Compositions and methods for NK-92 cells expressing native CD16
Patent Information
- Application Number
- PCT/IB2025/052949
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2025-03-20
- Publication Date
- 2026-09-24
Smart Images

Figure IB2025052949_24092026_PF_FP_ABST
Abstract
Description
Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001COMPOSITIONS AND METHODS FOR NK-92 CELLS EXPRESSING NATIVE CD16
[0001] This application claims priority to our copending US provisional patent application with the serial number 63 / 567,784, which was filed March 20, 2024, and which is incorporated by reference herein.Sequence Listing
[0002] The content of the XML file of the sequence listing named 104077.0027.xml, which is 8,615 bytes in size was created on March 17, 2025 and electronically submitted via EFS-Web along with the present application and is incorporated by reference in its entirety.Field of the Invention
[0003] The field of the invention is recombinant nucleic acids and cells, especially as they relate to the generation of NK-92 cells that natively express high affinity CD 16 and optionally intracellularly retained IL-2.Background of the Invention
[0004] The background description includes information that may be useful in understanding the present invention. It is not an admission that any of the information provided herein is prior art or relevant to the presently claimed invention, or that any publication specifically or implicitly referenced is prior art.
[0005] All publications and patent applications herein are incorporated by reference to the same extent as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. Where a definition or use of a term in an incorporated reference is inconsistent or contrary to the definition of that term provided herein, the definition of that term provided herein applies and the definition of that term in the reference does not apply.
[0006] In order to test the ADCC-enabling properties of a given antibody in an in vitro setting, effector cytotoxic cells that express CD 16 (FCGRA3) are required, and CD 16-positive NK cells obtained from peripheral blood have traditionally been used for such purpose. However, the genetic diversity between donors in terms of CD16 isoforms (e.g., 158F and 158V) and ofAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001NK-cell cytotoxic activity generates substantial variability in ADCC assays using such cells. Moreover, since the different CD 16 isoforms have different affinities for binding antibodies, characterization of a particular antibody generally requires cumbersome genotyping of the donors to determine their 158 F / V zygosity. Although individuals homozygous for the high affinity isoform of the CD 16 receptor (V / V) are the most likely to benefit from monoclonal antibody therapy, the majority of the general population (-80%) is either heterozygous (V / F), or homozygous for the low affinity version (F / F).
[0007] The NK-92 cell line is well suited for lab testing in that it offers a reliable source of effector cells, however, NK-92 cells do not naturally express CD 16. NK-92 cells engineered to overexpress a CD16 transgene (158V or 158F) have strong ADCC capabilities and provide consistency between assays. Unfortunately, such engineered NK-92 cells are known to spontaneously kill a wide range of targets, leading to a low signal -to-noise ratio between ADCC and natural cytotoxicity background.
[0008] Therefore, to test ADCC activity of a given antibody in a model that is more readily applicable to the clinic, NK cells have been used that are engineered to express a transgene CD 16 158V or 158F. However, the currently available NK-92 cells having transgenic CD 16 are subject to selective pressure, and as a result CD16 expression is lost within a few weeks.
[0009] It is difficult to determine the true benefits of a given antibody by measuring ADCC activity in cells that express a transgene CD 16 158V or 158F. Using NK cells isolated from the peripheral blood of human donors is a more representative alternative, but the process is generally cumbersome and expensive. Moreover, such tests will typically be at the mercy of donor-to-donor variability in NK cells quality.
[0010] Thus, even though various NK cells and methods are known in the art, all or almost all of them suffer from several drawbacks. Therefore, there remains a need for improved NK cells with predictable cytotoxicity, low non-specific cytotoxicity, and with homogenous expression of the native CD 16 158V allele.Summary of the Invention
[0011] The present disclosure provides novel recombinant NK-92 cells engineered for homogenous expression of the native CD 16 158V allele that have predictable cytotoxicity and low non-specific cytotoxicity. These recombinant NK-92 cells offer improved performanceAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001over conventional NK-92 cell models, including stable homogenous CD 16 expression, reduced background cytotoxicity, and more predictive ADCC results, making them especially suited for preclinical testing of therapeutic antibodies.
[0012] In one aspect, the invention provides a recombinant NK-92 cell comprising a recombinant promoter sequence positioned upstream of a gene encoding a native CD 16 allele, where the recombinant promoter is operably coupled to the gene to enable expression of CD 16. The recombinant promoter may be a constitutive promoter, including but not limited to nonhuman promoter sequences, such as the spleen focus forming virus (SFFV) promoter. The recombinant promoter may replace an inactive native CD 16 promoter, thereby restoring native CD 16 expression in NK-92 cells.
[0013] In some embodiments, the recombinant NK-92 cell comprises the native CD 16 allele which is heterozygous (both 158V and 158F variants of CD 16), but the cells express only the CD 16 158V variant.
[0014] The recombinant NK-92 cells of the present invention are engineered to remain viable and maintain consistent CD 16 expression for at least six months, ensuring reliability and reproducibility in long-term studies and assays.
[0015] In additional embodiments, the recombinant NK-92 cells may further comprise a recombinant nucleic acid encoding an intracellularly retained cytokine, such as interleukin-2 (IL-2) or endoplasmic reticulum-retained IL-2 (er-IL-2). These cytokines are expressed in a manner that supports cell survival without substantial secretion into the culture medium, with secreted IL-2 levels maintained below 5,000 pg / mL, thereby minimizing unintended effects on co-cultured target cells during ADCC assays.
[0016] Moreover, the recombinant NK-92 cells may also comprise antibiotic resistance genes and / or reporter genes for selection and tracking purposes.
[0017] The recombinant NK-92 cells express CD 16 on their cell surface, enabling binding to the Fc region of antibodies in ADCC assays. Importantly, these cells demonstrate functional ADCC activity against target cells expressing a cognate antigen when bound by an antibody, and they exhibit lower background (non-ADCC) cytotoxicity and reduced signal -to-noise ratio compared to non-recombinant parental NK-92 cells, thereby improving the accuracy and predictive value of ADCC measurements.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0018] In another aspect, the invention provides cell lines and compositions comprising a plurality of the recombinant NK-92 cells described herein, enabling scalable production for research and industrial applications.
