Peptides and peptide-drug conjugates for targeted skin penetrating delivery and controlled release
Patent Information
- Application Number
- PCT/CN2026/085803
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2026-01-21
- Filing Date
- 2026-03-25
- Publication Date
- 2026-10-01
Smart Images

Figure PCTCN2026085803-FTAPPB-I100001 
Figure PCTCN2026085803-FTAPPB-I100002 
Figure PCTCN2026085803-FTAPPB-I100003
Abstract
Description
Peptides and Peptide-Drug Conjugates for Targeted Skin Penetrating Delivery and Controlled Release
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS
[0002] This application Claims the benefit of and priority to PCT Application No. PCT / CN2025 / 085266, filed Mar. 27, 2025; PCT Application No. PCT / CN2025 / 128460, filed Oct. 17, 2025; and PCT Application No. PCT / CN2026 / 073906, filed Jan. 21, 2026, the disclosure of which are incorporated herein by reference in their entirety.FIELD
[0003] The present disclosure relates to skin penetrating peptides and skin-penetrating peptide-drug conjugates (PDCs) , compositions comprising the same, and uses thereof in drug delivery.BACKGROUND
[0004] Skin performs critical functions as a protective barrier against the external environment, defending against biological threats (microorganisms) , chemical substances, and physical damage (such as ultraviolet radiation) , while preventing the loss of essential biological components including moisture.
[0005] Successful delivery of therapeutics across the stratum corneum into deeper layers of skin has become a key area of research in research and development for dermatology therapeutics and other topical treatments. The effective delivery of bioactive molecules and therapeutic compounds into different skin layers (including stratum corneum, epidermis, dermis) remains a significant challenge in pharmaceutical development. Most bioactive molecules, from small molecules to peptides, proteins and oligonucleotides, struggle to penetrate the skin barrier effectively enough to achieve therapeutic levels. Among various approaches to overcome this challenge, peptide carriers have emerged as promising candidates for enhancing the skin penetration of bioactive molecules. This approach has led to the development of peptide-drug conjugates (PDCs) , where the peptide carrier serves as a delivery vehicle chemically linked to the therapeutic payload, including but not limited to small molecules, peptides, proteins and oligonucleotides. While certain peptides demonstrate the ability to penetrate cellular membranes and the stratum corneum, there remains an unmet need for developing more effective skin-penetrating compounds that can achieve targeted delivery.
[0006] Hair loss or alopecia represents a prevalent dermatological condition associated with substantial psychological and social burden. Androgenic alopecia (AGA) is one of the most common types of alopecia conditions and it affects both male and female populations. In males, AGA manifests as male-pattern baldness, characterized by progressive recession of the frontotemporal hairline and vertex thinning. Female-pattern hair loss (FPHL) , conversely, typically presents as diffuse crown thinning with preservation of the frontal hairline.
[0007] Ceramides are major lipid components found in the intercellular spaces of the skin's stratum corneum and are essential for proper skin barrier function. These sphingolipid molecules help form the characteristic lamellar (layered) structure within the stratum corneum by organizing with cholesterol and fatty acids into ordered lipid bilayers. Beyond their structural role, ceramides serve multiple functions in skin health: they regulate cell proliferation and differentiation, modulate inflammatory responses, participate in the skin’s natural moisturizing processes, and contribute to the skin’s antimicrobial defense mechanisms. Ceramides also play important roles in maintaining proper skin pH and supporting the desquamation process, where old skin cells are naturally shed. This multifunctional nature makes ceramides critical not only for barrier maintenance but also for overall skin homeostasis and repair processes. In addition to ceramides, other barrier lipids such as sphingosine, phytosphingosine, cholesterol, and fatty acids contribute to barrier integrity and skin homeostasis. Together, these lipids act synergistically, making the balance of ceramides and related barrier lipids essential for healthy skin.SUMMARY
[0008] The present disclosure provides skin-penetrating peptides and skin-penetrating peptide-drug conjugate (PDC) compounds, compositions comprising the compounds, methods for synthesizing the compounds, and methods of using the compounds and compositions in drug delivery. The skin-penetrating peptides and the skin-penetrating peptide-drug conjugate (PDC) compounds can deliver payloads across biological membranes, especially for delivering payloads to the desired layers of various skin tissues. The skin-penetrating peptides overcome topical delivery barriers, while the linker designs maintain stability and enable controlled release of active components.
[0009] In one aspect, the present disclosure provides a conjugate or a pharmaceutically / cosmetically acceptable salt thereof, wherein the conjugate comprises a peptide and a payload, with the peptide covalently binds to the payload via a linker. In some embodiments, the payload is a therapeutic agent, preferably selected from an agent for the treatment of androgenetic alopecia, for anti-aging, and for anesthesia.
[0010] In some embodiments, the payload is selected from the group comprising finasteride, minoxidil, dutasteride, spironolactone, argireline, tranexamic acid, benzocaine, lidocaine, 5-fluorouracil (5-FU) , venetoclax, vismodegib, selumetinib, derazantinib, barasertib, alisertib, bemcentinib, ralimetinib, and bioactive lipid.
[0011] In one preferable embodiment, the payload is a bioactive lipid. Preferably, the bioactive lipid is selected from the group comprising a steroid or its ester, a fatty acid or its ester, a phospholipid or its ester, a compound represented by Formula A and mixtures thereof,
[0012] in which:
[0013] R1 denotes:
[0014] a hydrogen atom or in which, R6 denotes:
[0015] a hydrogen atom, or either a saturated or unsaturated and linear or branched C1-C50, preferably C5-C50, hydrocarbon radical, it being possible for this radical to be substituted by one or more hydroxyl groups optionally esterified by an acid R7COOH, R7 being an optionally mono-or polyhydroxylated, saturated or unsaturated and linear or branched C1-C35 hydrocarbon radical, it being possible for the hydroxyl or hydroxyls of the R7 radical to be esterified by an optionally mono-or polyhydroxylated, saturated or unsaturated and linear or branched C1-C35 fatty acid;
[0016] or an R8- (NR9-CO) -R10 radical, in which R9 denotes a hydrogen atom or a mono-or polyhydroxylated, preferably monohydroxylated, C1-C20 hydrocarbon radical, R8 and R10 are hydrocarbon radicals, the sum of the carbon atoms of which is between 9 and 30, R10 being a divalent radical;
[0017] or an R13-O-CO- (CH2) p radical, in which R13 denotes a C1-C20 hydrocarbon radical and p is an integer varying from 1 to 12;
[0018] R2 denotes:
[0019] a hydrogen atom, a radical of saccharide type, in particular a (glycosyl) n, (galactosyl) m or sulphogalactosyl radical, a sulphate or phosphate residue, a phosphorylethylamine radical and a phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8;
[0020] R3 denotes:
[0021] a hydrogen atom or a hydroxylated or nonhydroxylated and saturated or unsaturated C1-C33 hydrocarbon radical, it being possible for the hydroxyl or hydroxyls to be esterified by an inorganic acid or an acid R7COOH, R7 having the same meanings as hereinabove, and it being possible for the hydroxyl or hydroxyls to be etherified by a (glycosyl) n, (galactosyl) m, phosphate, sulphogalactosyl, phosphorylethylamine or phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8; it also being possible for R3 to be substituted by one or more C1-C14 alkyl radicals;
[0022] R4 denotes:
[0023] a hydrogen atom, a methyl or ethyl radical, an optionally hydroxylated, saturated or unsaturated and linear or branched C3-C50 hydrocarbon radical or a -CH2-CHOH-CH2-O-R14 radical, in which R14 denotes a C10-C26 hydrocarbon radical, or an R13-O-CO- (CH2) p radical, R13 having the same meanings as hereinabove;
[0024] R5 denotes:
[0025] a hydrogen atom or a saturated or unsaturated and linear or branched C1-C30 hydrocarbon radical, optionally the radical is mono-or polyhydroxylated, it being possible for the hydroxyl or hydroxyls to be etherified by a (glycosyl) n, (galactosyl) m, sulphogalactosyl, phosphorylethylamine or phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8;
[0026] preferably, R5 denotes: a hydrocarbon group having 9 to 17 carbon atoms, such as nonanyl, decanyl, undecanyl, dodecanyl, tridecanyl, tetradecanyl, pentadecanyl, hexadecanyl, and heptadecanyl;
[0027] with the proviso that, when R3 and R5 denote hydrogen or when R3 denotes hydrogen and R5 denotes methyl, then R4 does not denote a hydrogen atom or a methyl or ethyl radical.
[0028] In one embodiment, R1 is selected from a hydrogen atom and R4 is selected from a hydrogen atom.
[0029] In one embodiment, R1 or R4 is selected from
[0030] In one embodiment, R3 is selected from a hydroxylated C1-C33 hydrocarbon radical etherified by a phosphate.
[0031] In another embodiment, R3 is selected from
[0032] In another embodiment, R3 is selected from
[0033] In one embodiment, R5 is selected from
[0034] In one embodiment, the bioactive lipid is a natural ceramide, a synthetic ceramide, a pseudo-ceramide, a ceramide analog.
[0035] The natural ceramide is ceramide that exists in nature, and may include ceramide extracted from animals, plants, and microorganisms. Naturally occurring ceramides differ in the length of their fatty acyl chains. Exemplary species of naturally occurring ceramides that can be included in the formulations include, but are not limited to, C2 ceramide, C8 ceramide, Cl6 ceramide, C18 ceramide, C20 ceramide and C24 ceramide. Many ceramide analogs and ceramide mimetics are known in art.
[0036] The pseudo-ceramide is a general term for compounds having a double-chained lamellar structure of the natural ceramide. Examples of the pseudo-ceramide may include at least one selected from 1, 3-bis (N-2-(hydroxyethyl) palmitoylamino) -2-hydroxy propane, 1, 3-bis (N-2- (hydroxyethyl) lauroyl amino) -2-hydroxy propane, 1, 3-bis (N-2- (hydroxyethyl) isostearoylamino) -2-hydroxy propane, 1, 3-bis (N-2- (hydroxyethyl) stearoylamino) -2-hydroxypropane, and a mixture thereof.
[0037] Suitable ceramide analogs include, but are not limited to, C6-serinol and (2S, 3R) - (4E, 6E) -2-octanoylamidooctadecadiene-l, 3-diol (4, 6-diene-ceramide) , 5R-OH-3E-Q-ceramide, adamantyl-ceramide and benzene-C4-ceramide. Other suitable ceramide analogs include those of the β-hydroxyalkylamine type, including those with saturated or mono-or polyunsaturated (cis or trans) alkyl groups. Exemplary ceramide analogs of this type include, but are not limited to N- (2-hydroxy-l- (hydroxymethyl) ethyl) -palmitoylamide ( "S16" ) ; N- (2-hydroxy-l -(hydroxymethyl) ethyl) -oleoylamide ( "S18" ) ; N, N-bis (2-hydroxyethyl) palmitoylamide ( "B16" ) ; N, N-bis (2-hydroxyethyl) oleoylamide ( "Bl 8" ) ; N-tris (hydroxymethyl) raethyl-palmJtoylamide ( "Tl 6" ) ; N-tris (hydroxymethyl) methyl-oleoylamide ( "T18" ) ; N-acetyl sphingosine ( "C2" ) ; D-threo-l-phenyl-2-decanoylamirio-3-morpholino-l propanol ( "D-threo-PDMP" ) ; D-threo-1-phenyl-2-hexadecanoylamino-3 -morpholino-1-propanol ( "D-Threo-PPMP" ) ; D-erythro-2-tetradecanoyl-l -phenyl-1-propanol (11D-MAPP" ) ; D-erythro-2- (N-myristoylamino) -l-phenyl-1-propanol ( "MAPP" ) ; (IS, 2R) -D-erythro-2- (N-myristoylamino) -l-phenyl-l-propanol; and N-hexanoylsphingosine (C6-ceramide) .
[0038] Commercialized products of the ceramides are available, and they may be purchased and used. Preferable examples of the products include "Ceramide I" (manufactured by Cosmo Pharm) containing N- (27-octadecanoyloxy-heptacosanoyl) -phytosphingosine as a component, "Ceramide TIC-001" (manufactured by Takasago International Corporation) containing N-stearoyl-dihydroxy-sphingosine as a component, "Ceramide III" (manufactured by Cosmo Pharm) containing N-stearoyl-phytosphingosine as a component, "Ceramide IIIA" (manufactured by Cosmo Pharm) containing N-linoleoyl-phytosphingosine as a component, "Ceramide IIIB" (manufactured by Cosmo Pharm) containing N-oleoyl-phytosphingosine as a component, and "Ceramide VI" (manufactured by Cosmo Pharm) containing N-2-hydroxystearoyl-phytosphingosine as a component. Other ceramide can be selected from ceramides that are described in Patent WO2015152420A1 or US8313755B2.
[0039] In one embodiment, the fatty acid is represented by formula B:
[0040] in which, R15 denotes a hydrocarbon radical containing from 6 to 40 carbon atoms, preferably R15 is linear or branched, acyclic or cyclic, saturated or unsaturated, aliphatic or aromatic, substituted or unsubstituted, more preferably a linear or branched, acyclic C6-40 alkyl or alkenyl group or a C1-40 alkyl phenyl group, more particularly a C8-22 alkyl or alkenyl group or a C4-18 alkyl phenyl group, more preferably a C12-18 alkyl group or alkenyl group or a C6-16 alkyl phenyl group.
[0041] In one embodiment, the fatty acid is selected from the group comprising arachidic acid, arachidonic acid, beeswax acid, capric acid, caproic acid, caprylic acid, coconut acid, lauric acid, myristic acid, palmitic acid, stearic acid, behenic acid, oleic acid, undecylenic acid, tannic acid (tallic acid) , isostearic acid, linoleic acid, linolenic acid, undecanoic acid, rapeseed acid, tallow acid, wheat germ acid, eicosapentaenoic acid (EPA) , docosahexaenoic acid (DHA) , and mixtures thereof.
[0042] In one embodiment, the fatty acid ester is selected from the group comprising monoglycerides of C12 to C20 saturated or unsaturated fatty acids (e.g. C14 to C18) , esters of saturated or unsaturated fatty acids with diols (such as C8 to C20 fatty acids; e.g. 2-hydroxypropyl octanoate; propylene glycol monolaurate) , mono-and di-esters of polyethylene glycol with medium chain fatty acids (e.g. C6 to C10 fatty acids) , sorbitol or sorbitan esters, esters of sorbitol or sorbitan with polyethylene glycol and / or fatty acids (e.g. polysorbates) .
[0043] In one embodiment, the sterol is selected from the group comprising cholesterol, cholesteryl sulfate, cholesteryl acetate, cholesteryl stearate, cholesteryl isostearate, cholesteryl hydroxystearate, phytosterol and mixtures thereof.
[0044] In one embodiment, the phospholipid is selected from the group comprising dioleoylphosphatidylethanolamine (DOPE) , distearoylphosphatidylcholine (DSPC) , palmitoyloleoylphosphatidylcholine (POPC) , egg phosphatidylcholine (EPC) , dioleoylphosphatidylcholine (DOPC) , dipalmitoylphosphatidylcholine (DPPC) , dioleoylphosphatidylglycerol (DOPG) , dipalmitoylphosphatidylglycerol (DPPG) , distearoylphosphatidylethanolamine (DSPE) , phosphatidylethanolamine (PE) , dipalmitoylphosphatidylethanolamine, 1, 2-dioleoyl-sn-glycero-3-phospho-L-serine (DOPS) , 1, 2-diphytanoyl-sn-glycero-3-phosphoethanolamine (Diphytanoyl-PE) , 1, 2-dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) , 1, 2-dimyristoyl-sn-glycero-3-phosphoethanolamine (DMPE) , 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) , and mixtures thereof.
[0045] Examples of common esters include methyl ester, ethyl ester, trichloroethyl ester, propyl ester, butyl ester, pentyl ester, tert-butyl ester, benzyl ester, nitrobenzyl ester, methoxybenzyl ester, benzhydryl.
[0046] In one embodiment, the bioactive lipid is selected from the group comprising: N-stearoyl-dihydroxy-sphingosine, N- (27-octadecanoyloxy-heptacosanoyl) -phytosphingosine, N-stearoyl-phytosphingosine, N-linoleoyl-phytosphingosine, N-oleoyl-phytosphingosine, N-2-hydroxystearoyl-phytosphingosine, ceramide NDS, ceramide NS, ceramide NP, ceramide NH, ceramide ADS, ceramide AS, ceramide AP, ceramide AH, ceramide EODS, ceramide EOS, ceramide EOP, ceramide EOH, ceramide Nds, ceramide Ads, ceramide EOds, C2 Ceramide, C6 Ceramide, C8 Ceramide, C16 Ceramide, C18 Ceramide, C20 Ceramide, C24 Ceramide, (2S, 3R) - (4E, 6E) -2-octanoylamidooctadecadiene-1, 3-diol, 5R-OH-3E-Q-ceramide, Adamantyl-ceramide, Benzene-C4-ceramide, N- (2-hydroxy-1- (hydroxymethyl) ethyl) -palmitoylamide ( "S16" ) , N- (2-hydroxy-1- (hydroxymethyl) ethyl) -oleoylamide ( "S18" ) , N, N-bis (2-hydroxyethyl) palmitoylamide ( "B16" ) , N, N-bis (2-hydroxyethyl) oleoylamide ( "B18" ) , N-tris (hydroxymethyl) methyl-palmitoylamide ( "T16" ) , N-tris (hydroxymethyl) methyl-oleoylamide ( "T18" ) , D-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol ( "D-threo-PDMP" ) , D-threo-1-phenyl-2-hexadecanoylamino-3-morpholino-1-propanol ( "D-Threo-PPMP" ) , D-erythro-2-tetradecanoyl-1-phenyl-1-propanol ( "D-MAPP" ) , D-erythro-2- (N-myristoylamino) -1-phenyl-1-propanol ( "MAPP" ) , (1S, 2R) -D-erythro-2- (N-myristoylamino) -1-phenyl-1-propanol, C6-Serinol, N-docosanoyl-N-methyl-D-glucamine, Caprooyl Phytosphingosine, Caprooyl Sphingosine, Bis (N-hydroxyethyl-N-cetyl) malonamide, N- (2-hydroxyethyl) -N- (3-cetyloxy-2-hydroxypropyl) amide of cetylic acid, 2-N-linoleoylaminooctadecane-1, 3-diol, 2-N-oleoylaminooctadecane-1, 3-diol, 2-N-palmitoylaminooctadecane-1, 3-diol, 2-N-stearoylaminooctadecane-1, 3-diol, 2-N-behenoylaminooctadecane-1, 3-diol, 2-N- [2-hydroxypalmitoyl] aminooctadecane-1, 3-diol, 2-N-stearoylaminooctadecane-1, 3, 4-triol, 2-N-palmitoylaminohexadecane-1, 3-diol, sphingosine-1-phosphate, ceramide-1-phosphate and mixtures thereof.
[0047] In another embodiment, the bioactive lipid is selected from the group comprising:
[0048] In another embodiment, the bioactive lipid is ceramide NS with formula A1:
[0049] In another embodiment, the bioactive lipid is ceramide NP with formula A2:
[0050] In another embodiment, the bioactive lipid is ceramide EOP with formula A3:
[0051] In one embodiment, the linker is a cleavable linker or a non-cleavable linker, preferably a cleavable linker, more preferably a linker that can be induced for cleavage and traceless release by reduction, and is preferably selected from the group comprising
[0052] wherein t is an integer of from 1 to 5, preferably 1 to 3.
[0053] In one preferable embodiment, the linker is wherein t is 1, and U is O.
[0054] In one preferable embodiment, are preferably for cysteine conjugation, and is preferably for lysine conjugation.
[0055] In some preferable embodiments, one payload can bind to 1, 2, 3 or more the same or different peptides via the linker, or 1, 2, 3 or more the same or different payloads can bind to one peptide via the linker; and preferably, one payload binds to one peptide by the linker.
[0056] In some preferable embodiments, the peptide has the following structure of Formula I:
[0057] R11-W1-X-PP-W2-R12 (Formula I)
[0058] wherein:
[0059] R11 is an N-terminal modification;
[0060] R12 is absent or a C-terminal modification;
[0061] each of W1 and W2 is independently selected from a direct bond or a linking moiety;
[0062] X is absent or a targeting moiety;
[0063] wherein one or more of W1, W2 and X are connected to the linker;
[0064] PP is selected from:
[0065] (1) oligo-arginine or oligo-arginine-analog, or
[0066] (2) oligo-arginine or oligo-arginine-analog, which is implanted with at least one spacer;
[0067] wherein the oligo-arginine is an oligomer of arginine, wherein the arginine can be L or D form; and the oligo-arginine-analog is an oligomer of an arginine analog containing guanidyl.
[0068] In some preferable embodiments, R11 is an N-terminal modification selected from the group comprising acetylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification, glycosylation, fluorination, sulfonation; preferably, acetyl modification, fatty acid modification, and pyrenebutyrate modification; more preferably, fatty acid modification.
[0069] In some preferable embodiments, R11 is selected from the group comprising: Ac (Acetyl) , C8, C10, C12, C14, C16 (Palm) , C18 (St) , C20, C22. In some preferable embodiments, R12 is a C-terminal modification selected from the group comprising amidation, alkylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification; preferably, NH2.
[0070] In some preferable embodiments, the linking moiety is preferably cysteine or lysine, wherein the cysteine or lysine can be L or D form.
[0071] In some preferable embodiments, the targeting moiety is selected from the group comprising transferrin, a Penetration Accelerating Sequence (PAS) , a Nuclear Localization Signal (NLS) sequence, an Endosomal Escape Enhancer, and a Heparin Sulfate Binding Peptides; and optionally, the targeting moiety is connected to the linker, preferably by Cys or Lys residue in the targeting moiety.
[0072] In some preferable embodiments, the transferrin can be a sequence of Lys-His-Ala-Ile-Tyr-Pro-Arg-His (SEQ ID NO.689) .
[0073] In some preferable embodiments, the PAS can be a sequence of Pro-Lys-Lys-Lys-Arg-Lys-Val-βAla-Lys-Phe-Phe-Leu-Ile-Pro-Lys-Gly (SEQ ID NO. 690) .
[0074] In some preferable embodiments, the Endosomal Escape Enhancer can be selected from the group comprising WEAALAEALAEALAEHLAEALAEALEALAA (GALA, SEQ ID NO. 691) , LFEAIEGFIENGWEGMIDGWY (INF7, SEQ ID NO. 692) , WEAKLAKALAKALAKHLAKALAKALKACEA (KALA, SEQ ID NO. 693) , GLFHAIAHFIHGGWHGLIHGWYG (H5WYG, SEQ ID NO. 694) , and GLFGAIAGFIENGWEGMIDGWYG (HA2-Derived Peptide, SEQ ID NO. 695) .
[0075] In some preferable embodiments, the Heparin Sulfate Binding Peptides can be selected from the group comprising LRSRTKIIRIR (HBPep, SEQ ID NO. 696) , SPKRKGGSRKYSPTSPTTSPTSKRKYSP (HS-20, SEQ ID NO. 697) , and KHKNKRKT (Platelet Factor 4, SEQ ID NO. 698) .
[0076] In some preferable embodiments, the NLS sequence can be selected from the group comprising PKKKRKV (NLS1, SEQ ID NO. 699) , PKLKRQ (NLS2, SEQ ID NO. 700) , PAAKRVKLD (NLS3, SEQ ID NO. 701) , RPRK (SEQ ID NO. 702) , RRARRPRG (SEQ ID NO. 703) , GKRKLITSEEERSPAKRGRKS (SEQ ID NO. 704) ,
[0077] KGKKGRTQKEKKAARARSKGKN (SEQ ID NO. 705) , RKRCAAGVGGGPAGCPAPGSTPLKKPRR (SEQ ID NO. 706) , RKPVTAQERQREREEKRRRRQERAKEREKRRQERER (SEQ ID NO. 707) ,
[0078] RSGGNHRRNGRGGRGGYNRRNNGYHPY (SEQ ID NO. 708) , TLLLRETMNNLGVSDHAVLSRKTPQPY (SEQ ID NO. 709) , PGKMDKGEHRQERRDRPY, (SEQ ID NO. 710) , GKKKKGKPGKRREQRKKKRRT, (SEQ ID NO. 711) , SANKVTKNKSNSSPYLNKRKGKPGPDS (SEQ ID NO. 712) , and
[0079] VHSHKKKKIPTSPTFTTPKTLTLRRQPKYPRKSAPRRNKLDHY (SEQ ID NO. 713) .
