the subject is previously untreated. In some such embodiments, CHOP is not appropriate for the subject (e.g., per the subject’s physician).

[0298] Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject:

[0299] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen); andDocket No. TRLN-013-037WO1 / TLS-077WO (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g.. Formula (Il-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (H-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, wherein the FL in the subject is previously untreated. In some such embodiments, a cyclophosphamide-containing regimen (e.g., CHOP or R-CHOP) is not appropriate for the subject (e.g., per the subject’s physician).

[0300] Also provided herein are methods for treating a FL in a subject in need thereof, the methods comprising administering to the subject:

[0301] (a) a therapeutically effective amount of an anti-CD19 therapy (e.g., alone or as part of an anti-CD19 therapy-containing regimen);

[0302] (b) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (II-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), Formula (II-a) (e g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (II-bb) (e.g.. Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof; and

[0303] (c) a therapeutically effective amount of an EZH2 inhibitor (e.g., any of the EZH2 inhibitors provided herein),

[0304] wherein the FL in the subject is previously untreated. In some such embodiments, CHOP is not appropriate for the subject (e.g., per the subject’s physician).

[0305] Also provided herein are methods for treating a FL in a subject in need thereof the methods comprising administering to the subject:

[0306] (a) a therapeutically effective amount of a compound of Formula (A) (e.g., Formula (A- 1)), or Formula (I) (e.g., Formula (1-1), Formula (1-2), Formula (I-a) (e.g., Formula (I-a-1), (I-a- 2), (I-a-3), or (I-a-4)), Formula (I-b) (e.g., Formula (I-b-1), (I-b-2), (I-b-3), or (I-b-4)), Formula (I-c) (e.g., Formula (I-c-1) or (I-c-2)), Formula (I-d) (e.g., Formula (I-d-1)), or Formula (I-e) (e.g., Formula (I-e-1) or (I-e-2))), or Formula (B) (e.g., Formula (B-l)), or Formula (II) (e.g., Formula (H-aa) (e.g., Formula (II-aa-1), (II-aa-2), (II-aa-3), (II-aa-4), (II-aa-5), or (II-aa-6)), FormulaDocket No. TRLN-013-037WO1 / TLS-077WO (II-a) (e.g., Formula (II-a-1), (II-a-2), (II-a-3), (II-a-4), (II-a-5) or (II-a-6)), or Formula (Il-bb) (e.g., Formula (II-bb-1) or (II-bb-2))), or a pharmaceutically acceptable salt thereof, in a maintenance phase following a treatment phase. In some embodiments, the treatment phase is first- line therapy. In some embodiments, the treatment phase is second-line therapy. In some embodiments, the treatment phase is cyclophosphamide (e.g., alone or as part of a cyclophosphamide-containing regimen) (e.g., first-line cyclophosphamide or second-line cyclophosphamide). In some embodiments, the treatment phase is anti-CD20 therapy (e.g., alone or as part of an anti-CD20 therapy-containing regimen) (e.g., first-line anti-C...

Claims

Docket No. TRLN-013-037WO1 / TLS-077WO WHAT IS CLAIMED IS:

1. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of cyclophosphamide; and(b) a therapeutically effective amount of Compound 202b:or a pharmaceutically acceptable salt thereof.

2. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 202b:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of cyclophosphamide.

3. The method of claim 1 or 2, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

4. The method of claim 1 or 2, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the cyclophosphamide, are administered in a treatment phase.

5. The method of claim 4, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.Docket No. TRLN-013-037WO1 / TLS-077WO 6. The method of claim 1 or 2, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the cyclophosphamide, are administered in a maintenance phase.

7. The method of claim 6, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

8. The method of any one of claims 3, 5, or 7, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

9. The method of claim 8, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

10. The method of claim 9, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

11. The method of claim 10, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

12. The method of claim 10, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

13. The method of any one of claims 1-12, wherein the cyclophosphamide is administered as part of a cyclophosphamide-containing regimen.

14. The method of claim 13, wherein the cyclophosphamide-containing regimen is selected from the group consisting of: CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), CHOEP (also called EPOCH) (etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), CVP (cyclophosphamide, vincristine, and prednisone), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), CVAD (doxorubicin, vincristine, dexamethasone, and cyclophosphamide), hyperCVAD (cyclophosphamide, vincristine, doxorubicin, methotrexate, and cytarabine), BV-CHP (brentuximab vedotin, cyclophosphamide, doxorubicin, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone),Docket No. TRLN-013-037WO1 / TLS-077WO R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), FCR (fludarabine, cyclophosphamide, and rituximab) and a combination thereof,15. The method of claim 14, wherein the cyclophosphamide-containing regimen is selected from the group consisting of CHOP, CHOEP, R-CHOP, G-CHOP, and R-EPOCH.

16. The method of claim 15, wherein the cyclophosphamide-containing regimen is selected from the group consisting of CHOP, R-CHOP, and G-CHOP.

17. The method of claim 16, wherein the cyclophosphamide-containing regimen is CHOP.

18. The method of claim 16, wherein the cyclophosphamide-containing regimen is R-CHOP.

19. The method of claim 16, wherein the cyclophosphamide-containing regimen is G-CHOP.

20. The method of any one of claims 1-19, wherein the non-Hodgkin lymphoma has an EZH2 dysregulation.

21. The method of claim 20, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

22. The method of claim 21, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

23. The method of any one of claims 1-22, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

24. The method of any one of claims 1-22, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

25. The method of claim 24, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

26. The method of claim 24 or 25, wherein the subject has been previously treated with chemotherapy.

27. The method of claim 26, wherein the chemotherapy with which the subj ect has been previously treated comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.Docket No. TRLN-013-037WO1 / TLS-077WO 28. The method of any one of claims 26-27, wherein the chemotherapy is first-line therapy or second-line therapy.

29. The method of any one of claims 24-28, wherein the subject has been previously treated with an anti-CD19 therapy or an anti-CD20 therapy.

30. The method of claim 29, wherein the subject has been previously treated with an anti-CD19 therapy.

31. The method of claim 30, wherein the anti-CD19 therapy comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

32. The method of claim 31, wherein the anti-CD19 therapy comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

33. The method of claim 32, wherein the anti-CD19 therapy comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

34. The method of claim 30, wherein the anti-CD19 therapy is part of an anti-CD19 therapy-containing regimen.

35. The method of claim 34, wherein the anti-CD19 therapy-containing regimen is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

36. The method of claim 29, wherein the subject has previously been treated with an anti-CD20 therapy.

37. The method of claim 36, wherein the anti-CD20 therapy comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of any thereof.

38. The method of claim 37, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion- CD20, RTXM-83, SAIT-101, and TL-011.Docket No. TRLN-013-037WO1 / TLS-077WO 39. The method of claim 37 or 38, wherein the anti-CD20 therapy comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

40. The method of claim 39, wherein the anti-CD20 therapy comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

41. The method of claim 39, wherein the anti-CD20 therapy comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

42. The method of claim 36, wherein the anti-CD20 therapy is part of an anti-CD20 therapy-containing regimen.

43. The method of claim 42, wherein the anti-CD20 therapy-containing regimen is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini -R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

44. The method of any one of claims 29-43, wherein the anti-CD19 therapy or the anti-CD20 therapy is first-line therapy or second-line therapy.