[0019] Further, provided are methods of testing antibodies, including therapeutic IgG antibodies for human use. The method comprises: providing a plurality of target cells expressing an antigen of interest; providing a plurality of recombinant NK-92 cells, or a cell line or composition comprising such cells; combining the target cells and recombinant NK-92 cells in the presence of an antibody that binds to the target antigen; and measuring ADCC against the target cells.
[0020] Preferably, the assay is conducted under conditions in which the target cells are not substantially exposed to cytokines secreted by NK-92 cells, avoiding cytokine-mediated artifacts. The effector-to-target (E:T) ratio of NK-92 cells to target cells may range from 0.1:1 to 50:1, including preferred sub-ranges such as 1:1 to 40:1, 5:1 to 20:1, and 10:1 to 20:1, depending on assay requirements. Notably, the method is designed to generate more predictive and accurate ADCC data than assays using NK-92 cells transgenically overexpressing high-affinity CD 16.
[0021] Additionally, the invention provides methods for generating recombinant NK-92 cells, comprising: providing a NK-92 cell line; and introducing a recombinant promoter sequence upstream of a native CD 16 allele, preferably via electroporation, to create the recombinant NK-92 cell.
[0022] In summary, the present disclosure provides a next-generation NK-92 cell platform for ADCC assays and other therapeutic or research uses, addressing limitations of current NK cell models by delivering consistent functional homogenous expression of the native CD 16 158V allele with minimal assay interference from non-specific effects.Brief Description of The Drawing
[0023] FIG.l is an exemplary schematic illustration for promotor replacement in NK-92 to produce the recombinant cells according to the inventive subject matter.
[0024] FIG.2 depicts exemplary FACS results for cell enrichment of the recombinant cells generated according to FIG.1.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0025] FIG.3 depicts exemplary results for ADCC against target cells expressing CD20 using haNK cells and recombinant NK-92 cells according to the inventive subject matter.
[0026] FIG.4 depicts exemplary lentiviral polycistronic transgenes used for transfection of the recombinant NK-92 cells according to the inventive subject matter.
[0027] FIG.5 depicts exemplary FACS results for expression of CD 16 in selected clones after limiting dilution cloning.
[0028] FIG.6 depicts exemplary cytotoxicity results of aNK cells and selected clones of FIG.5 against target cells.
[0029] FIG.7 depicts exemplary luciferase expression results of selected clones of FIG.5.
[0030] FIG.8 depicts exemplary results for IL-2 release into the medium of selected clones of FIG.5.
[0031] FIG.9 depicts exemplary results for ADCC against target for selected clones of FIG.5 with target specific and non-target specific antibodies.
[0032] FIG.10 depict exemplary FACS results for comparative transfection of NK-92CI cells.
[0033] FIG.ll depict exemplary FACS results for comparative transfection of NK-92CI cells.
[0034] FIG.12 depict exemplary that the recombinant NK-92 cells disclosed herein maintains high cell viability and consistent CD 16 expression in long term continuous culture.
[0035] FIG.13 depict exemplary the detection of CD16A allelic variants by sequencing.
[0036] FIG.14 depict exemplary the determination of CD16A allelic variations in NK-92 cells from DNA sequencing.
[0037] FIG.15 depict exemplary the determination of CD16A allelic variations in NK-92 cells from RNA sequencing.
[0038] FIG.16 depict exemplary RNAseq results.
[0039] FIG.17 depict exemplary quantification of CD 16 density in the cell.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0040] FIG.18 depict exemplary NKG2D-PE MACS Column Depletion post CRISPR Knock Out (KO) to increase NKG2D depleted populations.
[0041] FIG.19 depict exemplary NKG2D-Ligand expression on K562, Daudi, and Ramos cells.
[0042] FIG.20 depict exemplary cytotoxicity against Ramos cells upon NKG2D KO.
[0043] FIG.21 depict exemplary cytotoxicity against K562 upon NKG2D KO.
[0044] FIG.22 depict exemplary ADCC against Sup-B-15-CD19-CD20+ upon NKG2D KO.
[0045] FIG.23 depict exemplary cytotoxicity characterization against K562 and Ramos cells.Detailed Description
[0046] The inventors have now discovered that NK-92 cells can be genetically modified to form cells that express endogenous (native) homogenous CD 16 158V by genetically replacing the native silenced promotor sequence with a replacement promotor that is preferably constitutive. Moreover, the cells presented herein will advantageously also recombinantly express an intracellularly retained cytokine to so confer autotrophy, and most typically, the cytokine will not be secreted to a degree that would otherwise affect the behavior of a target cell (as would be the case, for example, with NK-92MI cells that recombinantly express a secreted cytokine and that produces it in substantial quantities.
[0047] On this backdrop, the inventors devised a way to generate an NK-92 cell line that express their endogenous CD 16 (FCGR3 A) gene and that have a substantially improved signal -to-noise ratio for ADCC testing. Moreover, it should be recognized that the so modified NK-92 cells express only the native CD16 158V allele (but not the CD16 158F allele), and because the so modified NK-92 cells were created by inserting a promoter in front of the native gene, potential natural post-transcriptional regulations are conserved. Therefore, these cells are uniquely suited for laboratory use for discerning differences in the potency of two mAbs that would otherwise be missed when using the currently available NK-92 cells (for example, NK-92, NK-92 CI, or NK-92MI). Viewed from a different perspective, it should be recognized that with endogenous CD 16 expression as presented herein, the recombinant NK-92 cells are better suited for an ADCC assay as they will have an improved signal-to-noise ratio (due to lower non-specific cytotoxicity).Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0048] Where desired, these cells can also be subjected to lentiviral transduction to express a secreted or non-secreted version of the cytokine IL-2, along with a luciferase reporter and a puromycin antibiotic resistance gene. IL-2 expressing NK-92 are highly advantageous in culture as they do not require addition of exogenous cytokine. However, high level of IL-2 secretion (such as displayed by NK-92.MI cells) is not desirable as it could interfere with in vitro and in vivo assays.
[0049] In addition to the expression of native homogenous CD 16 158V (or as an alternative), the inventors further contemplate that (i) adding inhibitory KIRs such as KIR2DL1 / 2 would be one way to inhibit the balance of native activating receptors while not affecting the ability of receptors such as FcGRIIIa (as well as CARs) to activate killing. In such a setting, the signal-to-noise ratio would be increased; (ii) knock out expression of the NKG2D activating receptor can be performed. This would also increase the signal-to-noise ratio would be favorably pushed towards signal while not affecting the ability of receptors such as FcGRIIIa (as well as CARs) to activate killing.