[0080] In some preferable embodiments, the oligo-arginine or oligo-arginine-analog is implanted with the spacer in such a way that one spacer is implanted in between every two adjacent residues in the oligo-arginine or oligo-arginine-analog; or in such a way that the spacer and the residues in the oligo-arginine or oligo-arginine-analog collectively form 2 or more unit structures of (X1X2X3) , wherein 0-1 in X1, X2 and X3 is the spacer and the other 2 or 3 are the residues of the oligo-arginine or oligo-arginine-analog.
[0081] In some preferable embodiments, the spacer and the oligo-arginine or oligo-arginine-analog collectively form 2-12, preferably 2-5 unit structures of (X1X2X3) .
[0082] In some preferable embodiments, all the unit structures of (X1X2X3) are the same.
[0083] In some preferable embodiments, the spacer consists of 1-3, preferably 1 residue.
[0084] In some preferable embodiments, the residue in the spacer is selected from the group comprising β-alanine (βAla) , γ-Aminobutyric acid, Aminohexanoic acid (Ahx) , proline, and tryptophan, preferably β-alanine (βAla) ; wherein the residue can be L or D form.
[0085] In some preferable embodiments, the residue in the oligo-arginine-analog is preferably selected from the group comprising 2- (6-guanidylhexyl) amino acetic acid ( GuanidylC6NHPeptoid) , 2- (4-guanidylbutyl) amino acetic acid ( GuanidylC4NHPeptoid) , and 2- (7-guanidylheptyl) amino acetic acid ( GuanidylC7NHPeptoid) .
[0086] In some preferable embodiments, the peptide has the following structures of Formula II, Formula III, Formula IV, Formula V, Formula VI, or Formula VII:
[0087] R11-W1-PP-R12 (Formula II)
[0088] wherein R11, W1, PP, and R12 are the same as defined above, and wherein W1 is connected to the linker;
[0089] R11-X-PP-R12 (Formula III)
[0090] wherein R11, X, PP, and R12 are the same as defined above; and wherein X is connected to the linker, preferably by Cys or Lys residue in X;
[0091] R11-PP-W2-R12 (Formula IV)
[0092] wherein R11, PP, W2, and R12 are the same as defined above; and wherein W2 is connected to the linker;
[0093] R11-W1-PP-W2-R12 (Formula V)
[0094] wherein R11, W1, PP, W2, and R12 are the same as defined above, and wherein one or both of W1 and W2 are connected to the linker;
[0095] R11-W1-X-PP-R12 (Formula VI)
[0096] wherein R11, W1, X, PP, and R12 are the same as defined above, and wherein one or both of W1 and X are connected to the linker, and wherein when X is connected to the linker, it is preferably connected by Cys or Lys residue in X;
[0097] R11-X-PP-W2-R12 (Formula VII)
[0098] wherein R11, X, PP, W2, and R12 are the same as defined above, and wherein one or both of X and W2 are connected to the linker, and wherein when X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0099] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog.
[0100] In some preferable embodiments, the peptide has the following structure of Formula II:
[0101] R11-W1-PP-R12 (Formula II)
[0102] wherein R11 is a fatty acid modification or acetyl modification, preferably acetyl modification; R12 is NH2, W1 is Cys or Lys, preferably Cys; and the PP is oligo-arginine; and wherein W1 is connected to the linker.
[0103] In some preferable embodiments, the peptide has the following structure of Formula III:
[0104] R11-X-PP-R12 (Formula III)
[0105] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is transferrin or PAS, and the PP is oligo-arginine; and
[0106] wherein X is connected to the linker, preferably by Cys or Lys residue in X.
[0107] In some preferable embodiments, the peptide has the following structure of Formula V:
[0108] R11-W1-PP-W2-R12 (Formula V)
[0109] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is oligo-arginine; and
[0110] wherein W1 and W2 are connected to the linker.
[0111] In some preferable embodiments, the peptide is selected from the group comprising:
[0112] Ac-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 718) ,
[0113] C8-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 719) ,
[0114] C10-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 720) ,
[0115] C12-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 721) ,
[0116] C14-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 722) ,
[0117] C16-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 723) ,
[0118] C18-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 724) ,
[0119] C20-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 725) ,
[0120] C22-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 726) ,
[0121] Ac-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 727) ,
[0122] C8-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 728) ,
[0123] C10-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 729) ,
[0124] C12-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 730) ,
[0125] C14-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 731) ,
[0126] C16-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 732) ,
[0127] C18-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 733) ,
[0128] C20-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 734) ,
[0129] C22-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 735) ,
[0130] Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 736) ,
[0131] C8-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 737) ,
[0132] C10-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 738) ,
[0133] C12-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 739) ,
[0134] C14-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 740) ,
[0135] C16-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 741) ,
[0136] C18-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 742) ,
[0137] C20-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 743) ,
[0138] C22-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 744) ,
[0139] Ac-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 745) ,
[0140] C8-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 746) ,
[0141] C10-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 747) ,
[0142] C12-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 748) ,
[0143] C14-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 749) ,
[0144] C16-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 750) ,
[0145] C18-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 751) ,
[0146] C20-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 752) ,
[0147] C22-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 753) ,
[0148] Ac-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 754) ,
[0149] C8-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 755) ,
[0150] C10-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 756) ,
[0151] C12-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 757) ,
[0152] C14-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 758) ,
[0153] C16-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 759) ,
[0154] C18-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 760) ,
[0155] C20-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 761) ,
[0156] C22-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 762) ,
[0157] Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 763) ,
[0158] C8-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 764) ,
[0159] C10-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 765) ,
[0160] C12-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 766) ,
[0161] C14-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 767) ,
[0162] C16-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 768) ,
[0163] C18-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 769) ,
[0164] C20-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 770) ,
[0165] C22-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 771) ,
[0166] Ac-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 799) ,
[0167] C8-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 800) ,
[0168] C10-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 801) ,
[0169] C12-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 802) ,
[0170] C14-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 803) ,
[0171] C16-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 804) ,
[0172] C18-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 805) ,
[0173] C20-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 806) ,
[0174] C22-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 807) ,
[0175] Ac-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 808) ,
[0176] C8-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 809) ,
[0177] C10-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 810) ,
[0178] C12-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 811) ,
[0179] C14-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 812) ,
[0180] C16-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 813) ,
[0181] C18-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 814) ,
[0182] C20-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 815) ,
[0183] C22-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 816) ,
[0184] Ac-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 817) ,
[0185] C8-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 818) ,
[0186] C10-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 819) ,
[0187] C12-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 820) ,
[0188] C14-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 821) ,
[0189] C16-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 822) ,
[0190] C18-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 823) ,
[0191] C20-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 824) ,
[0192] C22-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 825) ,
[0193] Ac-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 826) ,
[0194] C8-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 827) ,
[0195] C10-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 828) ,
[0196] C12-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 829) ,
[0197] C14-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 830) ,
[0198] C16-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 831) ,
[0199] C18-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 832) ,
[0200] C20-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 833) ,
[0201] C22-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 834) ,
[0202] Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg -NH2 (SEQ ID No. 1208) ,
[0203] Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-NH2 (SEQ ID No. 1210) .
[0204] In a more preferred embodiment, any one or more Arg in SEQ ID NO. 718-771 may be DArg.
[0205] In a further preferred embodiment, the peptide is selected from the group comprising:
[0206] Ac-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 47) ,
[0207] C8-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 48) ,
[0208] C10-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 49) ,
[0209] C12-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 50) ,
[0210] C14-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 51) ,
[0211] C16-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 52) ,
[0212] C18-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 53) ,
[0213] C20-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 54) ,
[0214] C22-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 55) ,
[0215] Ac-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 56) ,
[0216] C8-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 57) ,
[0217] C10-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 58) ,
[0218] C12-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 59) ,
[0219] C14-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 60) ,
[0220] C16-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 61) ,
[0221] C18-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 62) ,
[0222] C20-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 63) ,
[0223] C22-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 64) ,
[0224] Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 65) ,
[0225] C8-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 66) ,
[0226] C10-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 67) ,
[0227] C12-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 68) ,
[0228] C14-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 69) ,
[0229] C16-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 70) ,
[0230] C18-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 71) ,
[0231] C20-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 72) ,
[0232] C22-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 73) ,
[0233] Ac-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 74) ,
[0234] C8-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 75) ,
[0235] C10-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 76) ,
[0236] C12-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 77) ,
[0237] C14-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 78) ,
[0238] C16-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 79) ,
[0239] C18-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 80) ,
[0240] C20-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 81) ,
[0241] C22-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 82) ,
[0242] Ac-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 83) ,
[0243] C8-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 84) ,
[0244] C10-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 85) ,
[0245] C12-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 86) ,
[0246] C14-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 87) ,
[0247] C16-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 88) ,
[0248] C18-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 89) ,
[0249] C20-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 90) ,
[0250] C22-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 91) ,
[0251] Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 92) ,
[0252] C8-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 93) ,
[0253] C10-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 94) ,
[0254] C12-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 95) ,
[0255] C14-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 96) ,
[0256] C16-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 97) ,
[0257] C18-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 98) ,
[0258] C20-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 99) ,
[0259] C22-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 100) ,
[0260] Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-NH2 (SEQ ID No. 1209) .
[0261] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that one spacer is implanted in between every two adjacent residues in the oligo-arginine or oligo-arginine-analog, wherein the spacer consists of one residue.
[0262] In some preferable embodiments, the residue is preferably β-alanine.
[0263] In some preferable embodiments, the peptide has the following structure of Formula II:
[0264] R11-W1-PP-R12 (Formula II)
[0265] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 is connected to the linker.
[0266] In some preferable embodiments, the peptide has the following structure of Formula III:
[0267] R11-X-PP-R12 (Formula III)
[0268] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is NLS, and the PP is the same as defined above; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.
[0269] In some preferable embodiments, the peptide has the following structure of Formula IV:
[0270] R11-PP-W2-R12 (Formula IV)
[0271] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W2 is Cys or Lys, and the PP is the same as defined above; and wherein W2 is connected to the linker.
[0272] In some preferable embodiments, the peptide has the following structure of Formula V:
[0273] R11-W1-PP-W2-R12 (Formula V)
[0274] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 are connected to the linker.
[0275] In some preferable embodiments, the peptide has the following structure of Formula VI:
[0276] R11-W1-X-PP-R12 (Formula VI)
[0277] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0278] In some preferable embodiments, the peptide has the following structure of Formula I:
[0279] R11-W1-X-PP-W2-R12 (Formula I)
[0280] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0281] In some preferable embodiments, the peptide is selected from the group comprising:
[0282] Ac-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 101) ,
[0283] C8-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 102) ,
[0284] C10-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 103) ,
[0285] C12-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 104) ,
[0286] C14-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 105) ,
[0287] C16-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 106) ,
[0288] C18-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 107) ,
[0289] C20-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 108) ,
[0290] C22-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 109) ,
[0291] Ac-Cys-Arg-βAla-Arg-βAla-Arg-βAla-Arg-βAla-Arg-βAla-Arg-NH2 (SEQ ID No. 1211) ,
[0292] Palm-Cys-Arg-βAla-Arg-βAla-Arg-βAla-Arg-NH2 (SEQ ID No. 1212) ,
[0293] Ac-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 110) ,
[0294] C8-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 111) ,
[0295] C10-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 112) ,
[0296] C12-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 113) ,
[0297] C14-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 114) ,
[0298] C16-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 115) ,
[0299] C18-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 116) ,
[0300] C20-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 117) ,
[0301] C22-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 118) ,
[0302] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 119, NLS1-Arg- (βAla-Arg) 5) ,
[0303] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 120, NLS1-Arg- (βAla-Arg) 5) ,
[0304] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 121, NLS1-Arg- (βAla-Arg) 5) ,
[0305] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 122, NLS1-Arg- (βAla-Arg) 5) ,
[0306] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 123, NLS1-Arg- (βAla-Arg) 5) ,
[0307] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 124, NLS1-Arg- (βAla-Arg) 5) ,
[0308] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 125, NLS1-Arg- (βAla-Arg) 5) ,
[0309] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 126, NLS1-Arg- (βAla-Arg) 5) ,
[0310] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 127, NLS1-Arg- (βAla-Arg) 5) ,
[0311] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 128, NLS1-Arg- (βAla-Arg) 5) ,
[0312] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 129, NLS1-Arg- (βAla-Arg) 5) ,
[0313] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 130, NLS1-Arg- (βAla-Arg) 5) ,
[0314] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 131, NLS1-Arg- (βAla-Arg) 5) ,
[0315] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 132, NLS1-Arg- (βAla-Arg) 5) ,
[0316] C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 133, NLS1-Arg- (βAla-Arg) 5) ,
[0317] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 134, NLS1-Arg- (βAla-Arg) 5) ,
[0318] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 135, NLS1-Arg- (βAla-Arg) 5) ,
[0319] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 136, NLS1-Arg- (βAla-Arg) 5) ,
[0320] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 137, NLS1-Arg- (βAla-Arg) 4) ,
[0321] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 138, NLS1-Arg- (βAla-Arg) 4) ,
[0322] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 139, NLS1-Arg- (βAla-Arg) 4) ,
[0323] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 140, NLS1-Arg- (βAla-Arg) 4) ,
[0324] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 141, NLS1-Arg- (βAla-Arg) 4) ,
[0325] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 142, NLS1-Arg- (βAla-Arg) 4) ,
[0326] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 143, NLS1-Arg- (βAla-Arg) 4) ,
[0327] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 144, NLS1-Arg- (βAla-Arg) 4) ,
[0328] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 145, NLS1-Arg- (βAla-Arg) 4) ,
[0329] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 146, NLS1-Arg- (βAla-Arg) 4) ,
[0330] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 147, NLS1-Arg- (βAla-Arg) 4) ,
[0331] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 148, NLS1-Arg- (βAla-Arg) 4) ,
[0332] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 149, NLS1-Arg- (βAla-Arg) 4) ,
[0333] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 150, NLS1-Arg- (βAla-Arg) 4) ,
[0334] C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 151, NLS1-Arg- (βAla-Arg) 4) ,
[0335] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 152, NLS1-Arg- (βAla-Arg) 4) ,
[0336] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 153, NLS1-Arg- (βAla-Arg) 4) ,
[0337] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 154, NLS1-Arg- (βAla-Arg) 4) ,
[0338] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 155, NLS2-Arg- (βAla-Arg) 4) ,
[0339] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 156, NLS2-Arg- (βAla-Arg) 4) ,
[0340] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 157, NLS2-Arg- (βAla-Arg) 4) ,
[0341] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 158, NLS2-Arg- (βAla-Arg) 4) ,
[0342] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 159, NLS2-Arg- (βAla-Arg) 4) ,
[0343] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 160, NLS2-Arg- (βAla-Arg) 4) ,
[0344] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 161, NLS2-Arg- (βAla-Arg) 4) ,
[0345] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 162, NLS2-Arg- (βAla-Arg) 4) ,
[0346] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 163, NLS2-Arg- (βAla-Arg) 4) ,
[0347] Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 164, NLS2-Arg- (βAla-Arg) 4) ,
[0348] C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 165, NLS2-Arg- (βAla-Arg) 4) ,
[0349] C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 166, NLS2-Arg- (βAla-Arg) 4) ,
[0350] C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 167, NLS2-Arg- (βAla-Arg) 4) ,
[0351] C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 168, NLS2-Arg- (βAla-Arg) 4) ,
[0352] C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 169, NLS2-Arg- (βAla-Arg) 4) ,
[0353] C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 170, NLS2-Arg- (βAla-Arg) 4) ,
[0354] C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 171, NLS2-Arg- (βAla-Arg) 4) ,
[0355] C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 172, NLS2-Arg- (βAla-Arg) 4) ,
[0356] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 173, NLS3-Arg- (βAla-Arg) 4) ,
[0357] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 174, NLS3-Arg- (βAla-Arg) 4) ,
[0358] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 175, NLS3-Arg- (βAla-Arg) 4) ,
[0359] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 176, NLS3-Arg- (βAla-Arg) 4) ,
[0360] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 177, NLS3-Arg- (βAla-Arg) 4) ,
[0361] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 178, NLS3-Arg- (βAla-Arg) 4) ,
[0362] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 179, NLS3-Arg- (βAla-Arg) 4) ,
[0363] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 180, NLS3-Arg- (βAla-Arg) 4) ,
[0364] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 181, NLS3-Arg- (βAla-Arg) 4) ,
[0365] Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 182, NLS3-Arg- (βAla-Arg) 4) ,
[0366] C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 183, NLS3-Arg- (βAla-Arg) 4) ,
[0367] C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 184, NLS3-Arg- (βAla-Arg) 4) ,
[0368] C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 185, NLS3-Arg- (βAla-Arg) 4) ,
[0369] C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 186, NLS3-Arg- (βAla-Arg) 4) ,
[0370] C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 187, NLS3-Arg- (βAla-Arg) 4) ,
[0371] C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 188, NLS3-Arg- (βAla-Arg) 4) ,
[0372] C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 189, NLS3-Arg- (βAla-Arg) 4) ,
[0373] C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 190, NLS3-Arg- (βAla-Arg) 4) ,
[0374] Ac-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 191) ,
[0375] C8-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 192) ,
[0376] C10-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 193) ,
[0377] C12-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 194) ,
[0378] C14-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 195) ,
[0379] C16-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 196) ,
[0380] C18-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 197) ,
[0381] C20-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 198) ,
[0382] C22-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 199) ,
[0383] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 200, NLS1-Arg- (βAla-Arg) 5)
[0384] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 201, NLS1-Arg- (βAla-Arg) 5)
[0385] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 202, NLS1-Arg- (βAla-Arg) 5)
[0386] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 203, NLS1-Arg- (βAla-Arg) 5)
[0387] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 204, NLS1-Arg- (βAla-Arg) 5)
[0388] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 205, NLS1-Arg- (βAla-Arg) 5)
[0389] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 206, NLS1-Arg- (βAla-Arg) 5)
[0390] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 207, NLS1-Arg- (βAla-Arg) 5)
[0391] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 208, NLS1-Arg- (βAla-Arg) 5)
[0392] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 209, NLS1-Arg- (βAla-Arg) 4) ,
[0393] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 210, NLS1-Arg- (βAla-Arg) 4) ,
[0394] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 211, NLS1-Arg- (βAla-Arg) 4) ,
[0395] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 212, NLS1-Arg- (βAla-Arg) 4) ,
[0396] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 213, NLS1-Arg- (βAla-Arg) 4) ,
[0397] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 214, NLS1-Arg- (βAla-Arg) 4) ,
[0398] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 215, NLS1-Arg- (βAla-Arg) 4) ,
[0399] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 216, NLS1-Arg- (βAla-Arg) 4) ,
[0400] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 217, NLS1-Arg- (βAla-Arg) 4) ,
[0401] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 218, NLS2-Arg- (βAla-Arg) 4) ,
[0402] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 219, NLS2-Arg- (βAla-Arg) 4) ,
[0403] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 220, NLS2-Arg- (βAla-Arg) 4) ,
[0404] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 221, NLS2-Arg- (βAla-Arg) 4) ,
[0405] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 222, NLS2-Arg- (βAla-Arg) 4) ,
[0406] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 223, NLS2-Arg- (βAla-Arg) 4) ,
[0407] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 224, NLS2-Arg- (βAla-Arg) 4) ,
[0408] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 225, NLS2-Arg- (βAla-Arg) 4) ,
[0409] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 226, NLS2-Arg- (βAla-Arg) 4) ,
[0410] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 227, NLS3-Arg- (βAla-Arg) 4) ,
[0411] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 228, NLS3-Arg- (βAla-Arg) 4) ,
[0412] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 229, NLS3-Arg- (βAla-Arg) 4) ,
[0413] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 230, NLS3-Arg- (βAla-Arg) 4) ,
[0414] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 231, NLS3-Arg- (βAla-Arg) 4) ,
[0415] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 232, NLS3-Arg- (βAla-Arg) 4) ,
[0416] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 233, NLS3-Arg- (βAla-Arg) 4) ,
[0417] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 234, NLS3-Arg- (βAla-Arg) 4) ,
[0418] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 235, NLS3-Arg- (βAla-Arg) 4) ,
[0419] Ac-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 835) ,
[0420] C8-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 836) ,
[0421] C10-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 837) ,
[0422] C12-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 838) ,
[0423] C14-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 839) ,
[0424] C16-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 840) ,
[0425] C18-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 841) ,
[0426] C20-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 842) ,
[0427] C22-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 843) ,
[0428] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 844) ,
[0429] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 845) ,
[0430] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 846) ,
[0431] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 847) ,
[0432] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 848) ,
[0433] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 849) ,
[0434] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 850) ,
[0435] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 851) ,
[0436] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 852) ,
[0437] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 853) ,
[0438] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 854) ,
[0439] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 855) ,
[0440] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 856) ,
[0441] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 857) ,
[0442] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 858) ,
[0443] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 859) ,
[0444] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 860) ,
[0445] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 861) ,
[0446] Ac-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 862) ,
[0447] C8-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 863) ,
[0448] C10-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 864) ,
[0449] C12-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 865) ,
[0450] C14-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 866) ,
[0451] C16-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 867) ,
[0452] C18-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 868) ,
[0453] C20-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 869) ,
[0454] C22-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 870) ,
[0455] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 871) ,
[0456] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 872) ,
[0457] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 873) ,
[0458] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 874) ,
[0459] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 875) ,
[0460] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 876) ,
[0461] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 877) ,
[0462] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 878) ,
[0463] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 879) ,
[0464] Ac-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 880) ,
[0465] C8-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 881) ,
[0466] C10-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 882) ,
[0467] C12-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 883) ,
[0468] C14-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 884) ,
[0469] C16-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 885) ,
[0470] C18-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 886) ,
[0471] C20-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 887) ,
[0472] C22-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 888) ,
[0473] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 889) ,
[0474] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 890) ,
[0475] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 891) ,
[0476] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 892) ,
[0477] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 893) ,
[0478] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 894) ,
[0479] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 895) ,
[0480] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 896) ,
[0481] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 897) ,
[0482] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 898) ,
[0483] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 899) ,
[0484] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 900) ,
[0485] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 901) ,
[0486] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 902) ,
[0487] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 903) ,
[0488] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 904) ,
[0489] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 905) ,
[0490] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 906) ,
[0491] Ac-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 907) ,
[0492] C8-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 908) ,
[0493] C10-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 909) ,
[0494] C12-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 910) ,
[0495] C14-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 911) ,
[0496] C16-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 912) ,
[0497] C18-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 913) ,
[0498] C20-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 914) ,
[0499] C22-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 915) ,
[0500] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 916) ,
[0501] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 917) ,
[0502] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 918) ,
[0503] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 919) ,
[0504] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 920) ,
[0505] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 921) ,
[0506] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 922) ,
[0507] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 923) ,
[0508] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 924) ,
[0509] Acetyl- (GuanidylC6NHPeptoid-Ahx) 7GuanidylC6NHPeptoid-Cys-NH2, (SEQ ID No. 236) ,
[0510] C18-Ahx-GuanidylC6NHPeptoid- (Ahx-GuanidylC6NHPeptoid) 7-Cys-NH2 (SEQ ID No. 237) .
[0511] In a more preferred embodiment, any one or more Arg in above peptide.
[0512] In a further preferred embodiment, the peptide is selected from the group comprising:
[0513] Ac-Cys-DArg-βAla-DArg-βAla-DArg-βAla-DArg-βAla-DArg-βAla-DArg-NH2 (SEQ ID No. 1213) .
[0514] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same unit structures of (X1X2X3) , wherein X2 is the spacer and X1 and X3 are arginine or arginine-analog, wherein the spacer consists of one residue.
[0515] In some preferable embodiments, wherein the residue is preferably Aminohexanoic acid or β-alanine.
[0516] In some preferable embodiments, the peptide has the following structure of Formula II:
[0517] R11-W1-PP-R12 (Formula II)
[0518] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, and the PP is the same as defined above; and wherein W1 is connected to the linker.