45. The method of any one of claims 24-44, wherein the subject has been previously treated with a multispecific antibody, or an antigen-binding fragment thereof, or CAR T therapy.

46. The method of claim 45, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

47. The method of claim 46, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof.Docket No. TRLN-013-037WO1 / TLS-077WO 48. The method of claim 47, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

49. The method of claim 48, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bispecific antibody, or an antigen-binding fragment thereof.

50. The method of claim 49, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).

51. The method of claim 50, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof).

52. The method of any one of claims 45-51, wherein the subject has been previously treated with CAR T therapy.

53. The method of any one of claims 45-52, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

54. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a mature B-cell neoplasm.

55. The method of claim 54, wherein the mature B-cell neoplasm is a large B-cell lymphoma (LBCL).

56. The method of claim 55, wherein the LBCL is selected from the group consisting of diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with llq aberrations, and HGBCL-NOS.

57. The method of claim 56, wherein the LBCL is DLBCL-NOS.

58. The method of claim 54, wherein the mature B-cell neoplasm is a FL (e.g., grade 1-3 a or FLBCL) or transformed FL.

59. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a mantle cell lymphoma (MCL).

60. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a marginal zone lymphoma (MZL).Docket No. TRLN-013-037WO1 / TLS-077WO 61. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a chronic lymphocytic leukemia (CLL).

62. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a Richter transformation of CLL.

63. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a small lymphocytic lymphoma (SLL).

64. The method of any one of claims 1-53, wherein the non-Hodgkin lymphoma is a T-cell lymphoma.

65. The method of claim 64, wherein the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL).

66. The method of claim 65, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma ( ALCL) (e g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

67. The method of claim 66, wherein the PTCL is a nodal T follicular helper cell lymphoma.

68. The method of claim 67, wherein the PTCL is AITL.

69. The method of claim 67, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

70. The method of claim 67, wherein the PTCL is nodal T follicular helper cell lymphoma NOS.

71. The method of claim 64, wherein the T-cell lymphoma is a cutaneous T-cell lymphoma (CTCL).

72. The method of claim 71, wherein the CTCL is selected from the group consisting of primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, primary' cutaneous CD30-positive T-cell lymphoproliferative disorder: lymphomatoid papulosis, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: primary cutaneous anaplastic large cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, primary cutaneous gamma-delta T-cell lymphoma, and primary cutaneous peripheral T-cell lymphoma NOS.Docket No. TRLN-013-037WO1 / TLS-077WO 73. The method of claim 72, wherein the CTCL is mycosis fungoides or Sezary' syndrome.

74. The method of any one of claims 1-73, wherein the non-Hodgkin lymphoma is BCL6+.

75. The method of claim 74, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

76. The method of claim 75, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

77. The method of claim 76, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

78. The method of any one of claims 1-77, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

79. The method of claim 78, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

80. The method of claim 78, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

81. The method of claim 78, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 nig, wherein the dose is administered once or twice per day.

82. The method of claim 78, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

83. The method of claim 78, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

84. The method of any one of claims 78-83, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered once per day.

85. The method of any one of claims 78-83, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered twice per day.

86. The method of any one of claims 1-85, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered with food.Docket No. TRLN-013-037WO1 / TLS-077WO 87. The method of any one of claims 1-86, wherein the cyclophosphamide is administered at a dose of about 10 mg / kg to about 15 mg / kg weekly.

88. The method of any one of claims 1-86, wherein the cyclophosphamide is administered at a dose of about 300 mg / m2to about 1.5 g / m2.

89. The method of claim 88, wherein the cyclophosphamide is administered at a dose of about 600 mg / m2, about 750 mg / m2, about 800 mg / m2, about 1 g / m2, or about 1.5 g / m2.

90. The method of any one of claims 1-86, wherein the dose of cyclophosphamide is administered once per 28 days.

91. A method for treating a PTCL in a subject in need thereof, the method comprising admini stering to the subj ect:(a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxy daunorubicin, vincristine, and prednisone); and(b) a therapeutically effective amount of Compound 202b:0or a pharmaceutically acceptable salt thereof.

92. A method for treating a PTCL in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 202b:oDocket No. TRLN-013-037WO1 / TLS-077WO or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP,93. The method of claim 91 or 92, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

94. The method of claim 91 or 92, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the CHOP, are administered in a treatment phase.

95. The method of claim 94, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

96. The method of claim 91 or 92, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the CHOP, are administered in a maintenance phase.

97. The method of claim 96, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

98. The method of any one of claims 93, 95, or 97, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

99. The method of claim 98, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

100. The method of claim 99, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

101. The method of claim 100, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

102. The method of claim 100, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

103. The method of any one of claims 91-102, wherein the PTCL has an EZH2 dysregulation.

104. The method of claim 103, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

105. The method of claim 104, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.Docket No. TRLN-013-037WO1 / TLS-077WO 106. The method of any one of claims 91-105, wherein the administering of the therapeutically effective amount of Compound 202b, or a phar ceutically acceptable salt thereof, is during first-line therapy.

107. The method of any one of claims 91-105, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

108. The method of claim 107, wherein the admini stering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

109. The method of claim 107 or 108, wherein the subject has been previously treated with chemotherapy.

110. The method of claim 109, wherein the chemotherapy with which the subject has been previously treated comprises CHOP or EPOCH.

111. The method of claim 109 or 110, wherein the chemotherapy is first-line therapy or second-line therapy.

112. The method of any one of claims 106-111, wherein the subject has been previously treated with brentuximab vedotin.

113. The method of any one of claims 91-112, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

114. The method of claim 113, wherein the PTCL is a nodal T follicular helper cell lymphoma.

115. The method of claim 114, wherein the PTCL is AITL.

116. The method of claim 114, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

117. The method of claim 114, wherein the PTCL is nodal T follicular helper cell lympho a NOS.

118. The method of any one of claims 91-117, wherein the PTCL is BCL6+.

119. The method of claim 118, wherein the PTCL is BCL6-r with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.Docket No. TRLN-013-037WO1 / TLS-077WO 120. The method of claim 119, wherein the PTCL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

121. The method of claim 120, wherein the PTCL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

122. The method of any one of claims 91-121, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

123. The method of claim 122, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

124. The method of claim 122, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 nig, wherein the dose is administered once or twice per day.