[0050] The term “homogenous expression” or “homogenous CD 16 158 V” as used herein refers to selective expression of the 158V allele of CD 16, but not the 158F allele. In an embodiment, “homogenous expression” or “homogenous CD 16 158V” refers to selective expression of less than 10%, or less than 5%, or less than 1% of the 158F allele, and further refers to selective expression of more than 90%, or more than 95%, or more than 99% of the 158V allele.
[0051] Moreover, when making the cells according to the inventive subject matter, it should be recognized that clonal selection will allow preparation of tailored modified cells that have a desirably (and selectably) low level of test interference by cytokines otherwise encountered (either needed in heterotrophic cell lines or leaked from autotrophic cell lines) and cell lines with desirably (and selectably) high signal-to-noise ratio. In this context it should be noted that IL-2 or IL15 secretion in the medium can be kept below 5,000 pg / mL, or 3,000 pg / mL, or 1,000 pg / mL, and even lower. As such, contemplated cells will not interfere with in vivo effector cells and not create systemic effects on lab animals (e.g., systemic IL-2 toxicity in mice).
[0052] Finally, it is contemplated that the cells as presented herein will have a viability (and even capacity to proliferate) that is sufficiently long to allow commercial use. For example, unfrozen cells will have minimum viability of at least 2 weeks, or at least 4 weeks, or at least 7 weeks, or at least 3 months, or at least 6 months, and even longer. Moreover, the cellsAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001presented herein can be frozen for several weeks or months and thawed while maintaining their cytotoxic and ADCC properties.
[0053] In still further contemplated aspects, the inventors also consider additional genomic alternations to push the balance between activating and inhibiting receptors towards less activation (e.g., via knock out expression of the NKG2D activating receptor). This would also increase the signal-to-noise ratio would be favorably pushed towards signal while not affecting the ability of receptors such as FcGRIIIa (as well as CARs) to activate killing.
[0054] As detailed throughout this disclosure, provided herein are recombinant NK-92 cells engineered to include a recombinant promoter sequence positioned upstream of a gene encoding a native CD 16 allele. This recombinant promoter sequence is operably linked to the CD 16 gene, thereby enabling and driving the expression of native CD 16 on the NK-92 cell surface. Preferably, the recombinant promoter sequence is a constitutive promoter, allowing for continuous gene expression under standard conditions, and most preferably, this constitutive promoter is a Spleen Focus Forming Virus (SFFV) promoter. The SFFV promoter sequence contemplated herein has the sequence according to SEQ ID NO: 1.
[0055] In certain embodiments, the recombinant promoter sequence replaces a non-functional or inactive native promoter sequence, effectively restoring native CD 16 gene expression.
[0056] The recombinant NK-92 cell disclosed herein contains a native CD 16 allele that is naturally heterozygous, meaning it carries both the 158F (SEQ ID NO:2) and 158V (SEQ ID NO: 3) variants. However, unexpectedly, the inventors found that incorporation of the recombinant promoter leads to preferential expression of only the 158V variant on the cell surface, resulting in homogenous expression of the 158V allele, while the 158F allele is not expressed. This selective expression of CD 16 158V was surprising and offers advantages for therapeutic applications that require high-affinity CD16-mediated functions.
[0057] Additionally, it was found that the recombinant NK-92 cells described in this disclosure remain viable for a prolonged period of at least six (6) months or up to 200 days, demonstrating no loss of cell health or function during this time. Furthermore, these cells exhibit stable and consistent expression of CD 16 throughout this duration, confirming the reliability of the recombinant promoter system to maintain CD 16 expression long-term. CD 16 expression is maintained without a selection pressure.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0058] In some embodiments, the recombinant NK-92 cell disclosed herein may additionally comprise a recombinant nucleic acid molecule encoding an intracellularly retained cytokine, which enhances the cell’s function and viability. Preferably, this intracellularly retained cytokine is interleukin-2 (IL-2). In specific embodiments, the IL-2 protein is engineered to be expressed with a signal peptide sequence that directs the IL-2 to the endoplasmic reticulum (ER), thereby producing ER-retained IL-2 (erIL-2).
[0059] The localization of IL-2 to the ER enables intracellular accumulation of IL-2 at levels sufficient to sustain autocrine signaling, which supports NK-92 cell growth and survival without significant extracellular secretion of IL-2. This approach prevents undesired paracrine effects and systemic cytokine exposure. See Konstantinidis et al., “Targeting IL-2 to the endoplasmic reticulum confines autocrine growth stimulation to NK-92 cells,” Exp. Hematol.2005 Feb;33(2): 159-64, as well as WO2019226708 and W02020028656, each incorporated herein by reference in their entirety.
[0060] A representative IL-2 polypeptide sequence is provided in SEQ ID NO:4, and a representative erIL-2 polypeptide sequence is shown in SEQ ID NO:5. Preferably, when cultured under standard conditions, the recombinant NK-92 cells secrete no more than 5,000 pg / mL of IL-2 into the culture medium, ensuring minimal extracellular cytokine levels while maintaining robust autocrine signaling for sustained activity.
[0061] In additional embodiments, the recombinant NK-92 cell may also harbor a recombinant nucleic acid encoding an antibiotic resistance gene and / or a reporter gene. The antibiotic resistance gene, confers resistance to antibiotics like puromycin and serves as a positive selection marker, enabling selective growth of genetically modified cells under antibiotic pressure.
[0062] Furthermore, a reporter gene may be included to facilitate the tracking and quantification of gene expression or regulatory sequence activity. Such reporter genes typically encode detectable signals, such as fluorescent proteins (e.g., GFP) or enzymes (e.g., luciferase), providing an essential tool for monitoring transgene expression and functional studies of the recombinant cells.
[0063] Functionally, the recombinant NK-92 cells described herein are designed to mediate antibody-dependent cellular cytotoxicity (ADCC) against target cells that express a specific antigen. In this context, the target antigen is recognized and bound by an antibody, which inAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001turn engages the CD 16 receptor (expressed on the recombinant NK-92 cell surface), triggering ADCC and subsequent target cell lysis.