[0519] In some preferable embodiments, the peptide has the following structure of Formula III:
[0520] R11-X-PP-R12 (Formula III)
[0521] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is NLS, and the PP is the same as defined above; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.
[0522] In some preferable embodiments, the peptide has the following structure of Formula IV:
[0523] R11-PP-W2-R12 (Formula IV)
[0524] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, and the PP is the same as defined above; and wherein W2 is connected to the linker.
[0525] In some preferable embodiments, the peptide has the following structure of Formula V:
[0526] R11-W1-PP-W2-R12 (Formula V)
[0527] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 are connected to the linker.
[0528] In some preferable embodiments, the peptide has the following structure of Formula VI:
[0529] R11-W1-X-PP-R12 (Formula VI)
[0530] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0531] In some preferable embodiments, the peptide has the following structure of Formula I:
[0532] R11-W1-X-PP-W2-R12 (Formula I)
[0533] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0534] In some preferable embodiments, the peptide is selected from the group comprising:
[0535] Ac- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 238) ,
[0536] C8- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 239) ,
[0537] C10- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 240) ,
[0538] C12- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 241) ,
[0539] C14- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 242) ,
[0540] C16- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 243) ,
[0541] C18- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 244) ,
[0542] C20- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 245) ,
[0543] C22- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 246) ,
[0544] Ac- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 247) ,
[0545] C8- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 248) ,
[0546] C10- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 249) ,
[0547] C12- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 250) ,
[0548] C14- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 251) ,
[0549] C16- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 252) ,
[0550] C18- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 253) ,
[0551] C20- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 254) ,
[0552] C22- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 255) ,
[0553] Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 256) ,
[0554] C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 257) ,
[0555] C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 258) ,
[0556] C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 259) ,
[0557] C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 260) ,
[0558] C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 261) ,
[0559] C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 262) ,
[0560] C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 263) ,
[0561] C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 264) ,
[0562] Ac- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 265) ,
[0563] C8- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 266) ,
[0564] C10- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 267) ,
[0565] C12- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 268) ,
[0566] C14- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 269) ,
[0567] C16- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 270) ,
[0568] C18- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 271) ,
[0569] C20- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 272) ,
[0570] C22- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 273) ,
[0571] Ac-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 274) ,
[0572] C8-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 275) ,
[0573] C10-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 276) ,
[0574] C12-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 277) ,
[0575] C14-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 278) ,
[0576] C16-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 279) ,
[0577] C18-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 280) ,
[0578] C20-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 281) ,
[0579] C22-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 282) ,
[0580] Ac-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 283) ,
[0581] C8-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 284) ,
[0582] C10-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 285) ,
[0583] C12-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 286) ,
[0584] C14-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 287) ,
[0585] C16-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 288) ,
[0586] C18-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 289) ,
[0587] C20-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 290) ,
[0588] C22-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 291) ,
[0589] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 292) (NLS1- (Arg-βAla-Arg) 4) ,
[0590] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 293) (NLS1- (Arg-βAla-Arg) 4) ,
[0591] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 294) (NLS1- (Arg-βAla-Arg) 4) ,
[0592] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 295) (NLS1- (Arg-βAla-Arg) 4) ,
[0593] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 296) (NLS1- (Arg-βAla-Arg) 4) ,
[0594] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 297) (NLS1- (Arg-βAla-Arg) 4) ,
[0595] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 298) (NLS1- (Arg-βAla-Arg) 4) ,
[0596] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 299) (NLS1- (Arg-βAla-Arg) 4) ,
[0597] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 300) (NLS1- (Arg-βAla-Arg) 4) ,
[0598] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 301) (NLS1- (Arg-βAla-Arg) 4) ,
[0599] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 302) (NLS1- (Arg-βAla-Arg) 4) ,
[0600] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 303) (NLS1- (Arg-βAla-Arg) 4) ,
[0601] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 304) (NLS1- (Arg-βAla-Arg) 4) ,
[0602] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 305) (NLS1- (Arg-βAla-Arg) 4) ,
[0603] C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 306) (NLS1- (Arg-βAla-Arg) 4) ,
[0604] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 307) (NLS1- (Arg-βAla-Arg) 4) ,
[0605] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 308) (NLS1- (Arg-βAla-Arg) 4) ,
[0606] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 309) (NLS1- (Arg-βAla-Arg) 4) ,
[0607] Ac-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 310) ,
[0608] C8-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 311) ,
[0609] C10-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 312) ,
[0610] C12-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 313) ,
[0611] C14-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 314) ,
[0612] C16-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 315) ,
[0613] C18-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 316) ,
[0614] C20-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 317) ,
[0615] C22-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 318) ,
[0616] Ac-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 319) ,
[0617] C8-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 320) ,
[0618] C10-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 321) ,
[0619] C12-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 322
[0620] C14-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 323) ,
[0621] C16-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 324) ,
[0622] C18-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 325) ,
[0623] C20-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 326) ,
[0624] C22-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 327
[0625] Ac-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 328) ,
[0626] C8-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 329) ,
[0627] C10-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 330) ,
[0628] C12-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 331
[0629] C14-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 332) ,
[0630] C16-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 333) ,
[0631] C18-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 334) ,
[0632] C20-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 335) ,
[0633] C22-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 336) ,
[0634] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 337) (NLS1- (Arg-βAla-Arg) 4) ,
[0635] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 338) (NLS1- (Arg-βAla-Arg) 4) ,
[0636] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 339) (NLS1- (Arg-βAla-Arg) 4) ,
[0637] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 340) (NLS1- (Arg-βAla-Arg) 4) ,
[0638] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 341) (NLS1- (Arg-βAla-Arg) 4) ,
[0639] C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 342) (NLS1- (Arg-βAla-Arg) 4) ,
[0640] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 343) (NLS1- (Arg-βAla-Arg) 4) ,
[0641] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 344) (NLS1- (Arg-βAla-Arg) 4) ,
[0642] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 345) (NLS1- (Arg-βAla-Arg) 4) ,
[0643] Ac- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 925) ,
[0644] C8- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 926) ,
[0645] C10- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 927) ,
[0646] C12- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 928) ,
[0647] C14- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 929) ,
[0648] C16- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 930) ,
[0649] C18- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 931) ,
[0650] C20- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 932) ,
[0651] C22- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 933) ,
[0652] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 934) ,
[0653] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 935) ,
[0654] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 936) ,
[0655] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 937) ,
[0656] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 938) ,
[0657] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 939) ,
[0658] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 940) ,
[0659] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 941) ,
[0660] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 942) ,
[0661] Ac- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 943) ,
[0662] C8- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 944) ,
[0663] C10- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 945) ,
[0664] C12- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 946) ,
[0665] C14- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 947) ,
[0666] C16- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 948) ,
[0667] C18- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 949) ,
[0668] C20- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 950) ,
[0669] C22- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 951) ,
[0670] Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 952) ,
[0671] C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 953) ,
[0672] C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 954) ,
[0673] C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 955) ,
[0674] C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 956) ,
[0675] C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 957) ,
[0676] C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 958) ,
[0677] C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 959) ,
[0678] C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 960) ,
[0679] Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 961) ,
[0680] C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 962) ,
[0681] C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 963) ,
[0682] C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 964) ,
[0683] C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 965) ,
[0684] C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 966) ,
[0685] C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 967) ,
[0686] C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 968) ,
[0687] C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 969) ,
[0688] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 970) ,
[0689] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 971) ,
[0690] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 972) ,
[0691] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 973) ,
[0692] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 974) ,
[0693] C16-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 975) ,
[0694] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 976) ,
[0695] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 977) ,
[0696] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 978) .
[0697] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same unit structures of (X1X2X3) , wherein X1 is proline and X2 and X3 are arginine or arginine-analog, wherein proline and arginine can be L or D form.
[0698] In some preferable embodiments, the peptide has the following structure of Formula II:
[0699] R11-W1-PP-R12 (Formula II)
[0700] wherein R11 is a fatty acid modification or acetyl modification, R12 is absent or NH2, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 is connected to the linker.
[0701] In some preferable embodiments, the peptide has the following structure of Formula III:
[0702] R11-X-PP-R12 (Formula III)
[0703] wherein R11 is a fatty acid modification or acetyl modification, R12 is absent or NH2, X is NLS, and the PP is the same as defined above; preferably, the NLS is selected from NLS1, NLS2 or NLS3; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.
[0704] In some preferable embodiments, the peptide has the following structure of Formula V:
[0705] R11-W1-PP-W2-R12 (Formula V)
[0706] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 are connected to the linker.
[0707] In some preferable embodiments, the peptide has the following structure of Formula VI:
[0708] R11-W1-X-PP-R12 (Formula VI)
[0709] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0710] In some preferable embodiments, the peptide has the following structure of Formula I:
[0711] R11-W1-X-PP-W2-R12 (Formula I)
[0712] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, each of W1 and W2 is Cys or Lys, and the PP is the same as defined above; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.
[0713] In some preferable embodiments, the peptide is selected from the group comprising:
[0714] Ac-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 772) ,
[0715] C8-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 773) ,
[0716] C10-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 774) ,
[0717] C12-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 775) ,
[0718] C14-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 776) ,
[0719] C16-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 777) ,
[0720] C18-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 778) ,
[0721] C20-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 779) ,
[0722] C22-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 780) ,
[0723] Ac-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 781) ,
[0724] C8-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 782) ,
[0725] C10-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 783) ,
[0726] C12-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 784) ,
[0727] C14-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 785) ,
[0728] C16-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 786) ,
[0729] C18-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 787) ,
[0730] C20-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 788) ,
[0731] C22-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 789) ,
[0732] Ac-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 364) ,
[0733] C8-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 365) ,
[0734] C10-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 366) ,
[0735] C12-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 367) ,
[0736] C14-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 368) ,
[0737] C16-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 369) ,
[0738] C18-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 370) ,
[0739] C20-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 371) ,
[0740] C22-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 372) ,
[0741] Ac-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 373) ,
[0742] C8-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 374) ,
[0743] C10-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 375) ,
[0744] C12-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 376) ,
[0745] C14-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 377) ,
[0746] C16-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 378) ,
[0747] C18-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 379) ,
[0748] C20-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 380) ,
[0749] C22-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 381) ,
[0750] Ac-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 382) ,
[0751] C8-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 383) ,
[0752] C10-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 384) ,
[0753] C12-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 385) ,
[0754] C14-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 386) ,
[0755] C16-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 387) ,
[0756] C18-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 388) ,
[0757] C20-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 389) ,
[0758] C22-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 390) ,
[0759] Ac-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 391) ,
[0760] C8-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 392) ,
[0761] C10-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 393) ,
[0762] C12-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 394) ,
[0763] C14-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 395) ,
[0764] C16-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 396) ,
[0765] C18-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 397) ,
[0766] C20-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 398) ,
[0767] C22-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 399) ,
[0768] Ac-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 400) ,
[0769] C8-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 401) ,
[0770] C10-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 402) ,
[0771] C12-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 403) ,
[0772] C14-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 404) ,
[0773] C16-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 405) ,
[0774] C18-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 406) ,
[0775] C20-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 407) ,
[0776] C22-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 408) ,
[0777] Ac-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 409) ,
[0778] C8-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 410) ,
[0779] C10-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 411) ,
[0780] C12-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 412) ,
[0781] C14-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 413) ,
[0782] C16-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 414) ,
[0783] C18-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 415) ,
[0784] C20-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 416) ,
[0785] C22-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 417) ,
[0786] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 418) (NLS1-pRR3) ,
[0787] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 419) (NLS1-pRR3) ,
[0788] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 420) (NLS1-pRR3) ,
[0789] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 421) (NLS1-pRR3) ,
[0790] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 422) (NLS1-pRR3) ,
[0791] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 423) (NLS1-pRR3) ,
[0792] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 424 (NLS1-pRR3) ,
[0793] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 425) (NLS1-pRR3) ,
[0794] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 426) (NLS1-pRR3) ,
[0795] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 427) (NLS1-pRR3) ,
[0796] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 428) (NLS1-pRR3) ,
[0797] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 429) (NLS1-pRR3) ,
[0798] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 430) (NLS1-pRR3) ,
[0799] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 431) (NLS1-pRR3) ,
[0800] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 432) (NLS1-pRR3) ,
[0801] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 433) (NLS1-pRR3) ,
[0802] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 434) (NLS2-pRR3) ,
[0803] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 435) (NLS2-pRR3) ,
[0804] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 436) (NLS2-pRR3) ,
[0805] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 437) (NLS2-pRR3) ,
[0806] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 438) (NLS2-pRR3) ,
[0807] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 439) (NLS2-pRR3) ,
[0808] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 440) (NLS2-pRR3) ,
[0809] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 441) (NLS2-pRR3) ,
[0810] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 442) (NLS2-pRR3) ,
[0811] Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 443) (NLS2-pRR3) ,
[0812] C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 444) (NLS2-pRR3) ,
[0813] C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 445) (NLS2-pRR3) ,
[0814] C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 446) (NLS2-pRR3) ,
[0815] C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 447) (NLS2-pRR3) ,
[0816] C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 448) (NLS2-pRR3) ,
[0817] C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 449) (NLS2-pRR3) ,
[0818] C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 450) (NLS2-pRR3) ,
[0819] C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 451) (NLS2-pRR3) ,
[0820] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 452) (NLS3-pRR3) ,
[0821] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 453) (NLS3-pRR3) ,
[0822] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 454) (NLS3-pRR3) ,
[0823] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 455) (NLS3-pRR3) ,
[0824] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 456) (NLS3-pRR3) ,
[0825] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 457) (NLS3-pRR3) ,
[0826] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 458) (NLS3-pRR3) ,
[0827] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 459) (NLS3-pRR3) ,
[0828] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 460) (NLS3-pRR3) ,
[0829] Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 461) (NLS3-pRR3) ,
[0830] C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 462) (NLS3-pRR3) ,
[0831] C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 463) (NLS3-pRR3) ,
[0832] C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 464) (NLS3-pRR3) ,
[0833] C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 465) (NLS3-pRR3) ,
[0834] C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 466) (NLS3-pRR3) ,
[0835] C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 467) (NLS3-pRR3) ,
[0836] C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 468) (NLS3-pRR3) ,
[0837] C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 469) (NLS3-pRR3) ,
[0838] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 470) (NLS1-pRR4) ,
[0839] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 471) (NLS1-pRR4) ,
[0840] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 472) (NLS1-pRR4) ,
[0841] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 473) (NLS1-pRR4) ,
[0842] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 474) (NLS1-pRR4) ,
[0843] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 475) (NLS1-pRR4) ,
[0844] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 476) (NLS1-pRR4) ,
[0845] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 477) (NLS1-pRR4) ,
[0846] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 478) (NLS1-pRR4) ,
[0847] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 479) (NLS1-pRR4) ,
[0848] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 480) (NLS1-pRR4) ,
[0849] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 481) (NLS1-pRR4) ,
[0850] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 482) (NLS1-pRR4) ,
[0851] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 483) (NLS1-pRR4) ,
[0852] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 484) (NLS1-pRR4) ,
[0853] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 485) (NLS1-pRR4) ,
[0854] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 486) (NLS2-pRR4) ,
[0855] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 487) (NLS2-pRR4) ,
[0856] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 488) (NLS2-pRR4) ,
[0857] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 489) (NLS2-pRR4) ,
[0858] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 490) (NLS2-pRR4) ,
[0859] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 491) (NLS2-pRR4) ,
[0860] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 492) (NLS2-pRR4) ,
[0861] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 493) (NLS2-pRR4) ,
[0862] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 494) (NLS2-pRR4) ,
[0863] Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 495) (NLS2-pRR4) ,
[0864] C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 496) (NLS2-pRR4) ,
[0865] C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 497) (NLS2-pRR4) ,
[0866] C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 498) (NLS2-pRR4) ,
[0867] C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 499) (NLS2-pRR4) ,
[0868] C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 500) (NLS2-pRR4) ,
[0869] C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 501) (NLS2-pRR4) ,
[0870] C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 502) (NLS2-pRR4) ,
[0871] C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 503) (NLS2-pRR4) ,
[0872] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 504) (NLS3-pRR4) ,
[0873] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 505) (NLS3-pRR4) ,
[0874] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 506) (NLS3-pRR4) ,
[0875] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 507) (NLS3-pRR4) ,
[0876] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 508) (NLS3-pRR4) ,
[0877] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 509) (NLS3-pRR4) ,
[0878] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 510) (NLS3-pRR4) ,
[0879] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 511) (NLS3-pRR4) ,
[0880] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 512) (NLS3-pRR4) ,
[0881] Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 513) (NLS3-pRR4) ,
[0882] C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 514) (NLS3-pRR4) ,
[0883] C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 515) (NLS3-pRR4) ,
[0884] C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 516) (NLS3-pRR4) ,
[0885] C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 517) (NLS3-pRR4) ,
[0886] C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 518) (NLS3-pRR4) ,
[0887] C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 519) (NLS3-pRR4) ,
[0888] C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 520) (NLS3-pRR4) ,
[0889] C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 521) (NLS3-pRR4) ,
[0890] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 522) (NLS1-pRR5) ,
[0891] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 523) (NLS1-pRR5) ,
[0892] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 524) (NLS1-pRR5) ,
[0893] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 525) (NLS1-pRR5) ,
[0894] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 526) (NLS1-pRR5) ,
[0895] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 527) (NLS1-pRR5) ,
[0896] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 528) (NLS1-pRR5) ,
[0897] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 529) (NLS1-pRR5) ,
[0898] Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 530) (NLS1-pRR5) ,
[0899] C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 531) (NLS1-pRR5) ,
[0900] C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 532) (NLS1-pRR5) ,
[0901] C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 533) (NLS1-pRR5) ,
[0902] C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 534) (NLS1-pRR5) ,
[0903] C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 535) (NLS1-pRR5) ,
[0904] C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 536) (NLS1-pRR5) ,
[0905] C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 537) (NLS1-pRR5) ,
[0906] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 538) (NLS2-pRR5) ,
[0907] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 539) ,
[0908] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 540) ,
[0909] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 541) ,
[0910] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 542) ,
[0911] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 543) ,
[0912] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 544) ,
[0913] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 545) ,
[0914] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 546) ,
[0915] Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 547) (NLS2-pRR5) ,
[0916] C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 548) (NLS2-pRR5) ,
[0917] C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 549) (NLS2-pRR5) ,
[0918] C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 550) (NLS2-pRR5) ,
[0919] C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 551) (NLS2-pRR5) ,
[0920] C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 552) (NLS2-pRR5) ,
[0921] C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 553) (NLS2-pRR5) ,
[0922] C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 554) (NLS2-pRR5) ,
[0923] C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 555) (NLS2-pRR5) ,
[0924] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 556) (NLS3-pRR5) ,
[0925] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 557) (NLS3-pRR5) ,
[0926] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 558) (NLS3-pRR5) ,
[0927] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 559) (NLS3-pRR5) ,
[0928] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 560) (NLS3-pRR5) ,
[0929] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 561) (NLS3-pRR5) ,
[0930] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 562) (NLS3-pRR5) ,
[0931] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 563) (NLS3-pRR5) ,
[0932] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 564) (NLS3-pRR5) ,
[0933] Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 565) (NLS3-pRR5) ,
[0934] C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 566) (NLS3-pRR5) ,
[0935] C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 567) (NLS3-pRR5) ,
[0936] C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 568) (NLS3-pRR5) ,
[0937] C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 569) (NLS3-pRR5) ,
[0938] C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 570) (NLS3-pRR5) ,
[0939] C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 571) (NLS3-pRR5) ,
[0940] C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 572) (NLS3-pRR5) ,
[0941] C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 573) (NLS3-pRR5) ,
[0942] Ac-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 790) ,
[0943] C8-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 791) ,
[0944] C10-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 792) ,
[0945] C12-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 793) ,
[0946] C14-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 794) ,
[0947] C16-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 795) ,
[0948] C18-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 796) ,
[0949] C20-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 797) ,
[0950] C22-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 798) ,
[0951] Ac-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 583) ,
[0952] C8-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 584) ,
[0953] C10-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 585) ,
[0954] C12-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 586) ,
[0955] C14-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 587) ,
[0956] C16-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 588) ,
[0957] C18-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 589) ,
[0958] C20-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 590) ,
[0959] C22-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 591) ,
[0960] Ac-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 592) ,
[0961] C8-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 593) ,
[0962] C10-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 594) ,
[0963] C12-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 595) ,
[0964] C14-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 596) ,
[0965] C16-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 597) ,
[0966] C18-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 598) ,
[0967] C20-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 599) ,
[0968] C22-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 600) ,
[0969] Ac-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 601) ,
[0970] C8-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 602) ,
[0971] C10-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 603) ,
[0972] C12-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 604) ,
[0973] C14-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 605) ,
[0974] C16-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 606) ,
[0975] C18-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 607) ,
[0976] C20-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 608) ,
[0977] C22-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 609) ,
[0978] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 610) (NLS1-pRR3) ,
[0979] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 611) (NLS1-pRR3) ,
[0980] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 612) (NLS1-pRR3) ,
[0981] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 613) (NLS1-pRR3) ,
[0982] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 614) (NLS1-pRR3) ,
[0983] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 615) (NLS1-pRR3) ,
[0984] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 616) (NLS1-pRR3) ,
[0985] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 617) (NLS1-pRR3) ,
[0986] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 618) (NLS2-pRR3) ,
[0987] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 619) (NLS2-pRR3) ,
[0988] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 620) (NLS2-pRR3) ,
[0989] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 621) (NLS2-pRR3) ,
[0990] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 622) (NLS2-pRR3) ,
[0991] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 623) (NLS2-pRR3) ,
[0992] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 624) (NLS2-pRR3) ,
[0993] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 625) (NLS2-pRR3) ,
[0994] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 626) (NLS2-pRR3) ,
[0995] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 627) (NLS3-pRR3) ,
[0996] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 628) (NLS3-pRR3) ,
[0997] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 629) (NLS3-pRR3) ,
[0998] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 630) (NLS3-pRR3) ,
[0999] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 631) (NLS3-pRR3) ,
[1000] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 632) (NLS3-pRR3) ,
[1001] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 633) (NLS3-pRR3) ,
[1002] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 634) (NLS3-pRR3) ,
[1003] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 635) (NLS3-pRR3) ,
[1004] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 636) (NLS1-pRR4) ,
[1005] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 637) (NLS1-pRR4) ,
[1006] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 638) (NLS1-pRR4) ,
[1007] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 639) (NLS1-pRR4) ,
[1008] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 640) (NLS1-pRR4) ,
[1009] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 641) (NLS1-pRR4) ,
[1010] C20-CysPro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 642) (NLS1-pRR4) ,
[1011] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 643) (NLS1-pRR4) ,
[1012] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 644) (NLS2-pRR4) ,
[1013] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 645) (NLS2-pRR4) ,
[1014] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 646) (NLS2-pRR4) ,
[1015] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 647) (NLS2-pRR4) ,
[1016] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 648) (NLS2-pRR4) ,
[1017] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 649) (NLS2-pRR4) ,
[1018] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 650) (NLS2-pRR4) ,
[1019] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 651) (NLS2-pRR4) ,
[1020] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 652) (NLS2-pRR4) ,
[1021] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 653) (NLS3-pRR4) ,
[1022] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 654) (NLS3-pRR4) ,
[1023] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 655) (NLS3-pRR4) ,