125. The method of claim 122, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

126. The method of claim 122, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

127. The method of claim 122, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

128. The method of any one of claims 122-127, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered once per day.

129. The method of any one of claims 122-127, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered twice per day.

130. The method of any one of claims 91-129, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered with food.

131. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy; and(b) a therapeutically effective amount of Compound 202b:Docket No. TRLN-013-037WO1 / TLS-077WOoor a pharmaceutically acceptable salt thereof.132, A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 202b:oor a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CDl 9 therapy or an anti-CD20 therapy.133, The method of claim 131 or 132, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

134. The method of claim 131 or 132, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the anti-CDl 9 therapy or the anti-CD20 therapy, are administered in a treatment phase.135, The method of claim 134, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

136. The method of claim 131 or 132, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the anti-CD19 therapy or the anti-CD20 therapy, are administered in a maintenance phase.Docket No. TRLN-013-037WO1 / TLS-077WO 137. The method of claim 136, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

138. The method of any one of claims 133, 135, or 137, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

139. The method of claim 138, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

140. The method of claim 139, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

141. The method of claim 140, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

142. The method of claim 140, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

143. The method of any one of claims 131-142, wherein the anti-CD19 therapy or the anti-CD20 therapy is an anti-CDl 9 therapy.

144. The method of claim 143, wherein the anti-CD19 therapy is budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, biosimilars thereof, or a combination thereof.

145. The method of claim 144, wherein the anti-CD19 therapy is tafasitamab.

146. The method of claim 143, wherein the anti-CD19 therapy is part of an anti-CD19 therapy-containing regimen.

147. The method of claim 146, wherein the anti-CD19 therapy-containing regimen is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

148. The method of any one of claims 131-142, wherein the anti-CD19 therapy or the anti-CD20 therapy is anti-CD20 therapy.

149. The method of claim 148, wherein the anti-CD20 therapy is selected from the group consisting of divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, and SCT-400.Docket No. TRLN-013-037WO1 / TLS-077WO 150. The method of claim 149, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, / XCELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT- 101, and TL-011.

151. The method of any one of claims 148-150, wherein the anti-CD20 therapy is selected from the group consisting of rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) and obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

152. The method of claim 151, wherein the anti-CD20 therapy is rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

153. The method of claim 151, wherein the anti-CD20 therapy is obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

154. The method of claim 148, wherein the anti-CD20 therapy is part of an anti-CD20 therapy-containing regimen.

155. The method of claim 154, wherein the anti-CD20 therapy-containing regimen is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

156. The method of any one of claims 131-154, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during first-line therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 157. The method of any one of claims 131-154, wherein the administering of the therapeutically effective amount of Compound 202b, or a phar ceutically acceptable salt thereof, is during second-line or third-line therapy.

158. The method of claim 157, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

159. The method of claim 157 or 158, wherein the subject has been previously treated with chemotherapy.

160. The method of claim 159, wherein the chemotherapy comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.

161. The method of claim 159 or 160, wherein the chemotherapy is first-line therapy or second-line therapy.

162. The method of any one of claims 157-161, wherein the subj ect has been previously treated with an anti-CD19 therapy or an anti-CD20 therapy.

163. The method of claim 162, wherein the subject has been previously treated with an anti-CD19 therapy.

164. The method of claim 163, wherein the anti-CD19 therapy with which the subject has been previously treated comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

165. The method of claim 164, wherein the anti-CD19 therapy with which the subject has been previously treated comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

166. The method of claim 165, wherein the anti-CDI9 therapy with which the subject has been previously treated comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

167. The method of claim 163, wherein the anti-CD19 therapy with which the subject has been previously treated is part of an anti-CD19 therapy-containing regimen.

168. The method of claim 167, wherein the anti-CD19 therapy-containing regimen with which the subject has been previously treated is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

169. The method of claim 162, wherein the subject has previously been treated with an anti-CD20 therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 170. The method of claim 169, wherein the anti-CD20 therapy with which the subject has been previously treated comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of any thereof.

171. The method of claim 170, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

172. The method of claim 170 or 171, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

173. The method of claim 172, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

174. The method of claim 172, wherein the anti-CD20 therapy with which the subject has been previously treated comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

175. The method of claim 169, wherein the anti-CD20 therapy with which the subject has been previously treated is part of an anti-CD20 therapy-containing regimen.

176. The method of claim 175, wherein the anti-CD20 therapy-containing regimen with which the subject has been previously treated is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumabDocket No. TRLN-013-037WO1 / TLS-077WO vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

177. The method of any one of claims 162-176, wherein the anti-CD19 therapy or the anti-CD20 therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

178. The method of any one of claims 157-177, wherein the subject has been previously treated with a multispecific antibody, or an antigen-binding fragment thereof, or CAR T therapy.

179. The method of claim 178, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

180. The method of claim 179, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof.

181. The method of claim 180, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

182. The method of claim 181, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bispecific antibody, or an antigen-binding fragment thereof.

183. The method of claim 182, wherein the anti-CD20 and anti-CD3 bi specific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).

184. The method of claim 183, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof).

185. The method of any one of claims 178-184, wherein the subject has been previously treated with CAR T therapy.

186. The method of any one of cl aims 178-185, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

187. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a mature B-cell neoplasm.Docket No. TRLN-013-037WO1 / TLS-077WO 188. The method of claim 187, wherein the mature B-cell neoplasm is a large B-cell lymphoma (LBCL).

189. The method of claim 188, wherein the LBCL is selected from the group consisting of diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary' LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with I Iq aberrations, and HGBCL-NOS.

190. The method of claim 189, wherein the LBCL is DLBCL-NOS.

191. The method of claim 187, wherein the mature B-cell neoplasm is a FL (e.g., grade l-3a or FLBCL) or transformed FL.

192. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a mantle cell lymphoma (MCL).

193. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a marginal zone lymphoma (MZL).

194. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a chronic lymphocytic leukemia (CLL).

195. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a Richter transformation of CLL.

196. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a small lymphocytic lymphoma (SLL).

197. The method of any one of claims 131-186, wherein the non-Hodgkin lymphoma is a T-cell lymphoma.

198. The method of claim 197, wherein the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL).

199. The method of claim 198, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

200. The method of claim 199, wherein the PTCL is a nodal T follicular helper cell lymphoma.

201. The method of claim 200, wherein the PTCL is AITL.Docket No. TRLN-013-037WO1 / TLS-077WO 202. The method of claim 200, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

203. The method of claim 200, wherein the PTCL is nodal T follicular helper cell lymphoma NOS.

204. The method of claim 197, wherein the T-cell lymphoma is a cutaneous T-cell lymphoma (CTCL).

205. The method of claim 204, wherein the CTCL is selected from the group consisting of primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: lymphomatoid papulosis, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: primary cutaneous anaplastic large cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, primary cutaneous gamma-delta T-cell lymphoma, and primary cutaneous peripheral T-cell lymphoma NOS.

206. The method of claim 205, wherein the CTCL is mycosis fungoides or Sezary syndrome.

207. The method of any one of claims 131-206, wherein the non-Hodgkin lymphoma is BCL6+.

208. The method of claim 207, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

209. The method of claim 208, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

210. The method of claim 209, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

211. The method of any one of claims 131-210, wherein the non-Hodgkin lymphoma has an EZH2 dysregulation.

212. The method of claim 211, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

213. The method of claim 212, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

214. The method of any one of claims 131-213, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the groupDocket No. TRLN-013-037WO1 / TLS-077WO consisting of: 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

215. The method of claim 214, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

216. The method of claim 214, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

217. The method of claim 214, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

218. The method of claim 214, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

219. The method of claim 214, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

220. The method of any one of claims 214-219, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered once per day.

221. The method of any one of claims 214-219, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered twice per day.

222. The method of any one of claims 131-221, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered with food.

223. A method for treating a follicular lymphoma (FL) in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of rituximab; andDocket No. TRLN-013-037WO1 / TLS-077WO (b) a therapeutically effective amount of Compound 202b:or a pharmaceutically acceptable salt thereof224. A method for treating a follicular lymphoma (FL) in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 202b:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

225. The method of claim 223 or 224, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

226. The method of claim 223 or 224, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the rituximab, are administered in a treatment phase.