[0064] Importantly, relative to non-recombinant NK-92 cells (e.g., ATCC CRL-2407), the recombinant NK-92 cells of the present disclosure demonstrate a reduced signal-to-noise ratio during ADCC assays, indicating more specific and efficient cytotoxic activity with minimized background effects. Furthermore, these recombinant NK-92 cells exhibit reduced non-ADCC (off-target) cytotoxicity, enhancing the safety and selectivity of their therapeutic potential compared to unmodified NK-92 cells. This could be due to the polymorphism within the nucleic acid encoding CD 16, which results in 197T to 197A. With this mutation, there is reduced spontaneous cytotoxicity which in turn improves the signal to noise ratio.
[0065] Also provided herein is a cell line comprising a population of recombinant NK-92 cells as described throughout this disclosure, which can be stably maintained and expanded for research and therapeutic applications.
[0066] Further provided is a composition comprising a plurality of recombinant NK-92 cells, formulated for use in various applications, including but not limited to immunotherapy, adoptive cell transfer, and preclinical research.
[0067] In another aspect of the present disclosure, provided herein is a method for evaluating the activity and efficacy of an antibody, particularly for therapeutic use, through an antibodydependent cellular cytotoxicity (ADCC) assay. The method comprises: (1) Providing a population of target cells that express a specific antigen of interest; (2) Providing a population of recombinant NK-92 cells, as described throughout this disclosure, which are genetically engineered to express a native CD 16 allele under the control of a recombinant promoter; (3) Combining the target cells and recombinant NK-92 cells in the presence of an antibody capable of specifically binding to the antigen expressed on the target cells; and (4) Measuring the ADCC activity directed against the target cells to evaluate the functional activity of the antibody.
[0068] In certain embodiments, the antibody to be tested is an IgG isotype intended for therapeutic use in humans. Preferably, the target cells are not substantially exposed to cytokines secreted by the recombinant NK-92 cells, such that the measured cytotoxicity primarily reflects ADCC rather than cytokine-mediated effects.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0069] In various preferred embodiments, the ratio of recombinant NK-92 effector cells to target cells is selected to optimize assay sensitivity and specificity. Suitable effector-to-target (E:T) cell ratios include, but are not limited to, ratios between 0.1:1 and 50: 1, or between 1 : 1 and 40:1, or between 5:1 and 20:1, or between 10:1 and 20:1.
[0070] Advantageously, the disclosed method generates results that are more predictive of in vivo human responses than comparable assays using NK-92 cells engineered to express a transgene encoding a high-affinity CD 16 variant. Thus, the method enables more accurate assessment of antibody candidates in a preclinical setting.
[0071] In another aspect, also provided herein is a method for producing a recombinant NK-92 cell useful for ADCC-based assays and other applications. The method comprises: (1) Obtaining an NK-92 cell line, such as a cell line deposited with the American Type Culture Collection (ATCC) under Deposit No. CRL-2407; and (2) Introducing into the NK-92 cell a recombinant promoter sequence positioned upstream of a gene encoding a native CD 16 allele, thereby enabling controlled expression of CD 16 and generating a recombinant NK-92 cell with optimized CD 16 expression; and wherein the recombinant promotor sequence is operably coupled to the gene to thereby enable expression of the native CD 16.
[0072] Preferably the recombinant nucleic acid comprising the SFFV promoter sequence is introduced or delivered to the NK-92 cell via electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004 / 0014645, US 2005 / 0052630A1, US 2005 / 0070841 Al, US 2004 / 0059285A1, US 2004 / 0092907A1. The various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No. 6,678,556, U.S. Pat. No. 7,171,264, and U.S. Pat. No. 7,173,116. Apparatus for therapeutic application of electroporation are available commercially, e.g., the MedPulserTM DNA Electroporation Therapy System (Inovio / Genetronics, San Diego, Calif.).
[0073] The recombinant NK-92 cells produced by this method are suitable for use in antibody functional assays, including ADCC measurements, and provide advantages over existing NK-92 models.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001
[0074] The examples below are intended to further illustrate certain aspects of the compositions and methods described herein and are not intended to limit the scope of the claims.Example 1
[0075] NK-92 cells (whether wild type or NK-92.CI cells) were electroporated with a DNA construct encoding the spleen focus-forming virus (SFFV) promoter with a Kozak sequence flanked with DNA sequences homologous to the region of the FCGR3A gene overlapping the translational start codon (ATG), along with ribonucleoparticle complexes (RNPs) formed by Cas9 protein and guide RNA molecules targeting the genomic region immediately upstream of the FCGR3A gene translational start codon. Through homologous recombination, the SFFV promoter and Kozak sequence are integrated directly upstream of the FCGR3A gene translational start codon and constitutively drives expression of the native CD 16a protein. A schematic illustration for this is shown in FIG.l.
[0076] After a period of recuperation, the electroporated cells were screened for CD 16 expression by flow cytometry, and CD 16-positive cells were isolated by FACS or by several rounds of immunomagnetic column enrichment. Exemplary results for this screening and isolation are depicted in FIG.2. Purified CD16-expressing NK-92 cells were then tested and performed strong in an ADCC test as can be seen from FIG.3. Notably, the recombinant cells performed comparably to aNK cells expressing a high affinity CD 16 158V transgene (haNK cells (see e.g., Oncotarget 2016 Dec 27;7(52):86359-86373)).
[0077] Purified CD16-expressing NK-92 cells were transduced with lentiviral vectors encoding a polycistronic transgene that drives co-expression of a Luciferase reporter protein, a puromycin resistance protein, and the cytokine IL-2 in a secreted or non-secreted (ERIL2) form. The three proteins are separated by 2A sequences and are organized in the following orders from 5’ to 3 ’as is shown in FIG.4. In case 1) ERIL-2 was placed in third position so that the ER-retention signal is not fused to any 2 A peptide that may interfere with its function. In case 2) IL-2 is placed in second position, a position that has been shown to yield the lowest amount of peptide release and fused to a 2A peptide at its C-terminus, which is likely to interfere with its function. Both characteristics were intended to decrease the overall amount and activity of secreted IL-2. Transduced cells were selected in the presence of puromycin and in the absence of IL-2. Selected, transduced CD16-expressing NK-92 cells underwent oneAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001round of limiting dilution cloning. Several surviving clones were expanded and screened for CD 16 expression and their natural cytotoxic properties against the K562 cell line. A number of clones displayed markedly decreased natural cytotoxicity compared to the parental NK-92 wild-type cell line, and exemplary results are shown in FIG.5.