[1024] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 656) (NLS3-pRR4) ,
[1025] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 657) (NLS3-pRR4) ,
[1026] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 658) (NLS3-pRR4) ,
[1027] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 659) (NLS3-pRR4) ,
[1028] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 660) (NLS3-pRR4) ,
[1029] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 661) (NLS3-pRR4) ,
[1030] Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 662) (NLS1-pRR5) ,
[1031] C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 663) (NLS1-pRR5) ,
[1032] C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 664) (NLS1-pRR5) ,
[1033] C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 665) (NLS1-pRR5) ,
[1034] C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 666) (NLS1-pRR5) ,
[1035] C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 667) (NLS1-pRR5) ,
[1036] C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 668) (NLS1-pRR5) ,
[1037] C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 669) (NLS1-pRR5) ,
[1038] Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 670) (NLS2-pRR5) ,
[1039] C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 671) (NLS2-pRR5) ,
[1040] C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 672) (NLS2-pRR5) ,
[1041] C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 673) (NLS2-pRR5) ,
[1042] C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 674) (NLS2-pRR5) ,
[1043] C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 675) (NLS2-pRR5) ,
[1044] C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 676) (NLS2-pRR5) ,
[1045] C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 677) (NLS2-pRR5) ,
[1046] C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 678) (NLS2-pRR5) ,
[1047] Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 679) (NLS3-pRR5) ,
[1048] C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 680) (NLS3-pRR5) ,
[1049] C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 681) (NLS3-pRR5) ,
[1050] C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 682) (NLS3-pRR5) ,
[1051] C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 683) (NLS3-pRR5) ,
[1052] C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 684) (NLS3-pRR5) ,
[1053] C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 685) (NLS3-pRR5) ,
[1054] C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 686) (NLS3-pRR5) ,
[1055] C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 687) (NLS3-pRR5) ,
[1056] Ac- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 979) ,
[1057] C8- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 980) ,
[1058] C10- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 981) ,
[1059] C12- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 982) ,
[1060] C14- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 983) ,
[1061] C16- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 984) ,
[1062] C18- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 985) ,
[1063] C20- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 986) ,
[1064] C22- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 987) ,
[1065] Ac- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 988) ,
[1066] C8- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 989) ,
[1067] C10- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 990) ,
[1068] C12- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 991) ,
[1069] C14- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 992) ,
[1070] C16- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 993) ,
[1071] C18- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 994) ,
[1072] C20- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 995) ,
[1073] C22- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 996) ,
[1074] Ac- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 997) ,
[1075] C8- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 998) ,
[1076] C10- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 999) ,
[1077] C12- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1000) ,
[1078] C14- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1001) ,
[1079] C16- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1002) ,
[1080] C18- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1003) ,
[1081] C20- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1004) ,
[1082] C22- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1005) ,
[1083] Ac- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1006) ,
[1084] C8- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1007) ,
[1085] C10- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1008) ,
[1086] C12- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1009) ,
[1087] C14- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1010) ,
[1088] C16- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1011) ,
[1089] C18- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1012) ,
[1090] C20- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1013) ,
[1091] C22- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1014) ,
[1092] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1015) ,
[1093] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1016) ,
[1094] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1017) ,
[1095] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1018) ,
[1096] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1019) ,
[1097] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1020) ,
[1098] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1021) ,
[1099] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1022) ,
[1100] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1023) ,
[1101] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1024) ,
[1102] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1025) ,
[1103] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1026) ,
[1104] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1027) ,
[1105] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1028) ,
[1106] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1029) ,
[1107] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1030) ,
[1108] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1031) ,
[1109] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1032) ,
[1110] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1033) ,
[1111] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1034) ,
[1112] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1035) ,
[1113] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1036) ,
[1114] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1037) ,
[1115] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1038) ,
[1116] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1039) ,
[1117] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1040) ,
[1118] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1041) ,
[1119] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1042) ,
[1120] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1043) ,
[1121] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1044) ,
[1122] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1045) ,
[1123] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1046) ,
[1124] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1047) ,
[1125] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1048) ,
[1126] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1049) ,
[1127] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1050) ,
[1128] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1051) ,
[1129] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1052) ,
[1130] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1053) ,
[1131] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1054) ,
[1132] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1055) ,
[1133] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1056) ,
[1134] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1057) ,
[1135] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1058) ,
[1136] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1059) ,
[1137] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1060) ,
[1138] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1061) ,
[1139] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1062) ,
[1140] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1063) ,
[1141] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1064) ,
[1142] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1065) ,
[1143] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1066) ,
[1144] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1067) ,
[1145] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1068) ,
[1146] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1069) ,
[1147] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1070) ,
[1148] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1071) ,
[1149] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1072) ,
[1150] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1073) ,
[1151] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1074) ,
[1152] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1075) ,
[1153] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1076) ,
[1154] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1077) ,
[1155] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1078) ,
[1156] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1079) ,
[1157] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1080) ,
[1158] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1081) ,
[1159] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1082) ,
[1160] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1083) ,
[1161] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1084) ,
[1162] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1085) ,
[1163] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1086) ,
[1164] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1087) ,
[1165] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1088) ,
[1166] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1089) ,
[1167] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1090) ,
[1168] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1091) ,
[1169] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1092) ,
[1170] Ac- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1093) ,
[1171] C8- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1094) ,
[1172] C10- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1095) ,
[1173] C12- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1096) ,
[1174] C14- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1097) ,
[1175] C16- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1098) ,
[1176] C18- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1099) ,
[1177] C20- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1100) ,
[1178] C22- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1101) ,
[1179] Ac- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1102) ,
[1180] C8- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1103) ,
[1181] C10- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1104) ,
[1182] C12- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1105) ,
[1183] C14- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1106) ,
[1184] C16- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1107) ,
[1185] C18- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1108) ,
[1186] C20- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1109) ,
[1187] C22- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1110) ,
[1188] Ac- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1111) ,
[1189] C8- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1112) ,
[1190] C10- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1113) ,
[1191] C12- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1114) ,
[1192] C14- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1115) ,
[1193] C16- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1116) ,
[1194] C18- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1117) ,
[1195] C20- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1118) ,
[1196] C22- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1119) ,
[1197] Ac- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1120) ,
[1198] C8- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1121) ,
[1199] C10- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1122) ,
[1200] C12- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1123) ,
[1201] C14- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1124) ,
[1202] C16- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1125) ,
[1203] C18- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1126) ,
[1204] C20- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1127) ,
[1205] C22- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1128) ,
[1206] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1129) ,
[1207] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1130) ,
[1208] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1131) ,
[1209] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1132) ,
[1210] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1133) ,
[1211] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1134) ,
[1212] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1135) ,
[1213] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1136) ,
[1214] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1137) ,
[1215] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1138) ,
[1216] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1139) ,
[1217] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1140) ,
[1218] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1141) ,
[1219] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1142) ,
[1220] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1143) ,
[1221] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1144) ,
[1222] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1145) ,
[1223] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1146) ,
[1224] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1147) ,
[1225] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1148) ,
[1226] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1149) ,
[1227] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1150) ,
[1228] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1151) ,
[1229] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1152) ,
[1230] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1153) ,
[1231] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1154) ,
[1232] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1155) ,
[1233] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1156) ,
[1234] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1157) ,
[1235] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1158) ,
[1236] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1159) ,
[1237] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1160) ,
[1238] C20-CysPro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1161) ,
[1239] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1162) ,
[1240] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1163) ,
[1241] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1164) ,
[1242] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1165) ,
[1243] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1166) ,
[1244] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1167) ,
[1245] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1168) ,
[1246] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1169) ,
[1247] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1170) ,
[1248] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1171) ,
[1249] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1172) ,
[1250] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1173) ,
[1251] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1174) ,
[1252] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1175) ,
[1253] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1176) ,
[1254] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1177) ,
[1255] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1178) ,
[1256] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1179) ,
[1257] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1180) ,
[1258] Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1181) ,
[1259] C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1182) ,
[1260] C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1183) ,
[1261] C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1184) ,
[1262] C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1185) ,
[1263] C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1186) ,
[1264] C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1187) ,
[1265] C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1188) ,
[1266] Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1189) ,
[1267] C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1190) ,
[1268] C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1191) ,
[1269] C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1192) ,
[1270] C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1193) ,
[1271] C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1194) ,
[1272] C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1195) ,
[1273] C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1196) ,
[1274] C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1197) ,
[1275] Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1198) ,
[1276] C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1199) ,
[1277] C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1200) ,
[1278] C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1201) ,
[1279] C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1202) ,
[1280] C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1203) ,
[1281] C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1204) ,
[1282] C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1205) ,
[1283] C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1206) .
[1284] In a more preferred embodiment, any one or more Arg in SEQ ID NO. 772-798, SEQ ID NO. 364-573, and SEQ ID NO.583-687 may be DArg.
[1285] In a further preferred embodiment, the peptide is selected from the group comprising:
[1286] Ac-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 346) ,
[1287] C8-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 347) ,
[1288] C10-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 348) ,
[1289] C12-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 349) ,
[1290] C14-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 350) ,
[1291] C16-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 351) ,
[1292] C18-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 352) ,
[1293] C20-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 353) ,
[1294] C22-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 354) ,
[1295] Ac-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 355) ,
[1296] C8-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 356) ,
[1297] C10-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 357) ,
[1298] C12-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 358) ,
[1299] C14-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 359) ,
[1300] C16-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 360) ,
[1301] C18-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 361) ,
[1302] C20-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 362) ,
[1303] C22-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 363) ,
[1304] Ac-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 574) ,
[1305] C8-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 575) ,
[1306] C10-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 576) ,
[1307] C12-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 577) ,
[1308] C14-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 578) ,
[1309] C16-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 579) ,
[1310] C18-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 580) ,
[1311] C20-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 581) ,
[1312] C22-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 582) .
[1313] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same or different unit structures of (X1X2X3) , wherein 1 in X1, X2 and X3 is the spacer and the other 2 are the residues of the oligo-arginine or oligo-arginine-analog, and the spacer consists of 1 residue.
[1314] In some preferable embodiments, the residue of the spacer is preferably tryptophan.
[1315] In some preferable embodiments, the peptide has the following structure of Formula II:
[1316] R11-W1-PP-R12 (Formula II)
[1317] wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined above; and wherein W1 is connected to the linker.
[1318] In some preferable embodiments, the peptide is selected from the group comprising:
[1319] C18-Cys-Arg-Arg-Trp-Trp-Arg-Arg-Trp-Arg-Arg-CONH2 (SEQ ID No. 688) ,
[1320] C18-Arg-Arg-Trp-Trp-Arg-Arg-Trp-Arg-Arg-CONH2 (SEQ ID No. 1207) ,
[1321] Ac-Cys-Arg-Arg-Arg-Arg-Trp-NH2 (SEQ ID No. 1223) .
[1322] In some embodiments, the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that one spacer is implanted in between every two adjacent residues in the oligo-arginine or oligo-arginine-analog, wherein the spacer consists of one residue.
[1323] In some preferable embodiments, the residue is preferably tryptophan, phenylalanine or leucine.
[1324] In some preferable embodiments, the peptide is selected from the group comprising:
[1325] Ac-Cys-Arg-Trp-Arg-Trp-Arg-NH2 (SEQ ID No. 1215) ,
[1326] Ac-Cys-Arg-Phe-Arg-Phe-Arg-Phe-Arg-NH2 (SEQ ID No. 1216) ,
[1327] Ac-Cys-Arg-Leu-Arg-Leu-Arg-Leu-Arg-NH2 (SEQ ID No. 1217) .
[1328] In other preferable embodiments, the peptide is selected from the group comprising:
[1329] Ac-Cys-Trp-Arg-Arg-Arg-Arg-Arg-Arg-Trp-NH2 (SEQ ID No. 1214) ,
[1330] Ac-Cys-Arg-Arg-Arg-Arg-Trp-Trp-NH2 (SEQ ID No. 1218) ,
[1331] Ac-Cys-Arg-Lys-Lys-Arg-Arg-Gln-Arg-NH2 (SEQ ID No. 1219) ,
[1332] Ac-Cys-Arg-Lys-Arg-Lys-Arg-Lys-NH2 (SEQ ID No. 1220) ,
[1333] Ac-Cys-Leu-Ile-Ile-Leu-Arg-Arg-Arg-Ile-Arg-NH2 (SEQ ID No. 1221) ,
[1334] Ac-Cys-Arg-Gln-Ile-Lys-Ile-Trp-Phe-NH2 (SEQ ID No. 1222) .
[1335] In some embodiments, the peptide is selected from Table 1.
[1336] Table 1. Peptides
[1337] In some embodiments, the peptide can be replaced by peptoids. Examples of peptoids can be as follows:
[1338] In one aspect, the present disclosure provides a pharmaceutical composition comprising the conjugate or pharmaceutically / cosmetically acceptable salt thereof mentioned above. Preferably, the pharmaceutical composition comprises a pharmaceutically / cosmetically acceptable carrier.
[1339] In some embodiments, the pharmaceutical composition is selected from the group comprising ointment, cream, solution, tincture, gel, spray, powder, foam, spirit, lotion, oil, emulsion, suspension, paste, film, and aerosol. In one aspect, the present disclosure provides a cosmetic composition comprising the conjugate or cosmetically acceptable salt thereof mentioned above. Preferably, the cosmetic composition comprises a cosmetically acceptable carrier.
[1340] In some embodiments, the cosmetic composition is selected from the group comprising skin lotion, milk lotion, nourishing cream, massage cream, essence, eye cream, cleansing cream, cleansing foam, cleansing water, pack, spray, powder, hair tonic, hair cream, hair lotion, hair shampoo, hair rinse, hair conditioner, hair spray, hair aerosol, pomade, sol-gel, emulsion, oil, wax and aerosol.
[1341] In one aspect, the present disclosure provides a method, comprising topically applying the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition mentioned above to a subject in need thereof. Preferably, it is applied to the skin of the subject.
[1342] In some embodiments, the skin is aged (either intrinsic or extrinsic) skin, xerotic skin, dry skin, skin with wrinkles or other imperfections caused by aging or muscular contraction, skin with irregular pigmentation or lightening, skin with fungal infections, or skin with pain caused by external factors such as insect bites or burns.
[1343] In some embodiments, the method exhibits at least one effect chosen from anti-aging, skin hydration, skin protection, skin brightening, skin whitening, reducing wrinkles or melasma, rejuvenating and repairing skin damage, promoting collagen biosynthesis in skin, treating hyperpigmentation, treating skin conditions, increasing permeation of chemical denervation agents through skin, treating rhytides caused by muscular contraction, treating fungal infections, treating onychomycosis, as well as anti-cellulite, deodorant, anti-perspirant, nail care, and hair care uses.
[1344] In some embodiments, the skin condition is at least one condition chosen from acne, actinic damage, dandruff, eczema, fine lines, psoriasis, warts and wrinkles.
[1345] In one aspect, the present disclosure provides a method for treating a disease, comprising administering the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition mentioned above to a subject in need thereof.
[1346] In some preferable embodiments, the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition is topically administered to the subject.
[1347] In some preferable embodiments, the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition topically administered to the skin or mucosa of the subject.
[1348] In one aspect, the present disclosure provides a cosmetic method, comprising topically applying the conjugate or cosmetically acceptable salt thereof or the cosmetic composition mentioned above to a subject in need thereof.
[1349] In one aspect, methods are provided for using the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition described herein.
[1350] For example, the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition can be used in a method for supporting the natural bioactive lipid barrier function of skin, wherein the method comprises applying the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition to skin or hair. The methods may also improve the skin barrier functionality of a user’s skin. In some instances, the methods may promote regeneration, renewal, and / or repair of compromised skin. Additionally, the methods may provide improved skin appearance, such as anti-inflammation, improved skin pigmentation, etc.
[1351] Typically, the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition is applied to the skin or hair of humans. In some cases, the composition is applied to the face. Furthermore, the cosmetic composition can be used in methods for treating dryness of the skin and / or hair, repairing damage to skin and / or hair (for example, damage associated with ageing, UV exposure, dryness, etc. ) , and for diminishing the appearance of wrinkles, dark spots, and uneven skin texture. These methods also entail application of the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition described herein to the skin and / or hair, and in some cases to the face. The aforementioned methods are typically non-therapeutic.
[1352] The conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition may be applied once per day, twice per day, or more than once or twice per day. In some cases, the cosmetic composition is applied in the evenings before bed. In other cases, the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition is applied in the morning. In still other cases, the composition may be applied immediately after washing the skin and / or hair. The compositions may be used once, or for a series of days, weeks, or months. For example, the compositions may be used daily for a period of 1, 2, 3, 4, 5, 6, 7, 8 or more weeks, or months.
[1353] In one aspect, the present disclosure provides the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition mentioned above for use in the treatment of a disease.
[1354] In one aspect, the present disclosure provides the conjugate or pharmaceutically acceptable salt thereof or pharmaceutical composition for use above, wherein the disease is preferably androgenetic alopecia.
[1355] In one aspect, the present disclosure provides the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition mentioned above for use in anesthesia.
[1356] In one aspect, the present disclosure provides the conjugate or cosmetically acceptable salt thereof or the cosmetic composition mentioned above for use in anti-ageing or cosmetic application.
[1357] In one aspect, the present disclosure provides the use of the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition for body and / or facial skin and / or mucous membranes and / or the scalp and / or the hair and / or the nails and / or the eyelashes and / or the eyebrows, either as such or in a care product and / or a washing product and / or a make-up removal product.
[1358] In one aspect, the present disclosure provides the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition described herein for use in anti-ageing or cosmetic applications.
[1359] In one aspect, the present disclosure provides the conjugate or pharmaceutically / cosmetically acceptable salt thereof, or the pharmaceutical composition or cosmetic composition mentioned above for use in anti-ageing or cosmetic applications.
[1360] In one aspect, the present disclosure provides use of the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition mentioned above for the manufacture of a medicament for the treatment of a disease. In some preferable embodiments, the disease is preferably androgenetic alopecia.
[1361] In one aspect, the present disclosure provides use of the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition mentioned above for the manufacture of a medicament for anesthesia.
[1362] In one aspect, the present disclosure provides use of the conjugate or cosmetically acceptable salt thereof or the cosmetic composition mentioned above for the manufacture of an anti-ageing agent or a cosmetic.
[1363] For therapeutic applications, the compounds are administered to a mammal, in certain embodiments, a human, in a pharmaceutically acceptable dosage suitable for administration form such as those known in the art, and those discussed herein.
[1364] In some embodiments, the compounds and compositions described herein can be topically administered. In some embodiments, the topical compositions are in the form of a gel, ointment, cream, foam, spray, tonic, serum, paste, or lotion, more preferably in the form of spray, tonic or serum. In some embodiments, the spray formulation and the tonic formulation are formulated using the same unit formula. The difference of the spray formulations to the tonic formulations is that the spray formulations are administered by spraying to an affected site using a device. In some embodiments, the compounds and compositions are used in the treatment of alopecia, particularly androgenetic alopecia, in the prevention or retardation of hair loss, and in the stimulation of hair growth and helps growth of new and healthy hairs in mammalians. In addition, it is predictable to those skilled in the art that the compounds and compositions may further be used in the treatment of alopecia areata, alopecia totalis, alopecia universalis, and other types of alopecia.BRIEF DESCRIPTION OF THE DRAWINGS
[1365] FIGS. 1A and 1B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1366] FIGS. 2A and 2B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1367] FIGS. 3A and 3B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1368] FIGS. 4A and 4B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1369] FIGS. 5A and 5B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1370] FIGS. 6A and 6B show HaCaT cellular uptake of select peptides for 1 hour and 6 hours, respectively.
[1371] FIG. 7 shows cellular imaging of HaCaT cell uptake of Peptide-3 after 1 hour and 6 hours, respectively.
[1372] FIG. 8 shows the release rate and amount of payload from PDC-01.
[1373] FIG. 9 shows the release rate and amount of payload from PDC-02.
[1374] FIGS. 10A and 10B show the release rate and amount of payload from PDC-45.
[1375] FIGS. 11A and 11B show the release rate and amount of payload from PDC-46.
[1376] FIGS. 12A and 12B show the release rate and amount of payload from PDC-47.
[1377] FIGS. 13A and 13B show the release rate and amount of payload from PDC-48.
[1378] FIGS. 14A and 14B show the release rate and amount of payload from PDC-49.
[1379] FIGS. 15A and 15B show the release rate and amount of payload from PDC-50.
[1380] FIGS. 16A and 16B show the release rate and amount of payload from PDC-51.
[1381] FIGS. 17A and 17B show the release rate and amount of payload from PDC-52.
[1382] FIGS. 18A and 18B show the release rate and amount of payload from PDC-53.
[1383] FIG. 19 shows the results of stability studies of 10 Finasteride conjugates.
[1384] FIG. 20 shows the results of stability studies of Finasteride PDC-02 and Finasteride PDC-09.
[1385] FIG. 21 shows the results of payload releasing study of Finasteride PDC-02 and Finasteride PDC-09.
[1386] FIG. 22 and FIG. 23 show the results of skin penetration study of Finasteride PDC-02 and Finasteride PDC-09.
[1387] FIG. 24 shows the results of Finasteride PDCs on enzymatic inhibition towards 5α reductase.
[1388] FIG. 25 shows the results of solubility tests for Ceramide PDCs.
[1389] FIG. 26 shows the results of payload releasing study of Ceramide PDCs.
[1390] FIG. 27 shows the results of skin penetration study of Ceramide PDCs.
[1391] FIG. 28 shows the cell viability of DPC cells treated with testosterone (T) at different concentrations (10 μM or 40μM) and active pharmaceutical ingredient (API) at different concentrations (75 nM, 37.5nM, 18.75 nM or 9.375nM) : finasteride (FNS) or finasteride PDC-09 (FNS PDC-09) .
[1392] FIG. 29 shows the dermal pharmacokinetic curves of finasteride PDC-09 (FNS PDC-09) and Caretopic in the skin of mini pigs.
[1393] FIG. 30 shows skin penetration study results of Sample 1.
[1394] FIG. 31 shows skin penetration study results of Sample 2. Panel A shows result of Finasteride, Panel B shows result of Finasteride PDC-09.
[1395] FIG. 32 shows skin penetration study results of Sample 3.
[1396] FIG. 33 shows skin penetration study results of Sample 4. Panel A shows result of ceramide NS, Panel B shows result conjugate 03.
[1397] FIG. 34 shows skin penetration study results of Sample 5. Panel A shows result of ceramide NS, Panel B shows result of conjugate 04.DETAILED DESCRIPTION
[1398] The following description sets forth exemplary methods, parameters and the like. It should be recognized, however, that such description is not intended as a limitation on the scope of the present disclosure but is instead provided as a description of exemplary embodiments.
[1399] The present disclosure is directed to peptides conjugated to payloads capable of penetrating the skin and / or the cellular membranes of viable cells such as epidermal and dermal cells. Related compositions and methods are also described herein.
[1400] Definitions
[1401] Unless defined otherwise, all terms of art, notations and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and / or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.
[1402] As used herein, the singular forms "a" , "an" , and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "acell" includes a plurality of cells.
[1403] The term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value ±10%, ±5%, or ±1%. In certain embodiments, the term “about” indicates the designated value ± one standard deviation of that value.
[1404] Also as used herein, "and / or" refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative ( "or" ) .
[1405] Unless the context indicates otherwise, it is specifically intended that the various features of the present disclosure described herein can be used in any combination. Moreover, the present disclosure also contemplates that in some embodiments any feature or combination of features set forth herein can be excluded or omitted. To illustrate, if the specification states that a complex comprises components A, B, or C, it is specifically intended that any of A, B or C, or a combination thereof, can be omitted and disclaimed singularly or in any combination.
[1406] The term “bioactive lipid” as used herein, refers to a diverse group of lipids present in the epidermis that play essential roles in maintaining normal skin functions. Examples of bioactive lipids include sphingolipids, free fatty acids, sterols and sterol esters, and phospholipids. Sphingolipids, a class of lipids centered on a sphingoid base backbone, primarily consist of three core subclasses: sphingomyelins, glycosphingolipids, and ceramides.
[1407] As used herein, by “pharmaceutically acceptable” or “cosmetically acceptable” is meant a material that is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition or a cosmetic composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained. Pharmaceutically acceptable or cosmetically acceptable carriers or excipients have in some embodiments met the required standards of toxicological and manufacturing testing and / or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.
[1408] “Pharmaceutically acceptable salts” or “cosmetically acceptable salts” are those salts which retain at least some of the biological activity of the free (non-salt) compound and which can be administered as drugs (or pharmaceuticals) or cosmetics to an individual. Such salts, for example, include: (1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or formed with organic acids such as acetic acid, oxalic acid, propionic acid, succinic acid, maleic acid, tartaric acid and the like; (2) salts formed when an acidic proton present in the parent compound either is replaced by a metal ion, e.g., an alkali metal ion, an alkaline earth ion, or an aluminum ion; or coordinates with an organic base. Acceptable organic bases include ethanolamine, diethanolamine, triethanolamine and the like. Acceptable inorganic bases include aluminum hydroxide, calcium hydroxide, potassium hydroxide, sodium carbonate, sodium hydroxide, and the like. Pharmaceutically acceptable salts or cosmetically acceptable salts can be prepared in situ in the manufacturing process, or by separately reacting a purified compound in its free acid or base form with a suitable organic or inorganic base or acid, respectively, and isolating the salt thus formed during subsequent purification.