227. The method of claim 226, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

228. The method of claim 223 or 224, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, and the rituximab, are administered in a maintenance phase.

229. The method of claim 228, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.Docket No. TRLN-013-037WO1 / TLS-077WO 230. The method of any one of claims 225, 227, or 229, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

231. The method of claim 230, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

232. The method of claim 231, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of. 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

233. The method of claim 232, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

234. The method of claim 232, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

235. The method of any one of claims 223-234, wherein the rituximab is RITUXAN® (rituximab), or a biosimilar thereof.

236. The method of claim 235, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion- CD20, RTXM-83, SAIT-101, and TL-011.

237. The method of any one of claims 223-236, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

238. The method of any one of claims 223-237, wherein the administering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

239. The method of claim 238, wherein the admini stering of the therapeutically effective amount of Compound 202b, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

240. The method of claim 238 or 239, wherein the subject has been previously treated with chemotherapy.

241. The method of claim 240, wherein the chemotherapy comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.Docket No. TRLN-013-037WO1 / TLS-077WO 242. The method of claim 240 or 241, wherein the chemotherapy is first-line therapy or second-line therapy.

243. The method of any one of claims 238-242, wherein the subject has been previously treated with an anti-CDl 9 therapy or an anti-CD20 therapy.

244. The method of claim 243, wherein the subject has been previously treated with an anti-CDl 9 therapy.

245. The method of claim 244, wherein the anti-CD19 therapy with which the subject has been previously treated comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

246. The method of claim 245, wherein the anti -CD 19 therapy with which the subject has been previously treated comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

247. The method of claim 246, wherein the anti -CD 19 therapy with which the subject has been previously treated comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

248. The method of claim 244, wherein the anti -CD 19 therapy with which the subject has been previously treated is part of an anti-CD19 therapy-containing regimen.

249. The method of claim 248, wherein the anti-CD l 9 therapy-containing regimen with which the subject has been previously treated is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

250. The method of claim 243, wherein the subject has previously been treated with an anti-CD20 therapy.

251. The method of claim 250, wherein the anti-CD20 therapy with which the subject has been previously treated comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab- xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of any thereof.

252. The method of claim 251, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), MaballDocket No. TRLN-013-037WO1 / TLS-077WO (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

253. The method of claim 251 or 252, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

254. The method of claim 253, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

255. The method of claim 253, wherein the anti-CD20 therapy with which the subject has been previously treated comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

256. The method of claim 250, wherein the anti-CD20 therapy with which the subject has been previously treated is part of an anti-CD20 therapy-containing regimen.

257. The method of claim 256, wherein the anti-CD20 therapy-containing regimen with which the subject has been previously treated is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

258. The method of any one of claims 243-256, wherein the anti -CD 19 therapy or the anti-CD20 therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

259. The method of any one of claims 238-258, wherein the subject has been previously treated with a multispecific antibody, or an antigen -binding fragment thereof, or CAR T therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 260. The method of claim 259, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

261. The method of claim 260, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof.

262. The method of claim 261, wherein the multispecific antibody, or antigen-binding fragment thereof is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

263. The method of claim 262, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bi specific antibody, or an antigen-binding fragment thereof.

264. The method of claim 263, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).

265. The method of claim 264, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab- axgb (LUNSUMIO™), of a biosimilar thereof).

266. The method of any one of claims 259-265, wherein the subject has been previously treated with CAR T therapy.

267. The method of any one of claims 259-266, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

268. The method of any one of claims 223-267, wherein the FL is grade l-3a FL or FLBCL.

269. The method of any one of claims 223-268, wherein the FL is BCL6+.

270. The method of claim 269, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

271. The method of claim 270, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

272. The method of claim 271, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

273. The method of any one of claims 223-272, wherein the FL has an EZH2 dysregulation.Docket No. TRLN-013-037WO1 / TLS-077WO 274. The method of claim 273, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

275. The method of claim 274, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

276. The method of any one of claims 223-275, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

277. The method of claim 276, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

278. The method of claim 276, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

279. The method of claim 276, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

280. The method of claim 276, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

281. The method of claim 276, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

282. The method of any one of claims 276-281, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered once per day.

283. The method of any one of claims 276-281, wherein the dose of Compound 202b, or a pharmaceutically acceptable salt thereof, is administered twice per day.

284. The method of any one of claims 223-283, wherein Compound 202b, or a pharmaceutically acceptable salt thereof, is administered with food.

285. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of cyclophosphamide; andDocket No. TRLN-013-037WO1 / TLS-077WO (b) a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof.

286. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of cyclophosphamide.

287. The method of claim 285 or 286, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

288. The method of claim 285 or 286, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the cyclophosphamide, are administered in a treatment phase.

289. The method of claim 288, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

290. The method of claim 285 or 286, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the cyclophosphamide, are administered in a maintenance phase.

291. The method of claim 290, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

292. The method of any one of claims 287, 289, or 291, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g.,Docket No. TRLN-013-037WO1 / TLS-077WO valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

293. The method of claim 292, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

294. The method of claim 293, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

295. The method of claim 294, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

296. The method of claim 294, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

297. The method of any one of claims 285-296, wherein the cyclophosphamide is administered as part of a cyclophosphamide-containing regimen.

298. The method of claim 297, wherein the cyclophosphamide-containing regimen is selected from the group consisting of: CHOP (cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), CHOEP (also called EPOCH) (etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), CVP (cyclophosphamide, vincristine, and prednisone), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), CVAD (doxorubicin, vincristine, dexamethasone, and cyclophosphamide), hyperCVAD (cyclophosphamide, vincristine, doxorubicin, methotrexate, and cytarabine), BV-CHP (brentuximab vedotin, cyclophosphamide, doxorubicin, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), FCR (fludarabine, cyclophosphamide, and rituximab) and a combination thereof.

299. The method of claim 298, wherein the cyclophosphamide-containing regimen is selected from the group consisting of CHOP, CHOEP, R-CHOP, G-CHOP, and R-EPOCH.

300. The method of claim 299, wherein the cyclophosphamide-containing regimen is selected from the group consisting of CHOP, R-CHOP, and G-CHOP.Docket No. TRLN-013-037WO1 / TLS-077WO 301. The method of claim 300, wherein the cyclophosphamide-containing regimen is CHOP.