[0078] As will be readily appreciated, the Luciferase and puromycin sequences were used for culture purification in the case of puromycin and in the case of luciferase, for bioluminescence that can be useful for in vivo imaging or for in vitro proliferation assays. Despite the fact that Luciferase and IL-2 are both encoded in the same viral transgene, transduced CD16-expressing NK-92 clones displayed variable luciferase expression while being able to grow well in absence of IL-2, and exemplary results are shown in FIG.6 and FIG.7.
[0079] Notably, transduced CD16-expressing NK-92 clones with low natural cytotoxicity background maintained their ability to perform efficiently in ADCC as can be seen from FIG.8.Here, average IL-2 expression in clones ranges from 455 pg / mL to 14,500 pg / mL which is equivalent to 7.7 IL-2 units (U) to 256 IL-2 U; NK-92MI have high levels of IL-2 ~ 35,000 pg / mL corresponds to ~ 600 U of IL-2. Clones with less cytotoxicity compared to NK-92 are shown in red. (Note: 1 pg IL-2 =16,900 Units of IL-2).
[0080] While some of the methods used employed standard practices, it should be noted that the results were not readily predictable. In particular, the promotor sequence didn’t work in an earlier model to fully express CD 16, while it did work poorly in NK-92 CI cells. Consequently, the inventors assumed that poor performance could also be expected in wildtype NK-92 cells.FIG.10 and FIG.ll provide exemplary transfection results for NK-92CI cells (which did also not work in a reference cell line: HK293T). Unexpectedly, however, the inventors succeeded in generating the modified NK-92 cells as described herein with superior characteristics as shown herein.Example 2: High cell viability and consistent CD16 expression
[0081] The inventors performed cell viability experiments on the modified recombinant NK-92 cells having the SFFV promoter. They found that following a freeze-thaw process, only a subset of the selected NK-92 CD16 IL2+clones survived, which were clones 1C9, 4G5, and 3B2. These surviving clones were subsequently characterized for cell viability and stability of CD16 expression under long-term culture conditions. Specifically, cell health was assessed by measuring cell viability every two weeks throughout the six-month period. Furthermore, CD 16Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001expression was monitored every two weeks throughout the six-month period. The results are shown in FIG.12. The inventors found that over the monitoring period of six months, all three clones exhibited sustained high cell viability and consistent CD 16 expression without any detectable loss. Notably, this stability was maintained without the need for selection pressure, demonstrating the robustness and adaptability of these engineered clones. The term “high cell viability” refers to cell viability of at least 80%, or preferably at least 90%, more preferably at least 95%, and most preferably up to 100%. The term “consistent CD16 expression” refers to CD16 expression that does not decrease over time. For example, as shown in FIG.12, CD16 expression of the modified NK-92 cells having the SFFV promoter exhibit a reasonably stable CD 16 expression over the entire testing period of over 200 days, varying no more than about 20% at any given time as compared to initial expression levels.
[0082] Thus, the inventors unexpectedly found that the insertion of the SFFV immediately upstream of the FCGR3A gene translational start codon leads to high cell viability and drives the stable and consistent expression of CD 16 throughout the life of the modified recombinant NK-92 cells.Example 3: Expression of the CD16158V variant
[0083] As discussed previously, the native CD 16 gene in NK-92 cells typically encode both the 158V and 158F variants of CD16 (corresponding to position 176 in SEQ ID NO:2 and SEQ ID NO:3 of the full-length form of the CD16 polypeptide comprising the signal sequence). However, as the native CD 16 promoter is inactive, there is no detectable transcription, and no mRNA reads. This is shown in top panel of FIG.13. Because NK-92 cells do not express the CD16 Fc receptor, they are not capable ofNK-mediated ADCC lysis oftumor cells employing monoclonal antibodies (MAbs) of the immunoglobulin G1 (IgGl) isotype.
[0084] The inventors activated the native CD 16 gene in the presently disclosed engineered NK-92 clones by placing a SFFV promoter upstream of the CD 16 gene (bottom panel of FIG.13). It was expected that the activation of the native CD16 gene would lead to heterozygous expression of both the 158V and 158F variants. This belief was because NK92 cells typically possess both the 158V and 158F variants of CD16, which led to the engineering of the haNK (high affinity NK) cells to express the CD 16 high affinity FcyRIIIa (158V) receptor. See Jochems C. et al., Oncotarget. 2016; 7: 86359-86373. This was further verifiedAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001via DNA sequencing which showed that the two alleles (158V and 158F) are in approximately 1:1 ratio (FIG.14).
[0085] Unexpectedly, however, Bulk RNA sequencing analysis, revealed that the engineered clones disclosed herein (with the SFFV promoter) exclusively expressed the 158V allele but not the 158F allele. This surprising result is shown in FIG.15 and FIG.16, where the inventors surprisingly found from sequencing data that that all engineered clones (1C9, 3B2, 4G5) exclusively expressed the CD16 158V allele, with no detectable expression of the 158F variant. This surprising result suggests a selective activation or stabilization of the 158V form in the presently disclosed modified recombinant NK-92 cells.
[0086] The CD 16 158V allele in NK-92 cells confers enhanced NK-mediated ADCC lysis of tumor cells employing antibodies of the IgGl isotype as compared to the CD 16 158F allele. See Jochems C. et al., Oncotarget. 2016; 7: 86359-86373. Thus, the presently disclosed modified recombinant NK-92 cells having a SFFV promoter upstream of the CD 16 gene confers enhanced ADCC functionality, offering a novel and advantageous approach for therapeutic and / or diagnostic and testing applications.