[1409] The present disclosure intends to include all salts of compounds referred to herein, such as pharmaceutically acceptable salts or cosmetically acceptable salts. The present disclosure also includes any or all of the stereochemical forms, including any enantiomeric or diastereomeric forms, and any tautomers or other forms of the compounds described. Unless stereochemistry is explicitly indicated in a chemical structure or name, the structure or name is intended to embrace all possible stereoisomers of a compound depicted. In addition, where a specific stereochemical form is depicted, it is understood that other stereochemical forms are also described and embraced by the present disclosure. It is also understood that prodrugs, solvates and metabolites of the compounds are embraced by this disclosure. Compositions comprising a compound described herein are also intended, such as a composition of substantially pure compound, including a specific stereochemical form thereof. Compositions comprising a mixture of compounds described herein in any ratio are also embraced by the present disclosure, including mixtures of two or more stereochemical forms of a compound in any ratio, such that racemic, non-racemic, enantioenriched and scalemic mixtures of a compound are embraced.
[1410] The present disclosure also includes isotopically-labeled and / or isotopically-enriched forms of compounds described herein. The compounds herein may contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. In some embodiments, the compound is isotopically-labeled, where one or more atoms are replaced by an isotope of the same element. Exemplary isotopes that can be incorporated into compounds described herein include isotopes of hydrogen, carbon, nitrogen, oxygen, sulfur, fluorine, chlorine, such as 2H, 3H, 11C, 13C, 14C, 13N, 15N, 15O, 17O, 34S, 35S, 18F, 36Cl, 37Cl, or 32P. Incorporation of heavier isotopes such as deuterium (2H or D) can afford certain therapeutic advantages resulting from greater metabolic stability, for example, increased in vivo half-life, or reduced dosage requirements, and hence may be preferred in some instances. As used herein, each instance of enrichment, substitution, or replacement of an atom with corresponding isotope of that atom encompasses isotopic enrichment levels of one of about: 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100%, or a range between any two of the preceding percentages.
[1411] Isotopically-labeled compounds of the present disclosure can generally be prepared by standard methods and techniques known to those skilled in the art or by procedures similar to those described in the accompanying Examples substituting appropriate isotopically-labeled reagents in place of the corresponding non-labeled reagent.
[1412] Unless clearly indicated otherwise, “an individual” or “asubject” as used herein intends a mammal, including but not limited to a primate, human, bovine, horse, feline, canine, or rodent. In one variation, the individual is a human.
[1413] The term “effective amount” as used herein, refers to a sufficient amount of at least one agent being administered in vitro or in vivo to achieve a desired result, e.g., to introduce or transfect a nucleic acid into a target cell, or to deliver a nucleic acid to a target organ or tissue. In certain instances, the method is in vitro, and the desired result may comprise certain desired alteration of cells or biological processes. In certain instances, the method is in vivo, and the result may comprise a delivery or transfection of a nucleic acid into a target organ or tissue, a reduction and / or alleviation of the signs, symptoms, or causes of a disease. As is understood in the art, an effective amount may be in one or more doses, i.e., a single dose or multiple doses may be required to achieve the desired treatment endpoint. An effective amount may be considered in the context of administering one or more therapeutic agents (e.g., a compound, or pharmaceutically acceptable salt thereof) , and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable or beneficial result may be or is achieved. Suitable doses of any of the co-administered compounds may optionally be lowered due to the combined action (e.g., additive or synergistic effects) of the compounds.
[1414] As used herein, the terms “therapeutic agent” , and “therapeutic agents” refer to any agent (s) which can be used in the treatment, or prevention of a disorder, or one or more symptoms thereof. In certain embodiments, the term “therapeutic agent” includes a compound provided herein. In certain embodiments, a therapeutic agent is an agent which is known to be useful for, or has been, or is currently being used for the treatment, or prevention of a disorder, or one, or more symptoms thereof.
[1415] “Therapeutically effective amount” refers to an amount of a compound, or composition that, when administered to a subject for treating a condition, is sufficient to effect such treatment for the condition. A “therapeutically effective amount” can vary depending on, inter alia, the compound, the disease or disorder, and its severity, and the age, weight, etc., of the subject to be treated.
[1416] As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results including clinical and diagnostic results. In some embodiments, “treatment” or “treating” encompasses methods to obtain diagnostic results, such as detecting a biomarker or molecule, determining level and biodistribution of gene expression, measuring cell viability, imaging a tissue or cell, or diagnosing a disease or disorder. In some embodiments, “treatment” or “treating” encompasses methods to obtain therapeutically beneficial results, such as ameliorating the symptoms of a disease or disorder. Beneficial or desired clinical and diagnostic results include, but are not limited to, one or more of the following: detecting and diagnosing a disease or a disorder or underlying cause thereof, monitoring the development of a disease or a disorder, decreasing one more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease) , preventing or delaying the spread of the disease, delaying the occurrence or recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (whether partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, enhancing effect of another medication, delaying the progression of the disease, increasing the quality of life, and / or prolonging survival. The methods provided herein contemplate any one or more of these aspects of treatment.
[1417] The term “effective amount” as used herein, refers to a sufficient amount of at least one agent being administered in vitro or in vivo to achieve a desired result, e.g., to introduce or transfect a nucleic acid into a target cell, or to deliver a nucleic acid to a target organ or tissue. In certain instances, the method is in vitro, and the desired result may comprise certain desired alteration of cells or biological processes. In certain instances, the method is in vivo, and the result may comprise a delivery or transfection of a nucleic acid into a target organ or tissue, a reduction and / or alleviation of the signs, symptoms, or causes of a disease. As is understood in the art, an effective amount may be in one or more doses, i.e., a single dose or multiple doses may be required to achieve the desired treatment endpoint. An effective amount may be considered in the context of administering one or more therapeutic agents (e.g., a compound, or pharmaceutically acceptable salt thereof) , and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable or beneficial result may be or is achieved. Suitable doses of any of the co-administered compounds may optionally be lowered due to the combined action (e.g., additive or synergistic effects) of the compounds.
[1418] In certain instances, an “effective amount” is considered in the context of therapeutical and / or diagnostic uses and may be optionally referred to as “therapeutically or pharmaceutically effective amount” . A “therapeutically effective amount” refers to an amount of the compound or the composition comprising a compound or salt thereof as set forth herein sufficient to produce a desired alteration of a target organ or tissue, or a desired therapeutic outcome and / or required to provide a clinically significant decrease in a disease. An appropriate “effective” or “therapeutically effective” amount in any individual case is determined using any suitable technique, such as a dose escalation study. In various embodiments, an effective amount or a therapeutically effective amount of the compound may (i) introduce or transfect a nucleic acid into a target cell or target cells (e.g., lung cells, spleen cells, liver cells, skeletal muscle cells, brain cells, or any combination thereof) ; (ii) deliver or transfect a nucleic acid into a target organ or target organs (e.g., lung, liver, spleen, brain, or any combination thereof) ; (iii) deliver or transfect a nucleic acid into a target tissue or target tissues (e.g., lung tissue, spleen tissue, liver tissue, skeletal muscle tissue, brain tissue, or any combination thereof) ; or (iv) alter the biological process in a cell or cells (e.g., lung cells, spleen cells, liver cells, skeletal muscle cells, brain cells, or any combination thereof) after introduction or transfection of the nucleic acid.
[1419] It is understood that embodiments of the invention described herein include “consisting of” and / or “consisting essentially of” embodiments.
[1420] The present disclosure provides peptides that are capable of penetrating the stratum corneum, epidermis, dermis and / or penetrating viable skin model cells following administration. These peptides are referred to herein as “penetrating peptides” . In some embodiments, these penetrating peptides are capable of penetrating the cellular membranes of viable epidermal and dermal cells.
[1421] The present disclosure provides skin-penetrating peptide compounds which can be useful for delivering payloads. In some embodiments, the peptide compounds can be prepared as described herein and used for therapy. In some embodiments, the therapy is a treatment of androgenetic alopecia. In some embodiments, the peptide compounds can be used to reduce hair loss or promote hair growth. In some embodiments, the peptide compounds can be used for cosmetics. In some embodiments, the peptide compounds can be used for anti-aging. In some embodiments, the peptide compounds can be used for reducing wrinkles or melasma. In some embodiments, the peptide compounds can be used for inducing anesthesia. In some embodiments, the peptide compounds can be used for treating skin cancer such as basal cell carcinoma (BCC) .
[1422] The embodiments described herein include the recited compounds as well as pharmaceutically acceptable or cosmetically acceptable salts, hydrates, solvates, isomers, and / or mixtures thereof.
[1423] In some embodiments, the skin-penetrating peptide comprises 3 to 50 amino acids, 3 to 25 amino acids, 3 to 20 amino acids, or 3 to 15 amino acids. In some embodiments, the skin-penetrating peptide comprises 3 to 50 amino acids. In some embodiments, the peptide comprises 3 to 25 amino acids. In some embodiments, the peptide comprises 3 to 20 amino acids. In some embodiments, the peptide comprises 3 to 15 amino acids.
[1424] The term “N-terminal modification” as used herein, refers to a moiety capable of, covalently or otherwise, modifying the N-terminus of the aforementioned peptide. N-terminal modification is preferably selected from the group comprising acetylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification, glycosylation, fluorination, sulfonation; preferably, acetyl modification, fatty acid modification, and pyrenebutyrate modification.
[1425] In some embodiments, the N-terminal lipidation is a branched or unbranched C6-C22 alkyl, branched or unbranched C6-C22 alkenyl, or branched or unbranched C6-C22 alkynyl. In some embodiments, the N-terminal lipidation is a branched or unbranched C8-C22 alkyl, branched or unbranched C8-C22 alkenyl, or branched or unbranched C8-C22 alkynyl. In some embodiments, the N-terminal lipidation is a branched or unbranched C8-C22 alkyl. In some embodiments, the N-terminal lipidation is an unbranched C8-C22 alkyl.
[1426] In some preferable embodiments, R11 is selected from the group comprising: Ac (Acetyl) , C8, C10, C12, C14, C16 (Palm) , C18 (St) , C20, C22.
[1427] The term “Ac” as used herein refers to the acetyl group with the formula “-COCH3” . The term “C8” as used herein, refers to a linear saturated or unsaturated alkyl group having 8 carbon atoms, preferably saturated (with the formula “-C8H17” ) . The term “C10” as used herein refers to a linear saturated or unsaturated alkyl group having 10 carbon atoms, preferably saturated (with the formula “-C10H21” ) . The term “C12” as used herein refers to a linear saturated or unsaturated alkyl group having 12 carbon atoms, preferably saturated (with the formula “-C12H25” ) . The term “C14” as used herein refers to a linear saturated or unsaturated alkyl group having 14 carbon atoms, preferably saturated (with the formula “-C14H29” ) . The term “C16” or “Palm” as used herein refers to the palmityl group, a linear saturated or unsaturated alkyl group having 16 carbon atoms, preferably saturated (with the formula “-C16H33” , or the palmitoyl group derived from palmitic acid. The term “C18” or “St” as used herein refers to the stearyl group, a linear saturated or unsaturated alkyl group having 18 carbon atoms, preferably saturated (with the formula “-C18H37” , or the stearoyl group derived from stearic acid. The term “C20” as used herein refers to a linear saturated or unsaturated alkyl group having 20 carbon atoms, preferably saturated (with the formula “-C20H41” ) . The term “C22” as used herein refers to a linear saturated or unsaturated alkyl group having 22 carbon atoms, preferably saturated (with the formula “-C22H45” ) . In some embodiments, the N-terminal lipid is selected from the group consisting of stearyl, palmitoyl, and lauroyl. In some embodiments, the N-terminal lipid is stearyl. In some embodiments, the N-terminal lipid is palmitoyl. In some embodiments, the N-terminal lipid is lauroyl.
[1428] The term “C-terminal modification” as used herein, refers to a moiety capable of, covalently or otherwise, modifying the C-terminus of the aforementioned peptide. C-terminal modification is preferably selected from the group comprising amidation, alkylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification; preferably, NH2.
[1429] The term “targeting moiety” as used herein, refers to an amino acid sequence in the aforementioned peptide that directs the aforementioned peptide to a specific location in a specific cell. The targeting moiety is preferably selected from the group comprising transferrin, a Penetration Accelerating Sequence (PAS) , a Nuclear Localization Signal (NLS) sequence, an Endosomal Escape Enhancer, and a Heparin Sulfate Binding Peptides; and optionally, the targeting moiety is connected to the linker, preferably by Cys or Lys residue in the targeting moiety. Preferably, the transferrin can be a sequence of Lys-His-Ala-Ile-Tyr-Pro-Arg-His. Preferably, the PAS can be a sequence of Pro-Lys-Lys-Lys-Arg-Lys-Val-βAla-Lys-Phe-Phe-Leu-Ile-Pro-Lys-Gly. Preferably, the Endosomal Escape Enhancer can be selected from the group comprising WEAALAEALAEALAEHLAEALAEALEALAA (GALA) , GLFEAIEGFIENGWEGMIDGWY (INF7) , WEAKLAKALAKALAKHLAKALAKALKACEA (KALA) , GLFHAIAHFIHGGWHGLIHGWYG (H5WYG) , and GLFGAIAGFIENGWEGMIDGWYG (HA2-Derived Peptide) . Preferably, the Heparin Sulfate Binding Peptides can be selected from the group comprising LRSRTKIIRIR (HBPep) , SPKRKGGSRKYSPTSPTTSPTSKRKYSP (HS-20) , and KHKNKRKT (Platelet Factor 4) . Preferably, the NLS sequence can be selected from the group comprising Lys -Pro-Lys-Lys-Lys-Arg-Lys-Val (NLS1) , Lys-Pro-Lys-Leu-Lys-Arg-Gln (NLS2) , Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp (NLS3) , PKKKRKV, PKLKRQ, PAAKRVKLD, RPRK, RRARRPRG, GKRKLITSEEERSPAKRGRKS, KGKKGRTQKEKKAARARSKGKN, RKRCAAGVGGGPAGCPAPGSTPLKKPRR, RKPVTAQERQREREEKRRRRQERAKEREKRRQERER, RSGGNHRRNGRGGRGGYNRRNNGYHPY, TLLLRETMNNLGVSDHAVLSRKTPQPY, PGKMDKGEHRQERRDRPY, GKKKKGKPGKRREQRKKKRRT, SANKVTKNKSNSSPYLNKRKGKPGPDS, and VHSHKKKKIPTSPTFTTPKTLTLRRQPKYPRKSAPRRNKLDHY.
[1430] Linker
[1431] Types of Linkers
[1432] In some embodiments, the conjugate comprises a payload covalently bound to a peptide via a linker. In some embodiments, the linker comprises an alkyl, an amide, an ester, a disulfide, a sulfide, a ketal, a succinate, an oxime, a carbamate, an ether, an aryl, a heteroaryl, a cyclyl, or a heterocyclyl. In some embodiments, the linker comprises an alkyl, an amide, or an ester. In some embodiments, the linker comprises an alkyl. In some embodiments, the linker comprises an amide. In some embodiments, the linker comprises an ester. In some embodiments, the linker is a cleavable or non-cleavable linker. In some embodiments, the linker is a cleavable linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker comprises C1-C20 alkyl. In some embodiments, the linker comprises C2-C10 alkyl. In some embodiments, the linker comprises C2-C6 alkyl. In some embodiments, the linker is branched or linear. In some embodiments, the linker is branched. In some embodiments, the linker is linear. In some embodiments, the linker is a peptide-based linker. In some embodiments, the linker is not a peptide-based linker. In some embodiments, the linker covalently binds multiple payloads to one peptide. In some embodiments, the linker covalently binds two payloads to one peptide. In some embodiments, the linker covalently binds one payload to one peptide.
[1433] Linker Species
[1434] In some embodiments, the linker is selected from:
[1435] wherein t is an integer of from 1 to 10. In some embodiments, t is an integer of from 1 to 5.
[1436] Preferably, wherein are preferably for cysteine conjugation, and is preferably for lysine conjugation.
[1437] In some embodiments, t is an integer of from 1 to 3. In some embodiments, the linker is selected from In some embodiments, the linker is selected from where t is an integer from 1 to 3. In some embodiments, the linker is selected from where t is an integer from 1 to 3. In some embodiments, the linker is selected from where t is an integer from 1 to 3. In some embodiments, the linker is selected from the group consisting of In some embodiments, the linker is In some embodiments, the linker is In some embodiments, the linker is In some embodiments, the linker is In some embodiments, the linker is
[1438] Payload
[1439] In some embodiments, the payload can be selected from known antibacterial agents, antifungal agents, antiviral agents, antiproliferative agents, anti-cancer agent (e.g., for skin cancer such as basal cell carcinoma (BCC) ) , immunosuppressive agents, vitamins, analgesics, hormones, and the like.
[1440] In some embodiments, the payload is used for cosmetics. In some embodiments, the payload is used for anti-aging, skin hydration, skin protection, skin brightening, skin whitening, anti-cellulite, deodorants, anti-perspirants, nail care, or hair care. In some embodiments, the payload is used for anti-aging, skin protection, or skin brightening. In some embodiments, the payload is used for anti-aging. In some embodiments, the payload is used to reduce wrinkles or melasma. In some embodiments, the payload is used to reduce wrinkles. In some embodiments, the payload is used to reduce melasma. In some embodiments, the payload is selected from the group consisting of argireline, ceramide, tranexamic acid, resveratrol, nicotinamide mononucleotide, metformin, crocin, sappanone A, glutathione, glycolic acid, hyaluronic acid, astragaloside, pyrroloquinoline quinone, α-tocopheryl acetate, curcumin, sirolimus, spermidine, vitamin E, nicotinamide adenine dinucleotide, nicotinamide riboside, theanine, ursolic acid, ferulic acid, alpha lipoic acid, carnosine, nicotinamide, procyanidin, epigallocatechin gallate, fisetin, quercetin, sulforaphane, astaxanthin, nordihydroguaiaretic acid, retinol, hesperidin, astragaloside IV, bakuchiol, palmitoyl pentapeptide-4, and squalane. In some embodiments, the payload is selected from the group consisting of argireline, ceramide, tranexamic acid, retinol, vitamin E, and glutathione. In some embodiments, the payload is selected from the group consisting of argireline, ceramide, and tranexamic acid. In some embodiments, the payload is argireline. In some embodiments, the payload is ceramide. In some embodiments, the payload is tranexamic acid.
[1441] In some embodiments, the payload is used for inducing anesthesia. In some embodiments, the payload is selected from the group consisting of intravenous sedative hypnotics, adjuvant agents, local anesthetics, and paralytics. In some embodiments, the payload is selected from the group consisting of propofol, etomidate, ketamine, dexmedetomidine, lidocaine, benzocaine, midazolam, diazepam, alfentanil, sufentanil, remifentanil, fentanyl, hydromorphone, hydrocodone, oxycodone, succinylcholine, vecuronium, rocuronium, and cisatracurium. In some embodiments, the payload is selected from propofol, ketamine, diazepam, benzocaine, and lidocaine. In some embodiments, the payload is benzocaine. In some embodiments, the payload is lidocaine.
[1442] In some preferable embodiments, the payload is a therapeutic agent, and is preferably selected from an agent for the treatment of androgenetic alopecia, for the treatment of skin cancer such as basal cell carcinoma (BCC) , for anti-aging, and for anesthesia; and more preferably the payload is selected from the group comprising finasteride, minoxidil, dutasteride, argireline, ceramide, tranexamic acid, benzocaine, lidocaine, 5-fluorouracil (5-FU) , venetoclax, vismodegib, selumetinib, derazantinib, barasertib, alisertib, bemcentinib, and ralimetinib, including all the stereisomer of these compounds.
[1443] In some embodiments, the payload is used to treat androgenetic alopecia. In some embodiments, the payload is used to reduce hair loss or promote hair growth. In some embodiments, the payload is selected from finasteride, minoxidil, dutasteride, spironolactone, flutamide, bicalutamide, cyproterone acetate, ketaconazole, and prostaglandin F2 analogues. In some embodiments, the payload is selected from the group consisting of finasteride, minoxidil, dutasteride, spironolactone, flutamide, and ketaconazole. In some embodiments, the payload is selected from the group consisting of finasteride, minoxidil, and dutasteride. In some embodiments, the payload is finasteride. In some embodiments, the payload is minoxidil. In some embodiments, the payload is dutasteride.
[1444] In some embodiments, the payload is used for cosmetics. In some embodiments, the payload is used for hair care. In some embodiments, the payload is used to reduce hair loss or promote hair growth. In some embodiments, the payload is selected from finasteride, minoxidil, dutasteride, spironolactone, flutamide, bicalutamide, cyproterone acetate, ketaconazole, and prostaglandin F2 analogues. In some embodiments, the payload is selected from the group consisting of finasteride, minoxidil, dutasteride, spironolactone, flutamide, and ketaconazole. In some embodiments, the payload is selected from the group consisting of finasteride, minoxidil, and dutasteride. In some embodiments, the payload is finasteride. In some embodiments, the payload is minoxidil. In some embodiments, the payload is dutasteride.
[1445] In some preferable embodiments, the payload is a therapeutic agent, and is preferably an agent for the treatment of androgenetic alopecia; and more preferably the payload is selected from the group comprising finasteride, minoxidil, and dutasteride, including all the stereisomer of these compounds.
[1446] The exemplary chemical structures of finasteride, minoxidil, dutasteride, argireline, bioactive lipid (include ceramide) , tranexamic acid, benzocaine, lidocaine, 5-fluorouracil (5-FU) , venetoclax, vismodegib, selumetinib, derazantinib, barasertib, alisertib, bemcentinib and ralimetinib can be, for example, as follows:
[1447] Finasteride:
[1448] Minoxidil:
[1449] Dutasteride:
[1450] Argireline:
[1451] Tranexamic acid:
[1452] Benzocaine:
[1453] Lidocaine:
[1454] 5-Fluorouracil (5-FU) :
[1455] Venetoclax:
[1456] Vismodegib:
[1457] Selumetinib:
[1458] Derazantinib:
[1459] Barasertib:
[1460] Alisertib:
[1461] Bemcentinib:
[1462] Ralimetinib:
[1463] Peptide-drug conjugates (PDCs)
[1464] In some embodiments, the payload is 5-fluorouracil (5-FU) , Argireline, Benzocaine, Ceramide, Finasteride, Minoxidil, Tranexamic acid, and the conjugate is preferably selected from the PDCs in Table 2 and in the lists following.
[1465] Table 2. Peptide-drug conjugates (PDCs)
[1466] 5-FU PDCs
[1467] In some preferable embodiments, the payload is 5-FU and the PDC comprises any one of the following:
[1468] 5-FU PDCs –Linker 1
[1469] 5-FU PDCs –Linker 2
[1470] 5-FU PDCs –Linker 3
[1471] 5-FU PDCs –Linker 4
[1472] 5-FU PDCs -Linker 1 -2 Payload
[1473] Argireline -PDCs -Linker1 -I
[1474] Argireline -PDCs -Linker1 -II
[1475] Argireline -PDCs -Linker 1-2Peptide
[1476] Benzocaine-PDCs
[1477] In some preferable embodiments, the payload is benzocaine and the PDC comprises any one of the following:
[1478] Benzocaine-PDCs-Linker1
[1479] Benzocaine-PDCs-Linker2
[1480] Benzocaine-PDCs-Linker3
[1481] Ceramide Conjugates
[1482] In some preferable embodiments, the PDC can be further selected from bioactive lipid conjugate which comprises one or more any one kind of ceramide. The conjugates comprising ceramide as the bioactive lipid are referred to as “ceramide conjugates” .
[1483] In some embodiments, the PDC comprises any one of the following:
[1484] (1) 1, 2, 3 or more the same or different peptides selected from SEQ ID No. 1-688 and 1, 2, 3 or more ceramide NS,
[1485] (2) 1, 2, 3 or more the same or different peptides selected from SEQ ID No. 1-688 and 1, 2, 3 or more ceramide NP,
[1486] (3) 1, 2, 3 or more the same or different peptides selected from SEQ ID No. 1-688 and 1, 2, 3 or more ceramide EOP.