302. The method of claim 300, wherein the cyclophosphamide-containing regimen is R-CHOP.

303. The method of claim 300, wherein the cyclophosphamide-containing regimen is G-CHOP.

304. The method of any one of claims 285-303, wherein the non-Hodgkin lymphoma has an EZH2 dysregulation.

305. The method of claim 304, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof,306. The method of claim 305, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

307. The method of any one of claims 285-306, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

308. The method of any one of claims 285-306, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

309. The method of claim 308, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

310. The method of claim 308 or 309, wherein the subject has been previously treated with chemotherapy.

311. The method of claim 310, wherein the chemotherapy with which the subject has been previously treated comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.

312. The method of claim 310 or 311, wherein the chemotherapy is first-line therapy or second-line therapy.

313. The method of any one of claims 308-312, wherein the subject has been previously treated with an anti-CD19 therapy or an anti-CD20 therapy.

314. The method of claim 313, wherein the subject has been previously treated with an anti-CD19 therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 315. The method of claim 314, wherein the anti-CD19 therapy comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

316. The method of claim 315, wherein the anti-CD19 therapy comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

317. The method of claim 316, wherein the anti-CD19 therapy comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

318. The method of claim 314, wherein the anti-CD19 therapy is part of an anti-CD19 therapy-containing regimen.

319. The method of claim 318, wherein the anti-CD19 therapy-containing regimen is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

320. The method of claim 313, wherein the subject has previously been treated with an anti-CD20 therapy.

321. The method of claim 320, wherein the anti-CD20 therapy comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of anv thereof.

322. The method of claim 321, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, / XCELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

323. The method of claim 321 or 322, wherein the anti-CD20 therapy comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

324. The method of claim 323, wherein the anti-CD20 therapy comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

325. The method of claim 323, wherein the anti-CD20 therapy comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).Docket No. TRLN-013-037WO1 / TLS-077WO 326. The method of claim 320, wherein the anti-CD20 therapy is part of an anti-CD20 therapy-containing regimen,327. The method of claim 326, wherein the anti-CD20 therapy-containing regimen is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

328. The method of any one of claims 313-327, wherein the anti-CD19 therapy or the anti-CD20 therapy is first-line therapy or second-line therapy,329. The method of any one of claims 308-328, wherein the subject has been previously treated with a multispecific antibody, or an antigen-binding fragment thereof, or CAR T therapy.

330. The method of claim 329, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

331. The method of claim 330, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof,332. The method of claim 331, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

333. The method of claim 332, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bi specific antibody, or an antigen-binding fragment thereof.

334. The method of claim 333, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgbDocket No. TRLN-013-037WO1 / TLS-077WO (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).

335. The method of claim 334, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof).

336. The method of any one of claims 329-335, wherein the subject has been previously treated with CAR T therapy.

337. The method of any one of claims 329-336, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

338. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a mature B-cell neoplasm.

339. The method of claim 338, wherein the mature B-cell neoplasm is a large B-cell lymphoma (LBCL).

340. The method of claim 339, wherein the LBCL is selected from the group consisting of diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary' mediastinal LBCL, HGBCL with I Iq aberrations, and HGBCL-NOS.

341. The method of claim 340, wherein the LBCL is DLBCL-NOS.

342. The method of claim 338, wherein the mature B-cell neoplasm is a FL (e.g., grade l-3a or FLBCL) or transformed FL.

343. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a mantle cell lymphoma (MCL).

344. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a marginal zone lymphoma (MZL).

345. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a chronic lymphocytic leukemia (CLL).

346. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a Richter transformation of CLL.

347. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a small lymphocytic lymphoma (SLL).

348. The method of any one of claims 285-337, wherein the non-Hodgkin lymphoma is a T-cell lymphoma.Docket No. TRLN-013-037WO1 / TLS-077WO 349. The method of claim 348, wherein the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL).

350. The method of claim 349, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

351. The method of claim 350, wherein the PTCL is a nodal T follicular helper cell lymphoma.

352. The method of claim 351, wherein the PTCL is AITL.

353. The method of claim 351, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

354. The method of claim 351, wherein the PTCL is nodal T follicular helper cell lymphoma NOS.

355. The method of claim 348, wherein the T-cell lymphoma is a cutaneous T-cell lymphoma (CTCL).

356. The method of claim 355, wherein the CTCL is selected from the group consisting of primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: lymphomatoid papulosis, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: primary cutaneous anaplastic large cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, primary cutaneous gamma-delta T-cell lymphoma, and primary cutaneous peripheral T-cell lymphoma NOS.

357. The method of claim 356, wherein the CTCL is mycosis fungoides or Sezary syndrome.

358. The method of any one of claims 285-357, wherein the non-Hodgkin lymphoma is BCL6+.

359. The method of claim 358, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

360. The method of claim 359, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.Docket No. TRLN-013-037WO1 / TLS-077WO 361. The method of claim 360, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

362. The method of any one of claims 285-361, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

363. The method of claim 362, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

364. The method of claim 362, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

365. The method of claim 362, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

366. The method of claim 362, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

367. The method of claim 362, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

368. The method of any one of claims 362-367, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered once per day.

369. The method of any one of claims 362-367, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered twice per day.

370. The method of any one of claims 285-369, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered with food.

371. The method of any one of claims 285-370, wherein the cyclophosphamide is administered at a dose of about 10 mg / kg to about 15 mg / kg weekly.

372. The method of any one of claims 285-370, wherein the cyclophosphamide is administered at a dose of about 300 mg / m2to about 1.5 g / m2.

373. The method of claim 372, wherein the cyclophosphamide is administered at a dose of about 600 mg / m2, about 750 mg / m2, about 800 mg / m2, about 1 g / m2, or about 1.5 g / m2.

374. The method of any one of claims 285-373, wherein the dose of cyclophosphamide is administered once per 28 days.Docket No. TRLN-013-037WO1 / TLS-077WO375, A method for treating a PTCL in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of CHOP (cyclophosphamide, hydroxy daunorubicin, vincristine, and prednisone); and(b) a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof.

376. A method for treating a PTCL in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of CHOP.

377. The method of claim 375 or 376, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

378. The method of claim 375 or 376, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the CHOP, are administered in a treatment phase.

379. The method of claim 378, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

380. The method of claim 375 or 376, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the CHOP, are administered in a maintenance phase.Docket No. TRLN-013-037WO1 / TLS-077WO 381. The method of claim 380, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

382. The method of any one of claims 377, 379, or 381, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

383. The method of claim 382, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

384. The method of claim 383, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

385. The method of claim 384, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

386. The method of claim 384, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

387. The method of any one of claims 375-386, wherein the PTCL has an EZH2 dysregulation.

388. The method of claim 387, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

389. The method of claim 388, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

390. The method of any one of claims 375-389, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

391. The method of any one of claims 375-389, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

392. The method of claim 391, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 393. The method of claim 391 or 392, wherein the subject has been previously treated with chemotherapy.

394. The method of claim 393, wherein the chemotherapy with which the subject has been previously treated comprises CHOP or EPOCH.