[0087] Additionally, the inventors have identified a mutation at position 197 of CD 16, resulting in the expression of the L66H mutation. This mutation has been associated with decreased spontaneous cytotoxicity without affecting ADCC (Grier et al., , Human Immunodeficiency-Causing Mutation Defines CD 16 in Spontaneous NK Cell Cytotoxicity, J. Immunol, 1999). Thus, the presently disclosed recombinant NK-92 cells have reduced spontaneous cytotoxicity, thereby improving the signal to noise ratio when the ADCC of an antibody candidate is tested. Compare with Binyamin et al. J Immunol. 2008;180(9):6392-6401, and US20060292156, each of which are incorporated by reference herein in its entirety.Example 4: CD16 Density
[0088] The inventors quantified the CD16 density in the engineered clones (1C9, 3B2, 4G5) using a Qifikit assay. The Qifikit assay quantifies surface protein expression by correlating fluorescence intensity to known antibody-binding capacities, thereby enabling the inventors to measure CD16 molecules per cell. The results, shown in FIG.17, demonstrated that these clones expressed higher levels of CD 16 compared to the cells disclosed in Grier et al, The Journal of Clinical Investigation, Volume 122 Number 10 October 2012, which were generated via retroviral transduction and maintained a higher CD 16 expression level compared to haNKAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001cells, which were created using a non-viral approach. This finding highlights the superior stability and expression efficiency of the presently disclosed engineered clones.Example 5: NKG2D knockout data
[0089] The inventors knocked down the activating receptor NKG2D in NK92 cells and Clone 3B2 with the aim of reducing spontaneous cytotoxicity. Following depletion of the NKG2D-positive population, the knockout efficiency was validated, as illustrated in FIG.18. FIG.19 demonstrates expression ofNKG2D ligand on different targets. K562 and Ramos were selected since they express NKG2D ligands.
[0090] This targeted modification was designed to minimize background cytotoxicity while preserving ADCC functionality, optimizing these engineered clones for applications where reduced spontaneous activity is desirable. The inventors evaluated the cytotoxicity of the NKG2D -knockdown cells against the highly sensitive K562 and moderately sensitive Ramos cell lines (FIG.20 and FIG.21). The results showed a minor reduction in cytotoxicity against Ramos for NK92 cells following NKG2D depletion and no changes in K562 cytotoxicity. However, in clone 3B2, cytotoxicity levels remained unchanged, which illustrates that its killing mechanisms are less dependent on NKG2D signaling.Example 6: Cytotoxicity data
[0091] The inventors assessed the cytotoxicity of the engineered clones against a range of target cell lines, including the highly sensitive K562 as well as the moderately sensitive Ramos cells. This is illustrated in FIG.19, FIG.20, FIG.21 and FIG.22. This extensive characterization ensured that the clones maintained their functional properties across diverse target profiles. Notably, these clones retained their key characteristics before and after the freeze-thaw process, demonstrating their robustness.
[0092] ADCC was tested against SUP-B-15 expressing CD20 using Rituximab or control antibody Herceptin. It was found that ADCC is not affected upon NKG2D knockdown of haNK and Clone 3B2 (FIG.22).
[0093] Following further evaluation, two clones were selected based on their distinct functional traits: Clone 1C9 was chosen for its lower cytotoxicity and high luciferase expression, while Clone 3B2 was selected for its cytotoxicity levels comparable to NK92 cellsAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001but with lower luciferase expression. These clones represent optimal candidates for different functional applications, providing flexibility based on therapeutic or research needs.
[0094] The lower cytotoxicity of Clone 1C9 results in a reduced background signal, leading to an improved signal -to-noise ratio.Example 7: Methods
[0095] The materials and reagents used in the DNA electroporation for Knock-In of SFFV Promoter at CD 16 Locus in NK-92 Cells are as follows:
[0096] Reagents:
[0097] Stock solutions:
[0098] Reagents for media preparation:
[0099] Media used: X VIVO 10 + 5 % Human serumAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001[OO1OO] Equipment:
[0102] Cell Line: NK-92 cells, cultured in X-VIVO with 5% Human Serum and IL-2 (500 lU / mL).
[0103] Donor DNA: Donor Plasmid is designed to ensure efficient knock in of SFFV promoter at CD 16 gene locus, plasmid is assembled by gene synthesis. It contains SFFV promoter flanked by CD 16 homology arms, PAM site specific to sgRNA AJ is mutated to prevent cleavage of donor DNA when sgRNA AJ is electroporated. Flanking CD 16 homology arm contains a unique sequence that allows sgRNA 1 to linearize plasmid inside the cell post electroporation. An exemplary Donor DNA construct design is shown in SEQ ID NO:6. In this sequence nt 1-23 represents the SgRNA 1 Sequence, nt 24-350 represents 5’ homology arm with mutated PAM, nt 351-784 is the SFFV promoter, nt 785-1093 represents the 3’ homology am, and nt 1094-1116 represents the SgRNA 1 Sequence. The presence of these different elements in the nucleotide sequence are important element for successful knock in, and the homology arms allow the SFFV promoter to be inserted precisely.
[0104] HDR Knock-In (SFFV Promoter Insertion): Maintain NK-92 cells at a density of 0.5-1 x 106cells / mL in with IL-2 (500 lU / mL) in X VIVO 10 + 5 % Human serum. Take volume of aNK cells equal to 4 million cells, Spin down at 300 g for 5 minutes, then aspirate off media. Add 5mL of IX D-PBS and repeat this step twice. Suspend the cells in R buffer 80 pl / 4 million cells. Prepare Cas9-sgRNA complex for SgRNA AJ by mixing 3 pL Cas9 (62pM stock) + 2 pL of 1XPBS buffer per reaction; combine 5ul of sgRNA AJ (44pM) with 5pl of above cas9 suspension- Incubate for 30 mins at Room temperature (RT). Prepare second Cas9-sgRNA complex by mixing 1.2pl Cas9 (62pM stock) + 0.8 pL of 1XPBS buffer per reaction; combine 2ul of sgRNA 1 (44pM) with 2pl of above cas9 suspension- Incubate for 30 mins atAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001RT. Assemble electroporation mix by adding 14pL of RNP complex, 4pg of Donor template, electroporation enhancer was diluted to 10.8pM in R buffer, cell suspension ( 4 million cells) in 80pL , total volume 116 pL. Pipette in lOOpL of above cell mix very slowly without creating any bubbles using NEON lOOpl neon electroporation tips. Place pipette with electroporation tip in cuvette containing 3.5ml electroporation buffer E. Electroporate using following parameters: 1600V, 10ms, 3 pulses Resuspend cells in 4ml pre-warmed in X VIVO 10 + 5 % Human serum with HDR enhancer at luM final concentration.