[1487] In some embodiments, the PDC are selected from any one of the following:
[1488] Group (1) Ceramide conjugates comprising ceramide NS and one peptide:
[1489] Group (2) Ceramide conjugates comprising ceramide NS and two peptides:
[1490] Group (3) Ceramide conjugates comprising ceramide NS and one peptide (via linker different from Group (1) ) :
[1491] Group (4) Ceramide conjugates comprising ceramide NS and two peptides (via linkers different from Group (2) ) :
[1492] Group (5) Ceramide conjugates comprising ceramide NS and one peptide (via linker different from Group (1) or (3) ) :
[1493] Group (6) Ceramide conjugates comprising ceramide NP and three peptides:
[1494] Group (7) Ceramide conjugates comprising ceramide EOP and three peptides:
[1495] Finasteride PDCs
[1496] In some preferable embodiments, the payload is finasteride and the PDC comprises any one of the following:
[1497] Finasteride PDCs -Linker 1
[1498] Finasteride PDCs -Linker 2
[1499] Finasteride PDCs -Linker 3
[1500] Finasteride PDCs -Linker 4
[1501] Finasteride PDCs -Linker 5
[1502] Finasteride PDCs -Linker 1 -2 payload
[1503] Minoxidil-PDCs
[1504] In some preferable embodiments, the payload is minoxidil and the PDC comprises any one of the following:
[1505] Minoxidil-PDCs-Linker1
[1506] Minoxidil-PDCs-Linker2
[1507] Minoxidil-PDCs-Linker1-2Peptide
[1508] Minoxidil-PDCs-Linker2-2Peptide
[1509] Tranexamic acid –PDCs
[1510] In some preferable embodiments, the payload is tranexamic acid and the PDC comprises any one of the following:
[1511] Tranexamic acid -PDCs -Linker1
[1512] Tranexamic acid -PDCs -Linker2
[1513] Tranexamic acid -PDCs -Linker3
[1514] Tranexamic acid -PDCs -Linker1-II
[1515] Tranexamic acid -PDCs -Linker1 -2Peptide
[1516] In some embodiments, the PDC of the present application can successfully release the payload resulting in about 30 to 100%release. In some embodiments, the PDC can successfully release the payload resulting in about 40 to 90%release. In some embodiments, the PDC can successfully release the payload resulting in about 50 to 80%release. In some embodiments, the PDC can successfully release the payload resulting in about 60 to 70%release. In some embodiments, the PDC can successfully release the payload resulting in about 30 to 90%release. In some embodiments, the PDC can successfully release the payload resulting in about 30 to 80%release. In some embodiments, the PDC can successfully release the payload resulting in about 30 to 70%release. In some embodiments, the PDC can successfully release the payload resulting in about 30 to 60%release. In some embodiments, the PDC can successfully release the payload resulting in about 50 to 100%release. In some embodiments, the PDC can successfully release the payload resulting in about 60 to 100%release. In some embodiments, the PDC can successfully release the payload resulting in about 70 to 100%release. In some embodiments, the PDC can successfully release the payload resulting in about 70 to 90%release. In some embodiments, the PDC can successfully release the payload resulting in about 100%release. In some embodiments, the PDC can successfully release the payload resulting in about 90%release. In some embodiments, the PDC can successfully release the payload resulting in about 80%release. In some embodiments, the PDC can successfully release the payload resulting in about 70%release.
[1517] In some embodiments, the PDC of the present application can successfully improve the solubility of the payload, resulting in an increase of solubility ranging from about 10%to 100 times higher. The increase in solubility may vary depending on the type of drug and protein, the method of conjugation, and experimental conditions. In some embodiments, the PDC of the present application can successfully improve the solubility of the payload by 30%to 80 times. In some embodiments, the PDC of the present application can successfully improve the solubility of the payload by 50%to 70 times. In some embodiments, the PDC of the present application can successfully improve the solubility of the payload by 70%to 60 times. In some embodiments, the PDC of the present application can successfully improve the solubility of the payload by 90%to 50 times. In some preferable embodiments, the PDC of the present application can successfully improve the solubility of the payload by 1 to 100 times. In some preferable embodiments, the PDC of the present application can successfully improve the solubility of the payload by 2 to 80 times. In some preferable embodiments, the PDC of the present application can successfully improve the solubility of the payload by 3 to 70 times. In some preferable embodiments, the PDC of the present application can successfully improve the solubility of the payload by 4 to 60 times. In some preferable embodiments, the PDC of the present application can successfully improve the solubility of the payload by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 time.
[1518] In some embodiments, the PDC of the present application has a half-life of less than 24 hours. In some embodiments, the PDC has a half-life of less than five hours. In some embodiments, the PDC has a half-life of less than three hours. In some embodiments, the PDC has a half-life of less than one hour. In some embodiments, the PDC has a half-life of between about 20 and 24 hours. In some embodiments, the PDC has a half-life of between about 20 and 22 hours. In some embodiments, the PDC has a half-life of about 20.42 hours. In some embodiments, the PDC has a half-life of between about two and five hours. In some embodiments, the PDC has a half-life of between about two and four hours. In some embodiments, the PDC has a half-life of about 2.54 hours. In some embodiments, the PDC has a half-life of between about zero and one hour. In some embodiments, the PDC has a half-life of between about 0 and 30 minutes. In some embodiments, the PDC has a half-life of between about 0 and 20 minutes. In some embodiments, the PDC has a half-life of between about 0 and 10 minutes. In some embodiments, the PDC has a half-life of between about zero and five minutes. In some embodiments, the PDC has a half-life of between about zero and one minute. In some embodiments, the PDC has a half-life of about 23.43 minutes. In some embodiments, the PDC has a half-life of about 22.75 minutes. In some embodiments, the PDC has a half-life of about 18.6 minutes. In some embodiments, the PDC has a half-life of about 17.83 minutes. In some embodiments, the PDC has a half-life of about 1.20 minutes. In some embodiments, the PDC has a half-life of about 0.99 minutes. In some embodiments, the PDC has a half-life of about 0.95 minutes.
[1519] In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into different skin layers, including stratum corneum, epidermis, and dermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into stratum corneum and epidermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into stratum corneum and dermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into epidermis, and dermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into stratum corneum, epidermis, and dermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into stratum corneum. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into epidermis. In some embodiments, the PDC of the present application can effectively deliver bioactive molecules and therapeutic compounds into dermis.
[1520] In some embodiments, the PDC of the present application can significantly reduce the circulatory exposure of the payloads, so as to prevent the payloads from being absorbed into systemic circulation and avoid their potential systemic adverse effects. In some preferable embodiments, the PDC of the present application can significantly avoid the circulatory exposure of the payloads. In some preferable embodiments, the payload in the PDC of the present application is undetectable in the systemic circulation.
[1521] In some embodiments of the PDC of the present application, one payload can be conjugated to one or more the same or different peptides via the linker. The PDC having one or more peptides of the present application can successfully improve the solubility of the payload, and can effectively deliver the payload into stratum corneum, epidermis, and dermis.
[1522] In some embodiments of the PDC of the present application, one or more the same or different payloads can be conjugated to one peptide via the linker. The PDC having one or more payloads of the present application can effectively deliver the payload into stratum corneum, epidermis, and dermis, and can effectively improve the efficacy of the payload.
[1523] Therapy
[1524] In one aspect, provided herein is a method of introducing a drug into a cell. In some embodiments, the method comprises contacting a cell with the peptide-drug conjugate described herein. In some embodiments, the method comprises contacting a biological membrane with a peptide-drug conjugate that contains a payload that is covalently attached to a peptide via a linker.
[1525] In some embodiments, the compounds, compositions and methods described herein can be used to enhance transport of selected payloads across any of a number of biological membranes including, but not limited to, eukaryotic cell membranes, prokaryotic cell membranes, and cell walls. In some embodiments, the prokaryotic cell membranes include bacterial membranes. In some embodiments, the eukaryotic cell membranes of interest include membranes of dendritic cells, epithelial cells, endothelial cells, keratinocytes, muscle cells, fungal cells, and plant cells.
[1526] For therapeutic applications, the compounds are administered to a mammal, in certain embodiments, a human, in a pharmaceutically acceptable dosage suitable for administration form such as those known in the art, and those discussed herein, intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, inhalation, or intratumoral routes. The compounds also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. In certain embodiments, the compounds are administered to a mammal, in certain embodiments, a human, in a pharmaceutically acceptable dosage suitable for oral administration form such as those known in the art, and those discussed herein, for example sublingually. For example, the compounds of this disclosure may be administered orally to a human as a liquid or solid form. Solid dosage forms include, for example, capsules, tablets, pills, powders, and granules. In such solid dosage forms, the chemical entity is mixed with one or more pharmaceutically acceptable excipients, such as sodium citrate or dicalcium phosphate and / or: a) fillers or extenders such as, for example, starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidinone, sucrose, and acacia, c) humectants such as, for example, glycerol, d) disintegrating agents such as, for example, agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as, for example, paraffin, f) absorption accelerators such as, for example, quaternary ammonium compounds, g) wetting agents such as, for example, acetyl alcohol and glycerol monostearate, h) absorbents such as, for example, kaolin and bentonite clay, and i) lubricants such as, for example, talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. In one embodiment, the oral dosage form is an oral disintegrating tablet.
[1527] The compounds provided herein may be useful for the treatment of any disease or disorder described herein. In certain embodiments, the disease or disorder is proliferative. In certain embodiments, the disease or disorder is cancer. In certain embodiments, the disease or disorder is brain cancer, liver cancer, ovarian cancer, gastric cancer, or colorectal cancer. In certain embodiments, the disease or disorder is brain cancer. In certain embodiments, the disease or disorder is liver cancer. In certain embodiments, the disease or disorder is ovarian cancer. In certain embodiments, the disease or disorder is gastric cancer. In certain embodiments, the disease or disorder is colorectal cancer. In certain embodiments, the disease or disorder is head and neck cancer, oral cancer, or maxillofacial cancer.
[1528] In certain embodiments, the disease is dermatological. In certain embodiments, the disease is selected from the group consisting of, acne scarring, actinic keratosis, age spots (liver spots) , atopic dermatitis (eczema) , autoimmune diseases, basal cell carcinoma, bullous pemphigoid, burning mouth syndrome, calciphylaxis, cancer, canker sore, chronic hives, connective tissue disorders, contact dermatitis, cutaneous lupus, cutaneous T-cell lymphoma, dermatitis, dermatomyositis, Ehlers-Danlos syndrome, epidermolysis bullosa, erythromelalgia, genetic skin disorders, graft-versus-host disease, granuloma annulare, graves'disease, hair diseases, hair loss, hemangioma, hidradenitis suppurativa, hypereosinophilic syndrome, hyperhidrosis, itchy skin (pruritus) , keloids, Klippel-Trenaunay syndrome, lichen planus, lip cancer, lymphoma, melanoma, merkel cell carcinoma, moles, morphea, mucous membrane diseases, nail diseases, nephrogenic systemic fibrosis, neurofibromatosis, nonmelanoma skin cancer, oral lichen planus, panniculitis, pemphigus, pigmentation disorders, polymorphous light eruption, primary biliary cholangitis, psoriasis, pyoderma gangrenosum, rosacea, scleroderma, skin cancer, skin infections, spider veins, squamous cell carcinoma of the skin, Stevens-Johnson syndrome, subcutaneous fat diseases, sun allergy, varicose veins, vascular anomalies, vasculitis, vitiligo, vulvar skin disorders, and wrinkles. In certain embodiments, the disease is hair loss. In certain embodiments, the hair loss is caused by androgenetic alopecia.
[1529] In certain embodiments, the compounds provided herein may be useful as cosmetics as described herein. In certain embodiments, the cosmetic is for anti-aging, skin hydration, skin protection, skin brightening, skin whitening, anti-cellulite, deodorants, anti-perspirants, nail care, or hair care. In some embodiments, the cosmetic is for anti-aging, skin hydration, or skin brightening. In some embodiments, the cosmetic is for anti-aging. In some embodiments, the cosmetic reduces wrinkles or melasma.
[1530] In certain embodiments, the compounds provided herein may be useful as anesthetics as described herein. In some embodiments, the anesthetic is a general or a local anesthetic. In some embodiments, the anesthetic is a general anesthetic. In some embodiments, the anesthetic is a local anesthetic.
[1531] Androgenetic Alopecia (AGA)
[1532] Androgenetic alopecia (AGA) is the most common form of hair loss, affecting both men and women. It is characterized by a progressive thinning of hair in specific patterns, often leading to significant hair loss. Increased DHT level is the key factor responsible for AGA. Finasteride and Minoxidil are commonly used for the treatment for AGA. Finasteride inhibits 5α-reductase type II, an enzyme responsible for converting testosterone to DHT, reducing DHT levels and slowing hair loss. Minoxidil (applied topically) promotes hair growth by stimulating hair follicles and increasing blood flow to the scalp. Finasteride is commonly administered orally and exhibits systemic side effects. The finasteride PDCs of the present application enhance skin penetration and apply directly to the scalp; minimize systemic absorption and reduce the risk of side effects.
[1533] Ceramide
[1534] Ceramide is a popular ingredient in cosmetic and skincare products due to their ability to improve skin health and appearance, by moisturization and hydration, repairing the skin barrier, providing anti-aging benefits and preventing sensitivity. However, poor solubility of ceramides make them difficult to formulate; and the poor solubility can also lead to low concentrations of ceramides in the product, limiting their effectiveness. Conjugating to hydrophilic peptide can enhance their solubility.
[1535] Tranexamic acid
[1536] Tranexamic acid is commonly used for the treatment of melasma, a common form of hyperpigmentation characterized by dark, irregular patches on the skin. Tranexamic acid helps to reduce the formation of melanin and treats other forms of hyperpigmentation: such as post-inflammatory hyperpigmentation (PIH) , which occurs after skin inflammation or injury. Tranexamic acid also helps reduce dark spots and even out skin tone. However, hydrophilic nature, molecular size, and low skin retention limit tranexamic acid to deeply penetrate the skin. Conjugating to skin penetrating peptide that can enhance the skin retention.
[1537] Basal cell carcinoma (BCC)
[1538] Basal Cell Carcinoma (BCC) is the most common skin cancer, typically caused by UV exposure. It arises from basal cells in the epidermis and includes superficial, nodular, and aggressive forms like infiltrative BCC. While rarely metastatic, BCC can cause significant local damage if untreated. 5-Fluorouracil (5-FU) is a topical chemotherapy effective for superficial BCC. It inhibits DNA synthesis in rapidly dividing cells, offering a non-invasive alternative to surgery. However, its utility is limited by poor skin penetration, making it ineffective for deeper or aggressive subtypes like nodular and infiltrative BCC. These forms often require surgical or systemic treatments due to their deeper invasion and higher recurrence risks with topical therapies. Advanced drug delivery methods may enhance 5-FU's efficacy in such cases.
[1539] Examples
[1540] The examples are merely intended to illustrate embodiments and are not to be construed to limit the scope herein.
[1541] Abbreviations used in the Examples include:
[1542] Example 1: General materials and methods
[1543] 1.1 Materials and Instruments
[1544] All reagents and solvents were purchased from commercial sources (Sigma-Aldrich, VWR, Fisher, TCI, Oakwood Chemicals, ChemScene) and used without purification unless otherwise noted. 1H NMR was recorded on Varian 400, 500, or 600 MHz spectrometers. LC-MS data were obtained on Agilent 1290 Infinity / Agilent 6100 Series Single Quad and Agilent 1260 Infinity / Agilent 6410 Triple Quadrupole. Peptides were synthesized using standard solid-phase peptide synthesis (SPPS) techniques. For peptides with a C-terminal carboxylic acid (-COOH) , 2-chlorotrityl chloride (2-CTC) resin was used. For peptides with a C-terminal carboxyl amide (-CONH2) , rink amide resin was employed. Fmoc (9-fluorenylmethyloxycarbonyl) chemistry was used for stepwise assembly of the peptide chains. After the synthesis of the sequence, the N-terminus was capped with either acetic acid or fatty acid. Following capping, the peptides were deprotected, cleaved from the resin, and purified. Peptides and lipid conjugates were purified using GX-281 Preparative HPLC System or Biotage Isolera One Flash Purification Chromatography System.
[1545] 1.2 Characterizations
[1546] NMR: 1H NMR was recorded on Varian 400, 500, or 600 MHz spectrometers. Chemical shifts are reported in delta (δ) units, expressed in parts per million (ppm) downfield from tetramethylsilane using protio-solvent (residual) as internal standard (CD3OD, δH = 3.31 ppm for 1H NMR, D2O, δH = 4.79 ppm for 1H NMR) . Data are reported as chemical shift (δ) , multiplicity (s= singlet, d = doublet, t = triplet, m = multiplet, br = broad) , and integration.
[1547] Example 2: General synthetic procedure for synthesis of Finasteride-PDCs
[1548] General Scheme 1.
[1549] Step 1: Synthesis of Intermediate 1.
[1550] A stirring solution of Finasteride (3 g, 8.053 mmol, 1.0 eq, CAS: 98319-26-7) and DIPEA (3.33 mL, 20.132 mmol, 2.5 eq) in dry THF (30 mL) was chilled on ice for 5 min under argon. To the above mixture was added a solution of 4-Nitrophenyl chloroformate (3.246 g, 16.105 mmol, 2.0 eq) in dry THF (20 mL) dropwise at 0 ℃ under argon. The reaction was allowed to warm to room temperature and stirred for 24 h. The solvent was then evaporated, and the residue was purified by silica gel flash column chromatography (0 to 100%EtOAc / PE) to afford Intermediate 1 (1.82 g, 3.385 mmol, 42%yield) as white solid. ESI-MS m / z = 538.58 [M+H] + .
[1551] Step 2: Synthesis of Intermediate 2.
[1552] To an oven dried three-necked flask under nitrogen at room temperature equipped with a stir bar was added 1, 2-di(pyridin-2-yl) disulfane (9.429 g, 42.8 mmol) in 40 mL methanol purged with nitrogen. To this mixture was added 2-mercaptoethanol dropwise (1 mL, 14.27 mmol) . The solution turned yellow and was allowed to stir for two hours. The solvent was then removed in vacuo and flash chromatography was performed using 20%ethyl acetate and methylene chloride. The product was a yellow oil (2.288 g, 12.21 mmol, 85.6%yield) and homogeneous (one spot) by TLC Rf = 0.47 (5%EtOAc, DCM) . 1H NMR (400 MHz, Chloroform-d) δ 8.50 (ddd, J = 4.9, 1.8, 0.9 Hz, 1H) , 7.62 –7.53 (m, 1H) , 7.39 (dt, J = 8.1, 1.1 Hz, 1H) , 7.14 (ddd, J = 7.4, 5.0, 1.1 Hz, 1H) , 5.74 (s, 1H) , 3.79 (s, 2H) , 3.02 –2.85 (m, 2H) . ESI-MS m / z = 188 [M+H] + .
[1553] Step 3: Synthesis of Intermediate 3.
[1554] A stirring solution of Intermediate 2 (784 mg, 4.185 mmol, 1.5 eq) and NaH (60 %dispersion in mineral oil 100 mg, 4.185 mmol, 1.5 eq) in dry THF (15 mL) was chilled on ice under Ar. To the above mixture was added a solution of Intermediate 1 (1.5 g, 2.79 mmol, 1.0 eq) in dry DMF (15 mL) at 0 ℃ under argon, and the solution turned yellow immediately. The yellow solution was stirred at 0 ℃ for 2 h. The solvent was then evaporated. The residue was purified with silica gel column chromatography with 33%EtOAc / PE to afford Intermediate 3 (518 mg, 0.88 mmol, 31.7 %yield) as a white powder. ESI-MS m / z = 586.66 [M+H] + .
[1555] Step 4: Synthesis of PDC-01 to PDC-10.
[1556] PDC-01: A solution of Peptide-1 (58 mg, 0.041 mmol, 1.0 eq) , Intermediate 3 (48 mg, 0.082 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-01 (36.2 mg) as a white powder. Found mass: 472.92.
[1557] PDC-02: A solution of Peptide-2 (61 mg, 0.078 mmol, 1.0 eq) , Intermediate 3 (91 mg, 0.155 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-02 (67 mg) as a white powder. Found mass: 632.07.
[1558] PDC-03: A solution of Peptide-3 (68 mg, 0.042 mmol, 1.0 eq) , Intermediate 3 (49 mg, 0.084 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-03 (47 mg) as a white powder. Found mass: 697.94.
[1559] PDC-04: A solution of Peptide-4 (66.5 mg, 0.041 mmol, 1.0 eq) , Intermediate 3 (48 mg, 0.082 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-04 (34.8 mg) as a white powder. Found mass: 698.26.
[1560] PDC-05: A solution of Peptide-5 (67.7 mg, 0.047 mmol, 1.0 eq) , Intermediate 3 (55 mg, 0.082 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-05 (29.5 mg) as a white powder. Found mass: 643.50.
[1561] PDC-06: A solution of Peptide-6 (69.2 mg, 0.068 mmol, 1.0 eq) , Intermediate 3 (80 mg, 0.137 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-06 (24.4 mg) as a white powder. Found mass: 744.27.
[1562] PDC-07: A solution of Peptide-7 (65.6 mg, 0.031 mmol, 1.0 eq) , Intermediate 3 (37 mg, 0.663 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-07 (74.3 mg) as a white powder. Found mass: 514.00.
[1563] PDC-08: A solution of Peptide-8 (65.9 mg, 0.034 mmol, 1.0 eq) , Intermediate 3 (40 mg, 0.069 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-08 (15.5 mg) as a white powder. Found mass: 600.18.
[1564] PDC-09: A solution of Peptide-9 (69.2 mg, 0.049 mmol, 1.0 eq) , Intermediate 3 (57 mg, 0.097 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-09 (54.8 mg) as a white powder. Found mass: 634.23.
[1565] PDC-10: A solution of Peptide-10 (62.6 mg, 0.026 mmol, 1.0 eq) , Intermediate 3 (30.6 mg, 0.052 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-10 (75 mg) as a white powder. Found mass: 719.08.
[1566] Example 3: General synthetic procedure for synthesis of Ceramide-PDCs [ [ (NJC-C3-0021-0025) ] ]
[1567] General Scheme 2-1.
[1568] General Scheme 2-2.
[1569] Step 1: Synthesis of Intermediate 4.
[1570] D-Sphingosine (1.0 g, 3.339 mmol, 1.0 eq) , DMAP (81.6 mg, 0.668 mmol, 0.2 eq) and NEt3 (463 μL, 3.339 mmol, 1.0 eq) was stirred at 0 ℃ in dry THF (30 mL) under argon. To this solution was added palmitoyl chloride (1.01 g, 3.673 mmol, 1.1 eq) in dry THF (10 mL) dropwise. The whole mixture was stirred under argon at room temperature for 18 h. After completion of the reaction, 30 mL water was added, the mixture was exacted with DCM (30 mL × 3) . Organic phase was dried with Na2SO4 and then removed in vacuo. Recrystallization of the resulting residue in DCM / Hexanes (1 / 2) to afford Intermediate 4 (1.75 g, 97.4%yield) as white solid, which was used without further purification. 1H NMR (400 MHz, Chloroform-d) δ 6.25 (d, J = 7.2 Hz, 1H) , 5.84 –5.71 (m, 1H) , 5.52 (dd, J = 15.4, 6.4 Hz, 1H) , 4.35 –4.24 (m, 1H) , 3.99 –3.85 (m, 2H) , 3.74 –3.64 (m, 1H) , 2.26 –2.17 (m, 2H) , 2.04 (q, J = 7.2 Hz, 2H) , 1.63 (d, J = 7.2 Hz, 2H) , 1.40 -1.23 (m, 46H) , 0.86 (t, J = 6.8 Hz, 6H) .
[1571] Step 2: Synthesis of Intermediate 5.
[1572] A round bottom flask was charged with Intermediate 2 (1.53 g, 8.17 mmol, 1.0 eq) , bis- (pentafluorophenyl) carbonate (PFC) (3.54 g, 8.99 mmol, 1.1 eq) , CsF (248 mg, 1.63 mmol, 0.2 eq. ) , and 50 mL of anhydrous tetrahydrofuran (THF) . The solution was allowed to stir for 16 hours. The solvent was removed in vacuo. The residue was re-dissolved in methylene chloride and, byproduct precipitated was removed. This byproduct should be pentafluorophenol. The filtrate was evaporated in vacuo, and the resulting residue was purified by silica gel column chromatography (20%EtOAc / Hexane) to afford Intermediate 5 (2.56 g, 78.8%yield) as yellow oil. ESI-MS m / z = 398 [M+H] + .