395. The method of claim 393 or 394, wherein the chemotherapy is first-line therapy or second-line therapy.

396. The method of any one of claims 393-395, wherein the subject has been previously treated with brentuximab vedotin.

397. The method of any one of claims 375-396, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma (ALCL) (e.g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

398. The method of claim 397, wherein the PTCL is a nodal T follicular helper cell lymphoma.

399. The method of claim 398, wherein the PTCL is AITL.

400. The method of claim 398, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

401. The method of claim 398, wherein the PTCL is nodal T follicular helper cell lymphoma NOS.

402. The method of any one of claims 375-401, wherein the PTCL is BCL6+.

403. The method of claim 402, wherein the PTCL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

404. The method of claim 403, wherein the PTCL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

405. The method of claim 404, wherein the PTCL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

406. The method of any one of claims 375-405, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO 407. The method of claim 406, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

408. The method of claim 406, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

409. The method of claim 406, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

410. The method of claim 406, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

411. The method of claim 406, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

412. The method of any one of claims 406-411, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered once per day.

413. The method of any one of claims 406-411, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered twice per day.

414. The method of any one of claims 375-413, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered with food.

415. A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of an anti-CD19 therapy or an anti-CD20 therapy; and(b) a therapeutically effective amount of Compound 132a.Docket No. TRLN-013-037WO1 / TLS-077WO or a pharmaceutically acceptable salt thereof.416, A method for treating a non-Hodgkin lymphoma in a subject in need thereof, the method comprising administering to the subject:a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of an anti-CDl 9 therapy or an anti-CD20 therapy.

417. The method of claim 415 or 416, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

418. The method of claim 415 or 416, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the anti-CD19 therapy or the anti-CD20 therapy, are administered in a treatment phase.

419. The method of claim 418, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

420. The method of claim 415 or 416, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the anti-CD19 therapy or the anti-CD20 therapy, are administered in a maintenance phase.

421. The method of claim 420, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

422. The method of any one of claims 417, 419, or 421, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW- 5004.

423. The method of claim 422, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.Docket No. TRLN-013-037WO1 / TLS-077WO 424. The method of claim 423, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

425. The method of claim 424, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

426. The method of claim 424, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.

427. The method of any one of claims 415-426, wherein the anti-CD19 therapy or the anti-CD20 therapy is an anti-CD19 therapy.

428. The method of claim 427, wherein the anti-CD19 therapy is budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, biosimilars thereof, or a combination thereof.

429. The method of claim 428, wherein the anti-CD19 therapy is tafasitamab.

430. The method of claim 427, wherein the anti -CD 19 therapy is part of an anti-CD19 therapy-containing regimen.

431. The method of claim 430, wherein the anti-CD19 therapy-containing regimen is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

432. The method of any one of claims 415-426, wherein the anti-CD19 therapy or the anti-CD20 therapy is anti-CD20 therapy.

433. The method of claim 432, wherein the anti-CD20 therapy is selected from the group consisting of divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, and SCT-400.

434. The method of claim 433, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATUON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

435. The method of any one of claims 432-434, wherein the anti-CD20 therapy is selected from the group consisting of rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) and obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).Docket No. TRLN-013-037WO1 / TLS-077WO 436. The method of claim 435, wherein the anti-CD20 therapy is rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

437. The method of claim 435, wherein the anti-CD20 therapy is obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

438. The method of claim 432, wherein the anti-CD20 therapy is part of an anti-CD20 therapy-containing regimen.

439. The method of claim 438, wherein the anti-CD20 therapy-containing regimen is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

440. The method of any one of claims 415-439, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

441. The method of any one of claims 415-439, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

442. The method of claim 441, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

443. The method of claim 441 or 442, wherein the subject has been previously treated with chemotherapy.

444. The method of claim 443, wherein the chemotherapy comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.Docket No. TRLN-013-037WO1 / TLS-077WO 445. The method of claim 443 or 444, wherein the chemotherapy is first-line therapy or second-line therapy.

446. The method of any one of claims 441-445, wherein the subject has been previously treated with an anti-CD19 therapy or an anti-CD20 therapy.

447. The method of claim 446, wherein the subject has been previously treated with an anti-CD19 therapy.

448. The method of claim 447, wherein the anti-CD19 therapy with which the subject has been previously treated comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

449. The method of claim 448, wherein the anti -CD 19 therapy with which the subject has been previously treated comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

450. The method of claim 449, wherein the anti -CD 19 therapy with which the subject has been previously treated comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

451. The method of claim 447, wherein the anti -CD 19 therapy with which the subject has been previously treated is part of an anti-CD19 therapy-containing regimen.

452. The method of claim 451, wherein the anti-CD19 therapy-containing regimen with which the subject has been previously treated is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

453. The method of claim 446, wherein the subject has previously been treated with an anti-CD20 therapy.

454. The method of claim 453, wherein the anti-CD20 therapy with which the subject has been previously treated comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e.g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of any thereof.

455. The method of claim 454, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), MaballDocket No. TRLN-013-037WO1 / TLS-077WO (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

456. The method of claim 454 or 455, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

457. The method of claim 456, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof).

458. The method of claim 456, wherein the anti-CD20 therapy with which the subject has been previously treated comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

459. The method of claim 453, wherein the anti-CD20 therapy with which the subject has been previously treated is part of an anti-CD20 therapy-containing regimen.

460. The method of claim 459, wherein the anti-CD20 therapy-containing regimen with which the subject has been previously treated is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

461. The method of any one of claims 446-460, wherein the anti-CD19 therapy or the anti-CD20 therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

462. The method of any one of claims 441-461, wherein the subject has been previously treated with a multispecific antibody, or an antigen-binding fragment thereof, or CAR T therapy.Docket No. TRLN-013-037WO1 / TLS-077WO 463. The method of claim 462, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

464. The method of claim 463, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof.

465. The method of claim 464, wherein the multispecific antibody, or antigen-binding fragment thereof is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

466. The method of claim 465, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bi specific antibody, or an antigen-binding fragment thereof.

467. The method of claim 466, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).

468. The method of claim 467, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab- axgb (LUNSUMIO™), of a biosimilar thereof).

469. The method of any one of claims 462-468, wherein the subject has been previously treated with CAR T therapy.

470. The method of any one of claims 462-469, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

471. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a mature B-cell neoplasm.

472. The method of claim 471, wherein the mature B-cell neoplasm is a large B-cell lymphoma (LBCL).

473. The method of claim 472, wherein the LBCL is selected from the group consisting of diffuse large B-cell lymphoma not otherwise specified (DLBCL-NOS), diffuse large B-cell lymphoma / high grade B-cell lymphoma (HGBCL) (e.g., HGBCL with MYC and / or BCL2 rearrangements (HGBCL-MYC / BCL-2)), primary LBCL of immune-privileged sites, primary mediastinal LBCL, HGBCL with llq aberrations, and HGBCL-NOS.

474. The method of claim 473, wherein the LBCL is DLBCL-NOS.

475. The method of claim 471, wherein the mature B-cell neoplasm is a FL (e.g., grade l-3a or FLBCL) or transformed FL.Docket No. TRLN-013-037WO1 / TLS-077WO 476. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a mantle cell lymphoma (MCL),477. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a marginal zone lymphoma (MZL).

478. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a chronic lymphocytic leukemia (CLL).

479. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a Richter transformation of CLL.

480. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a small lymphocytic lymphoma (SLL).

481. The method of any one of claims 415-470, wherein the non-Hodgkin lymphoma is a T-cell lymphoma.

482. The method of claim 481, wherein the T-cell lymphoma is a peripheral T-cell lymphoma (PTCL).

483. The method of claim 482, wherein the PTCL is selected from the group consisting of anaplastic large cell lymphoma ( ALCL) (e g., ALK-positive anaplastic large cell lymphoma, or ALK-negative anaplastic large cell lymphoma), nodal T follicular helper cell lymphoma (e.g., nodal T follicular helper cell lymphoma angioimmunoblastic type (also known as angioimmunoblastic T-cell lymphoma (AITL) or follicular helper T-cell lymphoma, angioimmunoblastic type), nodal T follicular helper cell lymphoma follicular type (also known as follicular helper T-cell lymphoma, follicular type), and nodal T follicular helper cell lymphoma NOS (also known as follicular helper T-cell lymphoma, NOS)).

484. The method of claim 483, wherein the PTCL is a nodal T follicular helper cell lymphoma.

485. The method of claim 484, wherein the PTCL is AITL.

486. The method of claim 484, wherein the PTCL is nodal T follicular helper cell lymphoma follicular type.

487. The method of claim 484, wherein the PTCL is nodal T follicular helper cell lymphoma NOS.

488. The method of claim 481, wherein the T-cell lymphoma is a cutaneous T-cell lymphoma (CTCL).

489. The method of claim 488, wherein the CTCL is selected from the group consisting of primary cutaneous CD4-positive small or medium T-cell lymphoproliferative disorder, mycosis fungoides, Sezary syndrome, primary cutaneous CD30-positive T-cell lymphoproliferative disorder: lymphomatoid papulosis, primary cutaneous CD30-positive T-cell lymphoproliferativeDocket No. TRLN-013-037WO1 / TLS-077WO disorder: primary cutaneous anaplastic large cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, primary cutaneous gamma-delta T-cell lymphoma, and primary cutaneous peripheral T-cell lymphoma NOS.

490. The method of claim 489, wherein the CTCL is mycosis fungoides or Sezary syndrome.

491. The method of any one of claims 415-490, wherein the non-Hodgkin lymphoma is BCL6+.

492. The method of claim 491, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

493. The method of claim 492, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

494. The method of claim 493, wherein the non-Hodgkin lymphoma is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

495. The method of any one of claims 415-494, wherein the non-Hodgkin lymphoma has an EZH2 dysregulation.

496. The method of claim 495, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

497. The method of claim 496, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof.

498. The method of any one of claims 415-497, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

499. The method of claim 498, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.

500. The method of claim 498, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

501. The method of claim 498, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO 502. The method of claim 498, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

503. The method of claim 498, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

504. The method of any one of claims 498-503, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered once per day.

505. The method of any one of claims 498-503, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered twice per day.

506. The method of any one of claims 415-505, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered with food.

507. A method for treating a follicular lymphoma (FL) in a subject in need thereof, the method comprising administering to the subject:(a) a therapeutically effective amount of rituximab; and(b) a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof.

508. A method for treating a follicular lymphoma (FL) in a subject in need thereof, the method comprising administering to the subject:Docket No. TRLN-013-037WO1 / TLS-077WO a therapeutically effective amount of Compound 132a:or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of rituximab.

509. The method of claim 507 or 508, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor.

510. The method of claim 507 or 508, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the rituximab, are administered in a treatment phase.

511. The method of claim 510, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the treatment phase.

512. The method of claim 507 or 508, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, and the rituximab, are administered in a maintenance phase.

513. The method of claim 512, the method comprising administering a therapeutically effective amount of an EZH2 inhibitor in the maintenance phase.

514. The method of any one of claims 509, 511, or 513, wherein the EZH2 inhibitor is selected from the group consisting of: Compound Z, or a pharmaceutically acceptable salt thereof, lirametostat, mevrometostat, tazemetostat (e.g., tazemetostat hydrobromide), valemetostat (e.g., valemetostat tosylate), tulmimetostat (CPI-0209), EBI-2511, HH-2853, HM-97662, and XNW-5004.

515. The method of claim 514, wherein the EZH2 inhibitor is Compound Z, or a pharmaceutically acceptable salt thereof.

516. The method of claim 515, wherein Compound Z, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 250 mg, 300 mg, and 350 mg, and wherein the dose is administered once or twice per day.

517. The method of claim 516, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered once per day.

518. The method of claim 516, wherein the dose of Compound Z, or a pharmaceutically acceptable salt thereof, is administered twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO 519. The method of any one of claims 507-518, wherein the rituximab is RITUXAN® (rituximab), or a biosimilar thereof520. The method of claim 519, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), H / XNLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT-101, and TL-011.

521. The method of any one of claims 507-520, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during first-line therapy.

522. The method of any one of claims 507-520, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line or third-line therapy.

523. The method of claim 522, wherein the administering of the therapeutically effective amount of Compound 132a, or a pharmaceutically acceptable salt thereof, is during second-line therapy.

524. The method of claim 522 or 523, wherein the subject has been previously treated with chemotherapy.

525. The method of claim 524, wherein the chemotherapy comprises CHOP, EPOCH, R-CHOP, mini-R-CHOP, Pola-R-CHP, R-EPOCH, R-CVP, R-ICE, BR, or pola-BR.

526. The method of claim 524 or 525, wherein the chemotherapy is first-line therapy or second-line therapy.

527. The method of any one of claims 507-526, wherein the subject has been previously treated with an anti-CD19 therapy or an anti-CD20 therapy.

528. The method of claim 527, wherein the subject has been previously treated with an anti -CD 19 therapy.

529. The method of claim 528, wherein the anti -CD 19 therapy with which the subject has been previously treated comprises blinatumomab (e.g., BLINCYTO® (blinatumomab) or a biosimilar thereof), budoprutug, coltuximab ravtansine, inebilizumab (e.g., inebilizumab-cdon, or a biosimilar thereof), loncastuximab tesirine (e.g., loncastuximab tesirine-lpyl, or a biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), AZD-0486, dDT-2219, LY-3541860, or a biosimilar of any thereof.

530. The method of claim 529, wherein the anti-CD19 therapy with which the subject has been previously treated comprises budoprutug, inebilizumab (e.g., inebilizumab-cdon, or aDocket No. TRLN-013-037WO1 / TLS-077WO biosimilar thereof), obexelimab, tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof), LY-3541860, or a biosimilar of any thereof.

531. The method of claim 530, wherein the anti-CD19 therapy with which the subject has been previously treated comprises tafasitamab (e.g., tafasitamab-cxix, or a biosimilar thereof).

532. The method of claim 528, wherein the anti -CD 19 therapy with which the subject has been previously treated is part of an anti-CD19 therapy-containing regimen.