[0105] In some embodiments, the numbers expressing quantities of ingredients, properties such as concentration, reaction conditions, and so forth, used to describe and claim certain embodiments of the invention are to be understood as being modified in some instances by the term “about.” As used herein, the terms “about” and “approximately”, when referring to a specified, measurable value (such as a parameter, an amount, a temporal duration, and the like), is meant to encompass the specified value and variations of and from the specified value, such as variations of + / -10% or less, alternatively + / -5% or less, alternatively + / -!% or less, alternatively + / -0.1% or less of and from the specified value, insofar as such variations are appropriate to perform in the disclosed embodiments. Thus, the value to which the modifier “about” or “approximately” refers is itself also specifically disclosed. The recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.
[0106] All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., “such as”) provided with respect to certain embodiments herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the invention.
[0107] As used in the description herein and throughout the claims that follow, the meaning of “a,” “an,” and “the” includes plural reference unless the context clearly dictates otherwise. Also, as used in the description herein, the meaning of “in” includes “in” and “on” unless the context clearly dictates otherwise. As also used herein, and unless the context dictates otherwise, the term “coupled to” is intended to include both direct coupling (in which twoAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001elements that are coupled to each other contact each other) and indirect coupling (in which at least one additional element is located between the two elements). Therefore, the terms “coupled to” and “coupled with” are used synonymously.
[0108] It should be apparent to those skilled in the art that many more modifications besides those already described are possible without departing from the inventive concepts herein. The inventive subject matter, therefore, is not to be restricted except in the scope of the appended claims. Moreover, in interpreting both the specification and the claims, all terms should be interpreted in the broadest possible manner consistent with the context. In particular, the terms “comprises” and “comprising” should be interpreted as referring to elements, components, or steps in a non-exclusive manner, indicating that the referenced elements, components, or steps may be present, or utilized, or combined with other elements, components, or steps that are not expressly referenced. Where the specification or claims refer to at least one of something selected from the group consisting of A, B, C .... and N, the text should be interpreted as requiring only one element from the group, not A plus N, or B plus N, etc.Sequence ListingSEQ ID NO:1SFFV Promoter sequenceGT AAC GC CAT T T T GC AAGGC AT GG AAAAAT ACC AAACC AAGAAT AGAGAAGT T C AG AT C AAG GGCGGGTACATGAAAATAGCTAACGTTGGGCCAAACAGGATATCTGCGGTGAGCAGTTTCGG CCCCGGCCCGGGGCCAAGAACAGATGGTCACCGCAGTTTCGGCCCCGGCCCGAGGCCAAGAA CAGATGGTCCCCAGATATGGCCCAACCCTCAGCAGTTTCTTAAGACCCATCAGATGTTTCCA GGCTCCCCCAAGGACCTGAAATGACCCTGCGCCTTATTTGAATTAACCAATCAGCCTGCTTC TCGCTTCTGTTCGCGCGCTTCTGCTTCCCGAGCTCTATAAAAGAGCTCACAACCCCTCACTC GGCGCGCCAGTCCTCCGATTGACTGAGTCGCCCGGATCCCAGTGTGGTGGTACGGGGCCACCSEQ ID NO: 2CD 16 low affinity (158F) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW KDHKFKWRKDPQDK SEQ ID NO: 3CD 16 high affinity (158V) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKN VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWAttny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001KDHKFKWRKDPQDK SEQ ID NO: 4IL-2 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSI ISTLT SEQ ID NO: 5ER-IL-2 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSI ISTLTGSEKDEL SEQ ID NO: 6Construct design GCCGGGAGCAGGCGTGAGTGTGGGAAATGAAGGAAGCCCTCAGAGAATGCTCCTCCCACCTT GAATCTCATCCCCAGGGTCTCACTGTCCCATTCTTGGTGCTGGGTGGATCCAAATCCAGGAG ATGGGGCAAGCATCCTGGGATGGCTGAGGGCACACTCTGGCAGATTCTGTGTGTGTCCTCAG ATGCTCAGCCACAGACCTTTGAGGGAGTAAAGGGGGCAGACCCACCCACCTTGCCTCCAGGC TCTTTAATTCCTGGTCCTGTTCTATGGTGGGGCTCCCTTGCCAGACTTCAGACTGAGAAGTC AGATGAAGTTTCAAGAAAAGGAAATTGGTGGGTGACAGAGGTAACGCCATTTTGCAAGGCAT GGAAAAATACCAAACCAAGAATAGAGAAGTTCAGATCAAGGGCGGGTACATGAAAATAGCTA ACGTTGGGCCAAACAGGATATCTGCGGTGAGCAGTTTCGGCCCCGGCCCGGGGCCAAGAACA GATGGTCACCGCAGTTTCGGCCCCGGCCCGAGGCCAAGAACAGATGGTCCCCAGATATGGCC CAACCCTCAGCAGTTTCTTAAGACCCATCAGATGTTTCCAGGCTCCCCCAAGGACCTGAAAT GACCCTGCGCCTTATTTGAATTAACCAATCAGCCTGCTTCTCGCTTCTGTTCGCGCGCTTCT GCTTCCCGAGCTCTATAAAAGAGCTCACAACCCCTCACTCGGCGCGCCAGTCCTCCGATTGA CTGAGTCGCCCGGATCCCAGTGTGGTGGTACGGGGCCACC ATGGGTGGAGGGGCTGGGGAAAGGCTGTTTACTTCCTCCTGTCTAGTCGGTTTGGTCCCTTT AGGGCTCCGGATATCTTTGGTGACTTGTCCACTCCAGTGTGGCATCATGTGGCAGCTGCTCC TCCCAACTGCTCTGCTACTTCTAGGTAAGTCAGGGTCTCCCTGGTTGAGGGAGAAGTTTGAG ATGCCTTGGGTTCAGCAGAGACCCCTTTTCAGGCTACGAATGAGACTCCCACGAAGGGATGG GACCCCTCACCACATCTATAGCTGTGGATTGAGCTCCTAGGACAAGCCAAGATGGGGCTAGG CCGGGAGCAGGCGTGAGTGTGG
Claims
Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W0001CLAIMSWhat is claimed is:
1. A recombinant NK-92 cell, comprising:a recombinant promotor sequence upstream of a gene encoding a native CD 16 allele, wherein the recombinant promotor sequence is operably coupled to the gene to thereby enable expression of the native CD 16.
2. The recombinant NK-92 cell of claim 1, wherein the recombinant promotor sequence is a constitutive promotor sequence.
3. The recombinant NK-92 cell of any one of claims 1-2, wherein the recombinant promotor sequence is anon-human promotor sequence.