[1573] Step 3: Synthesis of Intermediate 6 and Intermediate 7.
[1574] Intermediate 4 (800 mg, 1.487 mmol, 1.0 eq) , Intermediate 5 (886.3 mg, 2.231 mmol, 1.5 eq) , DMAP (272.6 mg, 2.231 mmol, 1.5 eq) and Pyridine (176.5 mg, 2.231 mmol, 1.5 eq) were stirred in dry DMF (15 mL) under argon. The reaction mixture was stirred at room temperature for 18 h. 30 mL water was added, and the mixture was exacted with DCM (50mL x 3) . Organic phase was washed with brine (30mL × 3) , dried with Na2SO4 and then removed in vacuo. The resulting residue was purified by silica gel column chromatography (0 to 50%EtOAc / Hexane) to afford the mixture of Intermediate 6 and Intermediate 7 (950 mg, Intermediate 7: Intermediate 6≈2: 1) as white solid. The mixture of Intermediate 6 and Intermediate 7 was further purified by silica gel column chromatography (0 to 20%EtOAc / DCM) to afford Intermediate 6 (270 mg) as white solid and Intermediate 7 (550 mg) as a white solid.
[1575] Intermediate 6: 1H NMR (400 MHz, Chloroform-d) δ 8.48 -8.43 (m, 1H) , 7.69 -7.61 (m, 2H) , 7.13 -7.07 (m, 1H) , 5.91 (d, J = 7.6 Hz, 1H) , 5.78 -5.68 (m, 1H) , 5.52 -5.41 (m, 1H) , 4.45 -4.37 (m, 3H) , 4.26 -4.12 (m, 3H) , 3.06 (t, J = 6.4 Hz, 2H) , 2.20 -2.13 (m, 2H) , 2.05 -1.97 (m, 2H) , 1.65 -1.59 (m, 2H) , 1.37 -1.23 (m, 46H) , 0.86 (t, J = 6.4 Hz, 6H) . ESI-MS m / z = 751.84 [M+H] + .
[1576] Intermediate 7: 1H NMR (400 MHz, Chloroform-d) δ 8.46 (d, J = 6.0 Hz, 2H) , 7.67 -7.62 (m, 4H) , 7.11 -7.07 (m, 2H) , 5.92 (d, J = 9.2 Hz, 1H) , 5.89 -5.79 (m, 1H) , 5.45 -5.34 (m, 1H) , 5.10 (t, J = 7.2 Hz, 1H) , 4.42 -4.31 (m, 6H) , 4.19 -4.12 (m, 1H) , 3.08 -3.00 (m, 4H) , 2.18 -2.11 (m, 2H) , 2.05 -1.97 (m, 2H) , 1.58 -1.52 (m, 2H) , 1.35 -1.22 (m, 46H) , 0.88 -0.84 (m, 6H) . ESI-MS m / z = 964.91 [M+H] + .
[1577] Step 4: Synthesis of PDC-11 to PDC-14.
[1578] PDC-11 (Conjugate 01) : A solution of Peptide-1 (100 mg, 0.071 mmol, 1.0 eq) , Intermediate 6 (64 mg, 0.085 mmol, 1.2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-11 (152.9 mg) as a white powder. Found mass: 685.17.
[1579] PDC-12 (Conjugate 02) : A solution of Peptide-2 (30 mg, 0.038 mmol, 1.0 eq) , Intermediate 6 (34.3 mg, 0.046 mmol, 1.2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-12 (53.4 mg) as a white powder. Found mass: 714.76.
[1580] PDC-13 (Conjugate 03) : A solution of Peptide-1 (161 mg, 0.114 mmol, 2.2 eq) , Intermediate 7 (50 mg, 0.052 mmol, 1.0 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-13 (134.3 mg) as a white powder. Found mass: 595.59.
[1581] PDC-14 (Conjugate 04) : A solution of Peptide-2 (90 mg, 0.114 mmol, 2.2 eq) , Intermediate 7 (50 mg, 0.052 mmol, 1.0 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-14 (113 mg) as a white powder. Found mass: 773.28.
[1582] Example 4: General synthetic procedure of Tranexamic acid PDC-15 to PDC-24 [ [ (NJC-C3-0028-0037) ] ]
[1583] General Scheme 3.
[1584] Step 1: Synthesis of Intermediate 8.
[1585] To a solution of Boc-tranexamic acid (1.15 g, 4.45 mmol, 1.0 eq) and HCTU (2.21 g, 5.34 mmol, 1.2 eq) in 12 mL DMF was added DIPEA (742 μl, 2.4 eq) dropwise. A solution of Intermediate 2 (1 g, 5.34 mmol, 1.2 eq) in 6 mL DMF was added to the above solution dropwise at rt. The solution was allowed to stir overnight at room temperature. After the reaction was completed, the solution was diluted with brine and extracted with DCM (three times) . The organic extract was dried (Na2SO4) , filtered, and evaporated. The residue was purified by silica gel column chromatography with gradient of EtOAc (10-100%) in Hexane to afford Intermediate 8 (1.99 g) as a yellow oil. ESI-MS m / z = 427 [M+H] + .
[1586] Step 2: Synthesis of Intermediate 9.
[1587] A solution of Intermediate 8 (1.99 g) in 30%TFA / DCM (15 mL) was stirred at rt for 3 h. The solvent was then evaporated, and the residue was purified by silica gel flash column chromatography (0 to 10%MeOH / DCM) to afford Intermediate 9 (1.19 g, ) . 1H NMR (400 MHz, Chloroform-d) δ 8.45 (ddd, J = 4.9, 1.8, 1.0 Hz, 1H) , 7.69 –7.57 (m, 2H) , 7.10 (ddd, J = 7.1, 4.9, 1.4 Hz, 1H) , 4.30 (t, J = 6.3 Hz, 2H) , 3.01 (t, J = 6.3 Hz, 2H) , 2.71 (d, J = 43.4 Hz, 5H) , 2.24 –2.12 (m, 1H) , 1.99 (d, J = 13.2 Hz, 2H) , 1.85 (d, J = 12.8 Hz, 2H) , 1.38 (qd, J = 16.4, 14.7, 5.1 Hz, 2H) , 0.98 (dd, J = 14.3, 11.0 Hz, 2H) . ESI-MS m / z = 327.37 [M+H] + .
[1588] Step 3: Synthesis of PDC-15 to PDC-24
[1589] PDC-15: A solution of Peptide-1 (100 mg, 0.071 mmol, 1.0 eq) , Intermediate 9 (46 mg, 0.142 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-15 (47.7 mg) as a white powder. Found mass: 543.59.
[1590] PDC-16: A solution of Peptide-2 (100 mg, 0.127 mmol, 1.0 eq) , Intermediate 9 (83 mg, 0.254 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-16 (54.5 mg) as a white powder. Found mass: 335.30.
[1591] PDC-17: A solution of Peptide-3 (100 mg, 0.062 mmol, 1.0 eq) , Intermediate 9 (40 mg, 0.124 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-17 (100.7 mg) as a white powder. Found mass: 611.49.
[1592] PDC-18: A solution of Peptide-4 (100 mg, 0.062 mmol, 1.0 eq) , Intermediate 9 (40 mg, 0.124 mmol, 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-18 (79.1 mg) as a white powder. Found mass: 611.83.
[1593] PDC-19: A solution of Peptide-5 (100 mg, 0.069 mmol , 1.0 eq) , Intermediate 9 (45 mg, 0.138 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-19 (41.7 mg) as a white powder. Found mass: 557.04.
[1594] PDC-20: A solution of Peptide-6 (100 mg, 0.099 mmol , 1.0 eq) , Intermediate 9 (64.5 mg, 0.198 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-20 (106.6 mg) as a white powder. Found mass: 614.70.
[1595] PDC-21: A solution of Peptide-7 (100 mg, 0.048 mmol , 1.0 eq) , Intermediate 9 (31 mg, 0.096 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-21 (49.4 mg) as a white powder. Found mass: 577.31.
[1596] PDC-22: A solution of Peptide-8 (100 mg, 0.052 mmol , 1.0 eq) , Intermediate 9 (34 mg, 0.104 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-22 (66.8 mg) as a white powder. Found mass: 535.22.
[1597] PDC-23: A solution of Peptide-9 (100 mg, 0.07 mmol , 1.0 eq) , Intermediate 9 (45.8 mg, 0.14 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-23 (100.9 mg) as a white powder. Found mass: 547.65.
[1598] PDC-24: A solution of Peptide-10 (100 mg, 0.042 mmol , 1.0 eq) , Intermediate 9 (27 mg, 0.083 mmol , 2 eq) and dry DMF (2 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-24 (62.8 mg) as a white powder. Found mass: 654.14.
[1599] Example 5: General synthetic procedure of Tranexamic acid PDC-25 to PDC-34 [ [ (NJC-C3-0040-0049) ] ]
[1600] General Scheme 4.
[1601] Step 1: Synthesis of Intermediate 10.
[1602] To an oven dried three-necked flask under nitrogen at room temperature equipped with a stir bar was added 1, 2-di(pyridin-2-yl) disulfane (4.781 g, 21.70 mmol) in 30 mL methanol purged with nitrogen. To this mixture was added 3-mercaptopropan-1-ol dropwise (0.937 mL, 10.85mmol) . The solution turned yellow and was allowed to stir for two hours. The solvent was then removed in vacuo and flash chromatography was performed using 20%ethyl acetate and methylene chloride. The product was a yellow oil (2.01 g, 9.985 mmol, 92%yield) and homogeneous (one spot) by TLC Rf = 0.47 (5%EtOAc, DCM) . 1H NMR (400 MHz, Chloroform-d) δ 8.46 (d, J = 4.6 Hz, 1H) , 7.63 (d, J = 4.3 Hz, 2H) , 7.10 (q, J = 4.4 Hz, 1H) , 3.80 (q, J = 5.0 Hz, 2H) , 2.97 (dt, J = 9.9, 4.3 Hz, 2H) , 2.34 (q, J = 4.8 Hz, 1H) , 2.07 –1.79 (m, 2H) . ESI-MS m / z = 202 [M+H] + .
[1603] Step 2: Synthesis of Intermediate 11.
[1604] To a solution of Boc-tranexamic acid (1.5 g, 5.829 mmol, 1.0 eq) and HCTU (2.894 g, 6.995 mmol, 1.2 eq) in 15 mL DMF was added DIPEA (2.437 mL, 2.4 eq) dropwise. A solution of Intermediate 10 (1.408 g, 6.995 mmol, 1.2 eq) in 8 mL DMF was added to the above solution dropwise at rt. The solution was allowed to stir overnight at room temperature. After the reaction was completed, the solution was diluted with brine and extracted with DCM (three times) . The organic extract was dried (Na2SO4) , filtered, and evaporated. The residue was purified by silica gel column chromatography with gradient of EtOAc (10-100%) in Hexane to afford Intermediate 11 (1.54 g) as a yellow oil. ESI-MS m / z = 441 [M+H] + .
[1605] Step 3: Synthesis of Intermediate 12.
[1606] A solution of Intermediate 11 (1.54 g) in 30%TFA / DCM (20 mL) was stirred at rt for 3 h. The solvent was then evaporated, and the residue was purified by silica gel flash column chromatography (0 to 10%MeOH / DCM) to afford Intermediate 12 (1.3 g) . 1H NMR (400 MHz, DMSO-d6) δ 8.42 (dd, J = 5.2, 1.9 Hz, 1H) , 7.82 –7.77 (m, 1H) , 7.72 (d, J = 8.0 Hz, 1H) , 7.21 (dd, J = 7.2, 4.8 Hz, 1H) , 4.05 (t, J = 6.2 Hz, 2H) , 2.84 (t, J = 7.2 Hz, 2H) , 2.60 (q, J = 6.0 Hz, 2H) , 2.17 (tt, J = 12.1, 3.6 Hz, 1H) , 1.91 (q, J = 6.7 Hz, 2H) , 1.87 –1.79 (m, 2H) , 1.71 (dd, J = 13.3, 3.6 Hz, 2H) , 1.43 (dqd, J = 11.4, 7.3, 3.5 Hz, 1H) , 1.20 (qd, J = 13.1, 3.4 Hz, 2H) , 0.90 (qd, J = 13.0, 3.5 Hz, 2H) . ESI-MS m / z = 341.35 [M+H] + .
[1607] Step 4: Synthesis of PDC-25 to PDC-34.
[1608] PDC-25: A solution of Peptide-1 (50 mg, 0.035 mmol, 1.0 eq) , Intermediate 12 (24 mg, 0.071 mmol, 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-25 (48.5 mg) as a white powder. Found mass: 411.53.
[1609] PDC-26: A solution of Peptide-2 (50 mg, 0.064 mmol, 1.0 eq) , Intermediate 12 (43 mg, 0.127 mmol, 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-26 (43.5 mg) as a white powder. Found mass: 509.32.
[1610] PDC-27: A solution of Peptide-3 (50 mg, 0.031 mmol , 1.0 eq) , Intermediate 12 (21 mg, 0.062 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-27 (46.4 mg) as a white powder. Found mass: 616.17.
[1611] PDC-28: A solution of Peptide-4 (50 mg, 0.031 mmol , 1.0 eq) , Intermediate 12 (21 mg, 0.62 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-28 (48.2 mg) as a white powder. Found mass: 616.48.
[1612] PDC-29: A solution of Peptide-5 (50 mg, 0.034 mmol , 1.0 eq) , Intermediate 12 (23 mg, 0.069 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-29 (54.9 mg) as a white powder. Found mass: 561.73.
[1613] PDC-30: A solution of Peptide-6 (50 mg, 0.049 mmol , 1.0 eq) , Intermediate 12 (34 mg, 0.099 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-30 (54 mg) as a white powder. Found mass: 621.63.
[1614] PDC-31: A solution of Peptide-7 (50 mg, 0.024 mmol , 1.0 eq) , Intermediate 12 (16 mg, 0.048 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-31 (24.6 mg) as a white powder. Found mass: 464.93.
[1615] PDC-32: A solution of Peptide-8 (50 mg, 0.026 mmol , 1.0 eq) , Intermediate 12 (17.7 mg, 0.052 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-32 (44.1 mg) as a white powder. Found mass: 538.73.
[1616] PDC-33: A solution of Peptide-9 (50 mg, 0.035 mmol , 1.0 eq) , Intermediate 12 (24 mg, 0.07 mmol , 2 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-33 (29.8 mg) as a white powder. Found mass: 414.51.
[1617] PDC-34: A solution of Peptide-10 (25 mg, 0.01 mmol , 1.0 eq) , Intermediate 12 (7 mg, 0.021 mmol , 2 eq) and dry DMF (1 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-34 (19.3 mg) as a white powder. Found mass: 534.61.
[1618] Example 6: General synthetic procedure of Tranexamic acid PDC-35 to PDC-44 [ [ (NJC-C3-0052-0061) ] ]
[1619] General Scheme 5.
[1620] Step 1: Synthesis of Intermediate 13
[1621] To an oven dried three-necked flask under argon at room temperature equipped with a stir bar was added 1, 2-di (pyridin-2-yl) disulfane (7.47 g, 33.96 mmol) in 40 mL methanol purged with argon. To this mixture was added 4-mercaptobutan-1-ol dropwise (2.3 mL, 22.64 mmol) . The solution turned yellow and was allowed to stir for two hours. The solvent was then removed in vacuo, and the resulting residue was purified by silica gel column chromatography (20%EtOAc / petroleum ether) to afford Intermediate 13 (3.6 g, 73.9%yield) as a yellow oil.
[1622] 1H NMR (400 MHz, Chloroform-d) δ 8.47 –8.42 (m, 1H) , 7.72 –7.67 (m, 1H) , 7.66 –7.61 (m, 1H) , 7.11 –7.04 (m, 1H) , 3.64 (t, J = 6.4 Hz, 2H) , 2.82 (t, J = 7.2 Hz, 2H) , 1.84 –1.73 (m, 2H) , 1.69 –1.64 (m, 2H) .
[1623] Step 2: Synthesis of Intermediate 14
[1624] To a solution of Boc-tranexamic acid (2.58 g, 10.05 mmol, 1.2 eq) and HCTU (4.156 g, 10.05 mmol, 1.2 eq) in 30 mL DMF was added DIPEA (2.596 g, 20.1 mmol, 2.4 eq) dropwise. A solution of Intermediate 13 (1.8 g, 8.37 mmol, 1.0 eq) in 15 mL DMF was added to the above solution dropwise at rt. The solution was allowed to stir overnight at room temperature. After the reaction was completed, the solution was diluted with brine and extracted with DCM (three times) . The organic extract was dried (Na2SO4) , filtered, and evaporated. The residue was purified by silica gel column chromatography (20%EtOAc / petroleum ether) to afford Intermediate 14 (3.5 g, 92 %yield) as a yellow oil. ESI-MS m / z = 456 [M+H] + .
[1625] Step 3: Synthesis of Intermediate 15
[1626] A solution of Intermediate 14 (3.5 g, 7.69 mmol) in 30%TFA / DCM (40 mL) was stirred at rt for 3h. Solvent was removed under vacuum, and the residue was purified bysilica gel column chromatography (10%MeOH / DCM) to afford Intermediate 15 (2.7 g, 99%yield) as a yellow oil. ESI-MS m / z = 355.43 [M+H] + .
[1627] 1H NMR (400 MHz, Chloroform-d) δ 8.47 –8.40 (m, 1H) , 7.82 (s, 2H) , 7.72 (d, J = 8.0 Hz, 1H) , 7.66 (t, J = 8.6 Hz, 1H) , 7.13 –7.06 (m, 1H) , 4.02 (t, J = 5.8 Hz, 2H) , 2.83 -2.72 (m, 4H) , 2.17 (t, J = 12.0 Hz, 1H) , 1.95 (d, J = 9.6 Hz, 2H) , 1.85 (d, J = 14.0 Hz, 2H) , 1.79 –1.67 (m, 4H) , 1.61 (s, 1H) , 1.42 –1.28 (m, 2H) , 1.04 -0.89 (m, 2H) .
[1628] Step 4: Synthesis of PDC-35 to PDC-44.
[1629] PDC-35: A solution of Peptide-1 (50 mg, 0.035 mmol, 1.0 eq) , Intermediate 15 (25.2 mg, 0.071 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-35 (74.1 mg) as a white powder. Found mass: 415.05.
[1630] PDC-36: A solution of Peptide-2 (50 mg, 0.064 mmol, 1.0 eq) , Intermediate 15 (45 mg, 0.127 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-36 (65.3 mg) as a white powder. Found mass: 516.36.
[1631] PDC-37: A solution of Peptide-3 (50 mg, 0.031 mmol, 1.0 eq) , Intermediate 15 (22 mg, 0.062 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-37 (30.2 mg) as a white powder. Found mass: 620.86.
[1632] PDC-38: A solution of Peptide-4 (50 mg, 0.031 mmol, 1.0 eq) , Intermediate 15 (22 mg, 0.062 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-38 (57.7 mg) as a white powder. Found mass: 621.15.
[1633] PDC-39: A solution of Peptide-5 (50 mg, 0.034 mmol, 1.0 eq) , Intermediate 15 (24.5 mg, 0.069 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-39 (41.9 mg) as a white powder. Found mass: 566.37.
[1634] PDC-40: A solution of Peptide-6 (50 mg, 0.049 mmol, 1.0 eq) , Intermediate 15 (35.1 mg, 0.099 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-40 (40.3 mg) as a white powder. Found mass: 628.57.
[1635] PDC-41: A solution of Peptide-7 (50 mg, 0.024 mmol, 1.0 eq) , Intermediate 15 (17 mg, 0.048 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-41 (52.1 mg) as a white powder. Found mass: 467.72.
[1636] PDC-42: A solution of Peptide-8 (50 mg, 0.026 mmol, 1.0 eq) , Intermediate 15 (18.5 mg, 0.052 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-42 (54.5 mg) as a white powder. Found mass: 434.01.
[1637] PDC-43: A solution of Peptide-9 (50 mg, 0.035 mmol, 1.0 eq) , Intermediate 15 (24.9 mg, 0.070 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-43 (64.8 mg) as a white powder. Found mass: 577.01.
[1638] PDC-44: A solution of Peptide-10 (50 mg, 0.021 mmol, 1.0 eq) , Intermediate 15 (14.9 mg, 0.042 mmol, 2.0 eq) and dry DMF (1.5 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-44 (40.5 mg) as a white solid. Found mass: 537.40.
[1639] Example 7: General synthetic procedure of Benzocaine-PDCs
[1640] General Scheme 6-1.
[1641] Step 1: Synthesis of Compound 3.
[1642] A round bottom flask was charged with 1 (1 g, 6.05 mmol, 1.0 eq) , 2 bis- (pentafluorophenyl) carbonate (PFC) (2.863 g, 7.26 mmol, 1.2 eq) , CsF (365 mg, 2.4 mmol, 0.4 eq. ) , and 50 mL of anhydrous tetrahydrofuran (THF) . The solution was allowed to stir for 16 hours at 60 ℃. The solvent was removed in vacuo. The resulting residue was dissolved in methylene chloride, leading to the precipitation of a byproduct. The mixture was filtered, and the filtrate was extracted with brine, water and dried with Na2SO4. The solvent was evaporated in vacuo. The resulting residue was recrystallized in hot DCM (20 mL) to afford 3 (880 mg, 39%yield) as white crystalline solid.
[1643] Step 2: Synthesis of Compound 5.
[1644] A round bottom flask was charged with 3 (1000 mg, 2.66 mmol, 1.0 eq) , 4 (548 mg, 2.93 mmol, 1.1 eq) , CsF (81 mg, 0.53 mmol, 0.2 eq. ) , and 20 mL of anhydrous tetrahydrofuran (THF) . The solution was allowed to stir for 48 hours at rt.The solvent was removed in vacuo. The resulting residue was dissolved in methylene chloride, leading to the precipitation of a byproduct. The filtrate was extracted with brine, water and dried with Na2SO4. The solvent was evaporated in vacuo. The residue was recrystallized in a mixture of DCM and Hexanes to afford compound 5 (710 m g, 71%yield) as a white solid.
[1645] Step 3: Synthesis of PDC-45 and PDC-46.
[1646] A solution of Peptide-1 (310 mg, 0.25 mmol, 1.0 eq) , 5 (84 mg, 0.22 mmol, 1.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford 6 (27 mg, 50%yield) as a white powder. Found mass: 1178.8; 786.2; 590.0.
[1647] A solution of Peptide-2 (80 mg, 0.068 mmol, 1.0 eq) , 5 (51.5 mg, 0.136 mmol, 2.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford 7 (64 mg, 65%yield) as a white powder. Found mass: 1054.4; 527.8.
[1648] General Scheme 6-2.
[1649] Step 1: Synthesis of compound 8
[1650] To a solution of 6 (1000 mg, 2.52 mmol, 1.0 eq) in THF (50 ml. ) was added 7 (900 mg, 3.76 mmol, 1.5 eq) and CsF (115 mg, 0.756 mmol, 0.3 eq) . The solution was stirred at 60 ℃ overnight. The solution was stirred at 60 ℃ for another 6 h. The solvent was removed in vacuo. The resulting residue was dissolved in methylene chloride, leading to the precipitation of a byproduct. The filtrate was extracted with sodium bicarbonate, brine, water and was dried with Na2SO4. The solvent was evaporated in vacuo to afford the intermediate. To the above intermediate in MeOH (5 mL) was added 1 mL HCl (1M) dropwise. The mixture was stirred at rt for 1h. The solution was diluted with NaHCO3 solution and extracted with DCM. The organic extract was dried (Na2SO4) , filtered, and evaporated. The residue was purified by silica gel column chromatography with gradient of EtOAc (10-100 percent) in Hexane to afford compound 8 (410 mg, 48 %yield over two step) as colorless oil.