533. The method of claim 532, wherein the anti-CD19 therapy-containing regimen with which the subject has been previously treated is tafasitamab and lenalidomide, tafasitamab and R2, or tafasitamab, R-CHOP, and lenalidomide.

534. The method of claim 527, wherein the subject has previously been treated with an anti-CD20 therapy.

535. The method of claim 534, wherein the anti-CD20 therapy with which the subject has been previously treated comprises divozilimab, obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof), ocrelizumab (e g., OCREVUS® (ocrelizumab), or a biosimilar thereof), ofatumumab (e.g., ARZERRA® (ofatumumab), or a biosimilar thereof), rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof), ublituximab (e.g., ublituximab-xiiy, or a biosimilar thereof), veltuzumab, zuberitamab, MIL-62, SCT-400, or a biosimilar of any thereof536. The method of claim 535, wherein the biosimilar of RITUXAN® (rituximab) is selected from the group consisting of rituximab-abbs, rituximab-airx, rituximab-pvvr, ACELLBIA® (rituximab), HALPRYZA® (rituximab), HANLIKON® (rituximab), Maball (rituximab), REDITUX™ (rituximab), Retuxira (rituximab), RITUCAD® (rituximab), RIXATHON® (rituximab), Toritz (rituximab), AP-056, BI-695500, GB-241, GNR-006, Mabion-CD20, RTXM-83, SAIT- 101, and TL-011.

537. The method of claim 535 or 536, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUXAN® (rituximab), or a biosimilar thereof) or obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

538. The method of claim 537, wherein the anti-CD20 therapy with which the subject has been previously treated comprises rituximab (e.g., RITUX AN® (rituximab), or a biosimilar thereof).

539. The method of claim 537, wherein the anti-CD20 therapy with which the subject has been previously treated comprises obinutuzumab (e.g., GAZYVA® (obinutuzumab), or a biosimilar thereof).

540. The method of claim 534, wherein the anti-CD20 therapy with which the subject has been previously treated is part of an anti-CD20 therapy-containing regimen.Docket No. TRLN-013-037WO1 / TLS-077WO 541. The method of claim 540, wherein the anti-CD20 therapy-containing regimen with which the subject has been previously treated is selected from the group consisting of: R-CHOP (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone), mini-R-CHOP (a less intensive and / or dose reduced chemotherapy regimen of R-CHOP), G-CHOP (obinutuzumab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), mini-G-CHOP (a less intensive and / or dose reduced chemotherapy regimen of G-CHOP), R-EPOCH (rituximab, etoposide, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisone), DA-EPOCH-R (rituximab, and dose-adjusted etoposide, prednisolone, vincristine, cyclophosphamide, and doxorubicin), R-CVP (rituximab, cyclophosphamide, vincristine, and prednisone), G-CVP (obinutuzumab, cyclophosphamide, vincristine, and prednisone), BV-R-CHP (brentuximab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), Pola-R-CHP (polatuzumab vedotin, rituximab, cyclophosphamide, doxorubicin, and prednisone), R-CODOX-M (rituximab, cyclophosphamide, vincristine, doxorubicin, and methotrexate), R-ICE (rituximab, ifosfamide, carboplatin, and etoposide), BR (rituximab and bendamustine), pola-BR (rituximab, bendamustine, and polatuzumab vedotin), rituximab and chlorambucil, FCR (fludarabine, cyclophosphamide, and rituximab), R2(rituximab and lenalidomide), and a combination thereof.

542. The method of any one of claims 527-541, wherein the anti-CD19 therapy or the anti-CD20 therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

543. The method of any one of claims 522-542, wherein the subject has been previously treated with a multispecific antibody, or an antigen-binding fragment thereof, or CAR T therapy.

544. The method of claim 543, wherein the multispecific antibody, or antigen-binding fragment thereof, is a multispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

545. The method of claim 544, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific antibody, or an antigen-binding fragment thereof.

546. The method of claim 545, wherein the multispecific antibody, or antigen-binding fragment thereof, is a bispecific T-cell recruiting antibody, or an antigen-binding fragment thereof.

547. The method of claim 546, wherein the subject has been previously treated with an anti-CD20 and anti-CD3 bispecific antibody, or an antigen-binding fragment thereof.

548. The method of claim 547, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof), plamotamab, or odronextamab (e.g., ORDSPONO™, or a biosimilar thereof).Docket No. TRLN-013-037WO1 / TLS-077WO 549. The method of claim 548, wherein the anti-CD20 and anti-CD3 bispecific antibody is epcoritamab (e.g., epcoritamab-bysp (EPKINLY™), or a biosimilar thereof), glofitamab (e.g., COLUMVI® (glofitamab), or a biosimilar thereof), or mosunetuzumab (e.g., mosunetuzumab-axgb (LUNSUMIO™), or a biosimilar thereof).

550. The method of any one of claims 543-549, wherein the subject has been previously treated with CAR T therapy.

551. The method of any one of claims 543-550, wherein the multispecific antibody or antigen-binding fragment thereof or CAR T therapy with which the subject has been previously treated is first-line therapy or second-line therapy.

552. The method of any one of claims 507-551, wherein the FL is grade l-3a FL or FLBCL553. The method of any one of claims 507-552, wherein the FL is BCL6+.

554. The method of claim 553, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 1%.

555. The method of claim 554, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 20%.

556. The method of claim 555, wherein the FL is BCL6+ with a percent nuclear positivity score for BCL6 in an IHC test of greater than or equal to 30%.

557. The method of any one of claims 507-556, wherein the FL has an EZH2 dysregulation.

558. The method of claim 557, wherein the EZH2 dysregulation is an EZH2 Y646X mutation, an EZH2 Y666X mutation, an EZH2 A682X mutation, an EZH2 A692X mutation, or a combination thereof.

559. The method of claim 558, wherein the EZH2 dysregulation is an EZH2 Y646C mutation, an EZH2 Y646F mutation, an EZH2 Y646H mutation, an EZH2 Y646N mutation, an EZH2 Y646S mutation, an EZH2 Y666N mutation, an EZH2 A682G mutation, an EZH2 A692V mutation, or a combination thereof,560. The method of any one of claims 507-559, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose selected from the group consisting of: 25 mg, 30 mg, 50 mg, 70 mg, 75 mg, 100 mg, and 150 mg, wherein the dose is administered once or twice per day.

561. The method of claim 560, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 30 mg, wherein the dose is administered once or twice per day.Docket No. TRLN-013-037WO1 / TLS-077WO 562. The method of claim 560, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 50 mg, wherein the dose is administered once or twice per day.

563. The method of claim 560, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 70 mg, wherein the dose is administered once or twice per day.

564. The method of claim 560, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 100 mg, wherein the dose is administered once or twice per day.

565. The method of claim 560, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered at a dose of 150 mg, wherein the dose is administered once or twice per day.

566. The method of any one of claims 560-565, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered once per day.

567. The method of any one of claims 560-565, wherein the dose of Compound 132a, or a pharmaceutically acceptable salt thereof, is administered twice per day.

568. The method of any one of claims 507-567, wherein Compound 132a, or a pharmaceutically acceptable salt thereof, is administered with food.