4. The recombinant NK-92 cell of any one of claims 1-3, wherein the recombinant promotor sequence is a SFFV (spleen focus forming virus) promotor sequence.
5. The recombinant NK-92 cell of any one of claims 1-4, wherein the recombinant promotor sequence replaces an inactive native promotor sequence.
6. The recombinant NK-92 cell of any one of claims 1-5, wherein the native CD16 allele is a heterozygous allele.
7. The recombinant NK-92 cell of any one of claims 1-6, wherein the recombinant promoter sequence leads to detectable expression of the CD16 158V allele, but not the 158F allele.
8. The recombinant NK-92 cell of any one of claims 1-7, wherein the NK-92 cell remain viable for at least 6 months.
9. The recombinant NK-92 cell of any one of claims 1-8, wherein the NK-92 cell express CD 16 consistently for at least 6 months.
10. The recombinant NK-92 cell of any one of claims 1-9, wherein the recombinant NK-92 cell further comprises a recombinant nucleic acid that encodes an intracellularly retained cytokine.
11. The recombinant NK-92 cell of claim 10, wherein the intracellularly retained cytokine is an IL-2 or er-IL-2.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W000112. The recombinant NK-92 cell of claim 11, wherein the recombinant NK-92 cell, when cultured in a culture medium, secretes no more than 5,000 pg / mL IL-2 into the culture medium.
13. The recombinant NK-92 cell of any one of claims 1-12, wherein the recombinant nucleic acid further encodes an antibiotic resistance gene and / or a reported gene.
14. The recombinant NK-92 cell of any one of claims 1-13, wherein the recombinant NK-92 cell expresses CD 16 on the surface of the cell.
15. The recombinant NK-92 cell of claim 14, wherein the recombinant NK-92 cell expresses CD 16 158V on the surface of the cell.
16. The recombinant NK-92 cell of any one of claims 1-15, wherein the recombinant NK-92 cell has ADCC against a target cell expressing an antigen, and wherein the antigen is bound by an antibody that is bound to the CD 16 expressed on the surface of the recombinant NK- 92 cell.
17. The recombinant NK-92 cell of any one of claims 1-16, wherein the recombinant NK-92 cell, compared to a non-recombinant NK-92 cell, has a reduced signal-to-noise ratio for ADCC.
18. The recombinant NK-92 cell of any one of claims 1-17, wherein the recombinant NK-92 cell has reduced non-ADCC cytotoxicity as compared to a non-recombinant NK-92 cell.
19. A cell line comprising a plurality of recombinant NK-92 cells of any one of claims 1-18.
20. A composition comprising a plurality of recombinant NK-92 cells of any one of claims 1- 18.
21. A method of testing an antibody, comprising:providing a plurality of target cells expressing an antigen,providing a plurality of recombinant NK-92 cells of any one of claims 1-18, or a cell line according to claim 19 or a composition according to claim 20; combining the target cells and the recombinant NK-92 cells with an antibody that binds to the antigen; andmeasuring ADCC against the target cells.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W000122. The method of claim 21, wherein the antibody is an IgG for therapy in human.
23. The method of any one of claims 21-22, wherein the target cell is not substantially exposed to a cytokine secreted from the recombinant NK-92 cells.
24. The method of any one of claims 21-23, wherein a ratio of recombinant NK-92 cells to target cells is between 0.1:1 and 50:1.
25. The method of any one of claims 21-24, wherein the method generates results that are more predictive than the same method using NK-92 cells expressing a transgene high-affinity CD16.
26. A method of making a recombinant NK-92 cell, comprising:providing a NK-92 cell;introducing to the NK-92 cell a recombinant promotor sequence upstream of a gene encoding a native CD 16 allele to thereby make the recombinant NK-92 cell.
27. The method of claim 26, wherein the recombinant promotor sequence is operably coupled to the gene to thereby enable expression of the native CD 16.
28. The method of any one of claims 26-27, wherein the recombinant promoter sequence is introduced to the NK-92 cell via electroporation.
29. The method of any one of claims 26-28, wherein the recombinant promotor sequence is a constitutive promotor sequence.
30. The method of any one of claims 26-29, wherein the recombinant promotor sequence is a non-human promotor sequence.
31. The method of any one of claims 26-30, wherein the recombinant promotor sequence is a SFFV (spleen focus forming virus) promotor sequence.
32. The method of any one of claims 26-31, wherein the recombinant promotor sequence replaces an inactive native promotor sequence.
33. The method of any one of claims 26-32, wherein the native CD 16 allele is a heterozygous allele.Attny Dkt No. 104077.0027PCTClient Ref.: PAT.005368.W000134. The method of any one of claims 26-33, wherein the recombinant promoter sequence leads to expression of the CD16 158V allele, but not the 158F allele.
35. The method of any one of claims 26-43, wherein the NK-92 cell remain viable for at least 6 months.
36. The method of any one of claims 26-35, wherein the NK-92 cell express CD16 consistently for at least 6 months.
37. The method of any one of claims 26-36, wherein the recombinant NK-92 cell further comprises a recombinant nucleic acid that encodes an intracellularly retained cytokine.
38. The method of claim 37, wherein the intracellularly retained cytokine is an IL-2 or er-IL- 2.
39. The method of any one of claims 37-38, wherein the recombinant NK-92 cell, when cultured in a culture medium, secretes no more than 5,000 pg / mL IL-2 into the culture medium.
40. The method of any one of claims 26-40, wherein the recombinant nucleic acid further encodes an antibiotic resistance gene and / or a reported gene.
41. The method of any one of claims 26-40, wherein the recombinant NK-92 cell expresses CD 16 on the surface of the cell.
42. The method of any one of claims 26-41, wherein the recombinant NK-92 cell expresses homogenous CD 16 158V on the surface of the cell.
43. The method of any one of claims 26-42, wherein the recombinant NK-92 cell has ADCC against a target cell expressing an antigen, and wherein the antigen is bound by an antibody that is bound to the CD 16 expressed on the surface of the recombinant NK-92 cell.
44. The method of any one of claims 26-43, wherein the recombinant NK-92 cell, compared to a non-recombinant NK-92 cell, has a reduced signal-to-noise ratio for ADCC.
45. The method of any one of claims 26-44, wherein the recombinant NK-92 cell has reduced non-ADCC cytotoxicity as compared to a non-recombinant NK-92 cell.