[1651] Step 2: Synthesis of compound 9
[1652] A round bottom flask was charged with 8 (245 mg, 0.65 mmol, 1.1 eq) , 9 (200 mg, 0.59 mmol, 1.0 eq) , CsF (18 mg, 0.118 mmol, 0.2 eq. ) , and 5 mL of anhydrous tetrahydrofuran (THF) . The solution was allowed to stir for 16 hours at rt.The solvent was removed in vacuo. The resulting residue was dissolved in methylene chloride, leading to the precipitation of a byproduct. The filtrate was extracted with brine, water and dried with Na2SO4. The solvent was evaporated in vacuo. The residue was purified by column chromatography on silica gel with gradient of Ethyl Acetate (10-30%) in Hexanes to afford the compound 9 (180 m g, 58%yield) as a white solid.
[1653] Step 3: Synthesis of PDC-47.
[1654] A solution of Peptide-1 (150 mg, 0.069 mmol, 1.0 eq) , 9 (73 mg, 0.137 mmol, 2.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-47 (110 mg, 88%yield) as a white powder. Found MS: 915.2; 610.6; 458.2.
[1655] Example 8: General synthetic procedure of Minoxidil-PDCs
[1656] General Scheme 7-1.
[1657] Step 1: Synthesis of compound 3.
[1658] A round bottom flask was charged with 1 (500 mg, 2.39 mmol, 1.0 eq) , 2 (1044 mg, 2.62 mmol, 1.1 eq) , CsF (109 mg, 0.72 mmol, 0.3 eq. ) , and 5 mL of anhydrous DMF. The solution was allowed to stir for 2 hours at 60 ℃. The solvent was removed in vacuo. The resulting residue was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford compound 3 (320 m g, 32 %yield) .
[1659] Step 2: Synthesis of PDC-48 and PDC-49.
[1660] A solution of Peptide-1 (93 mg, 0.0426 mmol, 1.0 eq) , 3 (36 mg, 0.0852 mmol, 1.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-48 (89 mg, 81 %yield) as a white powder. Found mass: 862.2; 575.2; 431.6.
[1661] A solution of Peptide-2 (22.6 mg, 0.01 mmol, 1.0 eq) , 3 (8.7 mg, 0.021 mmol, 2.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-49 (15 mg, 57 %yield) as a white powder. Found mass: 861.2; 574.6; 431.2.
[1662] Step 3: Synthesis of PDC-50.
[1663] General Scheme 7-2.
[1664] A solution of Peptide-1 (60 mg, 0.027 mmol, 1.0 eq) , 4a (45 mg, 0.11 mmol, 4.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-50 (42 mg, 59 %yield) as a white powder. Found mass: 861.2; 574.6; 431.2.
[1665] Step 4: Synthesis of PDC-51.
[1666] General Scheme 7-3.
[1667] A solution of Peptide-1 (22.6 mg, 0.01 mmol, 1.0 eq) , 4b (8.7 mg, 0.021 mmol, 2.0 eq) and dry DMF (2.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-51 (15 mg, 57 %yield) as a white powder. Found mass: 861.2; 574.6; 431.2.
[1668] Example 9: General synthetic procedure of Argireline-PDCs
[1669] General Scheme 8-1.
[1670] A solution of Peptide-1 (48 mg, 0.022 mmol, 2.0 eq) , 1 (13 mg, 0.011 mmol, 1.0 eq) and dry DMF (1.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-52 (13 mg, 38%yield) as a white powder. Found mass: 1180.0; 787.0; 590.6; 472.6.
[1671] General Scheme 8-2.
[1672] A solution of Peptide-1 (105 mg, 0.048 mmol, 2.0 eq) , 2 (30 mg, 0.024 mmol, 1.0 eq) and dry DMF (1.0 mL) was allowed to stir under argon for 24 h. The DMF solution was directly loaded onto a reverse phase column and purified by using (10 -100%) acetonitrile / water gradient (with 0.1%TFA added) . Appropriate fractions were lyophilized to afford PDC-53 (35 mg, 62%yield) as a white powder. Found mass: 1180.0; 787.0; 590.6; 472.6.
[1673] Example 10: CCK-8 cell viability assay with HaCaT cells
[1674] HaCaT cells were counted. After cell counting, the cells were seeded at a density of 5000 cells per well in a 96-well cell culture plate. The plates were incubated overnight at 37℃ in a 5%CO2 incubator. Cells were treated with various concentrations of peptide at 0, 5, 2.5, 1.25, 0.625, and 0.3125 μM for 72h. After incubation, the culture medium was removed. An aliquot of 90 μL of serum-free DMEM was added to each well. An aliquot of 10 μL of CCK-8 detection reagent was added to each well and mixed thoroughly by vertexing. The mixture was incubated for 1 hour. The absorbance (OD value) at 450 / 650 nm was measured using a multifunctional microplate reader. Cell viability after treatment with peptide is shown in Table 3.
[1675] Table 3. CCK-8 cell viability
[1676] Example 11: Cell uptake assay with HaCaT cells
[1677] HaCaT cells were seeded in a 96-well plate at 25,000 cells per well and incubated at 37℃ with 5%CO2 for 24 hours. Cells were treated with various concentrations of the fluorescently labelled peptide at 0, 5, 2.5, 1.25, 0.625, and 0.3125 μM for 1h and 6h. After the treatment, Hoechst 33342 (10 μg / mL, 50 μL) was added for 10 minutes of nuclear staining. Images were captured under high-content objective lens for analysis. Images of Peptide-3 after 1 hour and 6 hours are shown in FIG. 7. Analogous experiments were performed for Peptides 4-28 (images not shown) . Average cell fluorescence intensity per well and the percentage of positive cells were analyzed using CellScoring software under the 10x objective lens. Intracellular uptake after treatment with transporter peptide is shown in Table 4.
[1678] Table 4. Intracellular uptake
[1679] *NT indicates not tested.
[1680] Example 12: Release kinetics
[1681] The release rate and amount of payload from PDCs in the presence of dithiothreitol (DTT) were quantified using LC-MS.For the release study, PDC (50 μM) was mixed with DTT (5 mM) in PBS and incubated at 37℃. Aliquots were taken at set time intervals for LC-MS analysis, and the concentration of released payload was determined using the standard curve. Release kinetics were plotted over time and are shown in FIGS. 8-18 and Table 5. PDC-01 and PDC-02 could successfully release finasteride in the reducing environment, resulting in about 70%and 90%release (FIGS. 8-9) . Different linkers resulted in varying release kinetics, with PDC-47 exhibiting the fastest release, having a t1 / 2 of 0.95 min, while PDC-45 and PDC-46 showed slower release rates with t1 / 2 values of 17.83 min and 18.6 min, respectively (FIGS. 10-12) . Both carbamate and carboxylic amide linkers could successfully facilitate the release of Minoxidil in a reducing environment. The carbamate linkage exhibited significantly faster release kinetics compared to the carboxylic acid linkage, with half-lives (t1 / 2) for PDC-48, PDC-49, PDC-50, and PDC-51, being 0.99 min, 1.20 min, 20.42 h, and 2.54 h, respectively (FIGS. 13-16) . The conjugation site influences release kinetics, as evidenced by the significantly shorter t1 / 2 of PDC-50 compared to PDC-51. Finally, different conjugation sites resulted in similar release kinetics, with t1 / 2 values of 23.43 min for PDC-52 and 22.75 min for PDC-53 (FIGS. 17-18) . Additionally, both conjugates release nearly 100%of argireline.
[1682] Table 5. Kinetics of peptide-drug conjugates
[1683] Example 13: Stability study of Finasteride PDCs
[1684] Stability studies for Finasteride PDCs were performed in PBS at 37 ℃. To evaluate conjugate stability, a 50 μM working solution was prepared by diluting 50 μL of a 1 mM stock solution with 950 μL PBS in a 1.5 mL centrifuge tube. The solution was incubated at 37℃ with shaking. At 0 minutes, 1 hour, 2 hours, and 6 hours, aliquots were collected for analysis. Conjugate peak areas were analyzed by LC-MS. The same procedure was applied to other conjugates, and the LC-MS peak areas were compared across the four time points.
[1685] Finasteride PDC-02 and Finasteride PDC-09 are more stable conjugates among all 10 conjugates tested (FIG. 19) , Finasteride PDC-01 to Finasteride PDC-10:
[1686] Specifically, a 50 μM working solution was prepared by diluting 50 μL of a 1 mM stock solution with 950 μL PBS in a 1.5 mL centrifuge tube, adjust the pH to 5.0 and 7.4, respectively. The solution was incubated at 37℃ with shaking. At predetermined time points, aliquots were collected for analysis. Conjugate peak areas were analyzed by LC-MS. The same procedure was applied to other conjugates, and the LC-MS peak areas were compared across the four time points. Finasteride PDC-02 and Finasteride PDC-09 are more stable conjugates at pH 5.0. Finasteride PDC-09 is more stable than Finasteride PDC-02 at pH 7.4 (FIG. 20) .
[1687] Example 14: Payload releasing study of Finasteride PDCs
[1688] Specifically, prepare a 1 mM stock solution of PLFNS by dissolving it in 100%methanol, then create a standard curve by diluting the stock to six concentrations, and analyze using LC-MS / MS. Similarly, prepare a 1 mM conjugate stock solution in methanol and a 10 mM GSH working solution in PBS (pH 7.4) . For the conjugate-GSH reaction, mix 50 μL of conjugate stock with 450 μL PBS and 500 μL GSH solution in a centrifuge tube. Incubate at 37℃ and 500 rpm, sampling at specific time points. Analyze the samples using LC-MS / MS, recording any dilution steps and methods. In the presence of for 5 mM GSH, Finasteride PDC-02 and Finasteride PDC-09 gradually release finasteride, and the release ratios of Finasteride PDC-02 and Finasteride PDC-09 are 42%and 64%, respectively (FIG. 21) .
[1689] Example 15: Skin penetration study of Finasteride PDCs
[1690] Skin penetration study was conducted in 10-minute skin penetration study using Franzen diffusion cell and porcine skin. Specifically, add 500 μL of 100 μM finasteride and conjugate working solutions to the administration chamber, seal with parafilm, and cover with aluminum foil to protect from light. After a 10-minute skin incubation, collect receptor chamber samples and remaining test solution from the administration chamber, recording its volume. Rinse the administration chamber twice with 500 μL PBS, collecting and combining the rinses. For analysis, mix 500 μL of the administration chamber rinse and recovered solution with 500 μL of 10 mM GSH solution, incubate for 2 hours, and determine finasteride content using LC-MS. Similarly, mix 200 μL of the working solution with 200 μL of 10 mM GSH, incubate for 2 hours, and analyze using LC-MS. Receptor chamber samples are not analyzed at this stage. Calculate finasteride content in the administration chamber, the working solution, and standard curve results.
[1691] Finasteride PDC-02 and Finasteride PDC-09 achieved 25.67%and 26.99%penetration, respectively. Finasteride showed no detectable skin penetration. Therefore, conjugates showed higher skin penetration (FIG 22 and FIG 23) .
[1692] Example 16: Enzymatic inhibition towards 5α reductase of Finasteride PDCs
[1693] Specifically, ten male SD rats were fasted for 12 hours with access to water before euthanasia. The ventral prostate and epididymis were excised, weighed, minced on ice, and homogenized in pre-cooled buffer (1: 3, g / mL) . The homogenate was centrifuged at 1500g for 10 minutes at 4℃, and the supernatant was further centrifuged at 105,000g for 1 hour at 4℃.The resulting pellet was resuspended in 1 mL of buffer and stored at -80℃. A 200 μL enzymatic reaction system was prepared to determine the concentration at which the positive control achieves a about 50%inhibition rate, which was used as a reference for comparing test substance inhibition rates. The positive control and the conjugates were tested at the same molar concentration. At the end of the enzymatic reaction, the reaction was terminated by adding 200 μL of pre-cooled acetonitrile containing 10 ng / mL rivaroxaban as an internal standard. After vortex mixing, the samples were centrifuged at 3220g for 10 minutes at 4℃. A 40 μL aliquot of the supernatant was mixed with 160 μL of pure water and analyzed by UPLC-MS / MS.
[1694] Finasteride PDC-09 achieved comparable inhibition efficacy as finasteride. Finasteride PDC-09 exhibited higher inhibition efficacy than Finasteride PDC-02 (FIG 24) .
[1695] Example 17: Solubility tests for Ceramide PDCs (Conjugate 01-04)
[1696] Ceramide PDCs were developed, and the following 4 Ceramide PDCs were tested:
[1697] Specifically, ceramide and conjugates were prepared at a 7%w / v concentration in water. The solutions were sonicated for 30 seconds and then allowed to stand at room temperature to assess their solubility.
[1698] Developed conjugates that are soluble in water at 7%w / v concentration, while ceramide at the same concentration was not soluble in water (FIG. 25) .
[1699] Example 18: Payload releasing study of Ceramide PDCs (Conjugate 01-04)
[1700] Specifically, to prepare for the experiment, dissolve the small molecule PLCM in 100%methanol to create a 1 mM stock solution. Dilute this stock to a maximum concentration of 50 μM (to be optimized) and prepare 6–8 concentration points to establish a standard curve using LC-MS / MS. For the conjugate stock solution, dissolve it in PBS to prepare a 1 mM solution. Prepare a 10 mM GSH working solution by dissolving GSH powder in PBS (pH 7.4) . For the conjugate working solution, mix 50 μL of the conjugate stock with 450 μL of PBS, then add 500 μL of the GSH solution. Vortex briefly and incubate the mixture at 37℃ with shaking at 500 rpm, released ceramide concentration was quantified via LC-MS / MS at predetermined time points.
[1701] Ceramide PDC-11 and Ceramide PDC-13 are able to release payload in PBS (FIG. 26) . Similarly, Ceramide PDC-12 and Ceramide PDC-14 should also be able to release payload ceramide.
[1702] Example 19: Skin penetration study of Ceramide PDCs (Conjugate 01-04)
[1703] Skin penetration study (IR spectroscopic quantification of conjugates skin penetration and distribution) was conducted for Ceramide PDCs. Specifically, porcine ear skin, due to its histological similarities to human skin, was used as a model for studying dermal absorption. Infrared spectroscopy, using the Hyperion 3000 infrared imaging system, was employed to collect spectral signals from a 510 × 1020 μm area. Multivariate linear regression was used to establish a model for determining the relative concentration of the target compound at each point, visualized as a heatmap to show its skin penetration distribution. Following penetration testing, skin samples were cryosectioned using a Leica CM 1950 cryostat and embedded in OCT. Transdermal penetration was assessed using the TK-12D system, where porcine skin samples were exposed to PBS (pH 7.4) at 32 ± 0.5℃, with 300 rpm stirring for 6 hours. Data were processed using OPUS and MATLAB software.
[1704] Ceramide PDC-13 and Ceramide PDC-14 showed higher skin penetration than Ceramide PDC-11 and Ceramide PDC-12.Ceramide PDC-13 showed the highest amount in stratum corneum, which matches with desired product profile (FIG. 27) .
[1705] Example 20: Effects of Finasteride conjugates on testosterone induced cytotoxicity and DHT production in human dermal papilla cells (DPC cells)
[1706] Seed DPC cells at a density of 2 × 104 cells per well into a 96-well plate and allow them to attach for 48 hours before adding the treatment sample. After discarding the old medium, treat the cells with testosterone at different concentrations (10 μM or 40μM) and finasteride or finasteride PDC-09 at different concentrations (75 nM, 37.5nM, 18.75 nM or 9.375nM) as active pharmaceutical ingredient (API) , and incubate them at 37℃ with 5%CO2 for 48 hours. Check cell confluency under a microscope. Carefully aspirate the culture medium from each well, then add 90 μL of fresh serum-free medium to each well, followed by 10 μL of CCK-8 reagent. Measure the optical density at 450 nm using 650 nm as the reference wavelength.
[1707] After treated with testosterone, DPC cells’ viability recovery was comparable under finasteride treatment and finasteride PDC-09 (FIG. 28) .
[1708] Example 21: Plasma exposure of Finasteride conjugates in mini pigs
[1709] The formulations were applied topically to a 7 cm × 7 cm area on the back of mini pigs using a 1 mL syringe, with 0.5 mL of the test (finasteride PDC-09, referred to as group 1) or reference formulation (Caretopic, Fynzur, 2.275 mg / ml, referred to as group 2) . Each group includes two mini pigs. The application area was divided into nine equal sections, and approximately 0.056 mL of formulation was applied to each section. The site was shaved and cleaned at least three days prior to administration, using warm water or soap if necessary, and lightly cleaned before application. The reference formulation had a concentration of 2.275 mg / mL, and the test formulation was prepared at twice the molar concentration of the active ingredient relative to the reference formulation. Blood samples (0.5 mL) were collected into EDTA-2K tubes at 0 h, 0.25 h, 0.5 h, 1 h, 2 h, 3 h, 4 h, 6 h, 8 h and 24 h after transdermal administration, stored on crushed ice, and centrifuged at 1800g for 10 minutes at 4℃ within 1 hour. Plasma was then collected and stored at -80℃ within 0.5 hours. The drug concentration in the plasma was analyzed by LC-MS.
[1710] The plasma concentration and pharmacokinetic (PK) parameters at designated time points is shown in Table 6. Finasteride PDC-09 removes blood exposure of finasteride compared to Caretopic.
[1711] Table 6. Plasma concentration and PK parameters
[1712] BLQ: Below Limit of Quantitation
[1713] BQL: Below Quantitation Limit
[1714] NA: Not Available
[1715] #DIV / 0! : Results from any attempt to divide by zero
[1716] The lower limit of quantification is 0.01 ng / mL for finasteride, and is 0.025 ng / ml for finasteride PDC-09.
[1717] Example 22: Skin pharmacokinetics of Finasteride conjugates on mini pigs
[1718] The formulations were applied topically to a 7 cm × 7 cm area on the back of mini pigs using a 1 mL syringe, with 0.5 mL of the test (Finasteride PDC-09) or reference formulation (Caretopic, Fynzur, 2.275 mg / ml) . The application area was divided into nine equal sections, and approximately 0.056 mL of formulation was applied to each section. The site was shaved and cleaned at least three days prior to administration, using warm water or soap if necessary, and lightly cleaned before application. The reference formulation had a concentration of 2.275 mg / mL, and the test formulation (Finasteride PDC-09) was prepared at the same molar concentration of the active ingredient as the reference formulation. After the animals have reached the specified time points post-administration topically (0.5h, 1h, 6h, 24h) , they are euthanized for skin sample collection. At each time point, three mini pigs are euthanized in the test group and the reference group respectively. The entire skin from each application site (7cm x 7cm) is collected. Before collection, any residual formulation is cleaned using absorbent paper, followed by wiping the application site five times with a gauze pad soaked in saline and then three times with a gauze pad soaked in 75%alcohol. After cleaning the site, hair is shaved, and the skin is layered using a skin punch, first collecting the epidermis (0.1mm) . The top 0.1mm is discarded, and then the dermis layers of 0.3mm and 0.45mm thickness are collected. Three skin samples (epidermis, dermis 0.3mm, dermis 0.45mm) are taken from each application area to measure the drug concentration by LC-MS.
[1719] More finasteride from Caretopic in the epidermis than that of finasteride PDC-09, meaning most finasteride PDC-09 will be delivered and released in dermis. Intact PDC was found in dermis, as well as finasteride, meaning the PDC releases finasteride in dermis (FIG. 29) .
[1720] Example 23: Real-time in vivo permeation testing of Finasteride conjugates
[1721] Conduct real-time in vivo permeation testing of the traceable substances in the samples by means of Raman spectroscopy. By tracking the characteristic peaks of the test samples applied to in vivo human skin, use Raman imaging diagrams to determine the permeation of traceable active substances in the test samples. Refer to T / SHRH 064-2024 <Transdermal penetration evaluation of cosmetic ingredients by Raman spectroscopy in vivo> for the detailed experimental procedure. All subjects were informed of the study protocol and provided written informed consent prior to participation. Upon arrival, each subject was instructed to cleanse the designated test site using purified water. After cleansing, the subject remained seated in a temperature-and humidity-controlled environment for 30 minutes to allow for physiological equilibration of the skin.
[1722] The test sample (2.0 ± 0.2 mg) was uniformly applied to a defined 1 × 1 cm2 area on the volar forearm. Raman spectroscopic analysis was then performed on these areas to evaluate the dermal permeation profile of the sample. Measurements were taken at predetermined time points, 0, 1, 2, 4, 6, 8, 10, 12 hours post-application. Within each test area, five measurement points were randomly selected, and each point was measured in triplicate to ensure data reliability and reproducibility.
[1723] The acquired Raman spectra were analyzed to assess the spatial distribution and relative skin permeability of the test sample over time.
[1724] Raman spectral imaging data processing includes spectral processing and data analysis. The spectral processing includes cosmic ray removal, spectral smoothing, background noise elimination, baseline calibration and spectral normalization. Univariate data analysis mainly focuses on biochemical substances corresponding to a specific peak position. Raman spectrum data analysis shows the distribution of the substances in human skin.
[1725] For data analysis, the Labspec software was used to perform baseline calibration of Raman spectra and confirmation of characteristic peak positions. The processed Raman spectra data were calculated, including peak intensity, peak displacement, peak area and half-peak width, etc. At the same time, Labspec software was used to analyze the corresponding peak intensity at different depths and plot its spatial distribution.
[1726] The penetration behavior of the product was determined by utilizing its characteristic Raman signals that are distinct from the intrinsic signals of the skin to confirm its distribution in different skin depth space.
[1727] Sample preparation:
[1728] Sample 1: Weighed 8.0 mg of finasteride into a vial, added 270 μL of 1, 2-hexanediol, and sonicated to dissolve. Then, 2930 μL of PBS (pH 5.0) was added, followed by sonication at 100 Hz for 10 min to obtain a white, semi-transparent solution. The resulting mixture was diluted with PBS (pH 5.0) to achieve a final finasteride concentration of 0.114% (w / v) .
[1729] Sample 2: Finasteride PDC-09 was weighed and diluted with a 20 mM sodium acetate solution (pH 4.6) to a total mass of 2 g. A Finasteride PDC-09 solution was thereby obtained at the same molar concentration as Sample 1.
[1730] Table 7. Penetrating ability of Samples 1-2
[1731] As shown in Table 7, Figure 30, and Figure 31, the results indicate that Finasteride conjugated with peptide (Finasteride PDC-09) exhibits superior skin penetration compared to free Finasteride, demonstrating higher relative permeability and deeper maximum penetration depths.
[1732] Example 24: Human skin-occlusive patch test
[1733] Test Method: Safety and Technical Standards for Cosmetics (Version 2015) , Chapter VII: Human skin patch test Sample: Finasteride PDC-09 was weighed and diluted with a 20 mM sodium acetate solution (pH 4.6) to obtain a test solution at the same molar concentration as the reference formulation (Caretopic, Fynzur, 2.275 mg / mL) .
[1734] Negative control: Blank
[1735] Procedure:
[1736] A qualified patch test chamber with a surface area not exceeding 50 mm2 and a depth of approximately 1 mm was selected. The test substance was applied to the chamber at a dose of approximately 0.020–0.025 g (for solids or semi-solids) or 0.020–0.025 mL (for liquids) . The patch chambers containing the test substance and the negative control were affixed to the volar side of the subject’s forearm. After 24 hours, the chambers were removed. Skin reactions were evaluated at 30 minutes (after pressure marks had faded) , 24 hours, and 48 hours following patch removal, based on the criteria in Table 8. All observations were documented accordingly.
[1737] A total of 33 subjects were enrolled in this study, and all 33 completed the trial. Using a systematic sampling method, the first 30 subjects were selected for statistical analysis (subjects No. 31, 32, and 33 were excluded accordingly) . The final valid dataset included 30 subjects-7 males and 23 females-aged between 32 and 60 years.
[1738] Table 8. Subjects age analysis
[1739] Table 9. Skin reaction grading criteria for skin occlusive patch test
[1740] Table 10. Results of skin occlusive patch test
[1741] Results: The results showed that all 30 subjects exhibited a skin reaction score of 0 at 0.5, 24, and 48 hours after removal of the patch test chamber, with no adverse skin reactions observed.
[1742] Example 25: Real-time in vivo permeation testing of Ceramide PDCs (Conjugate 01-04)
[1743] Conduct real-time in vivo permeation testing of the traceable substances in the samples by means of Raman spectroscopy. By tracking the characteristic peaks of the test samples applied to in vivo human skin, use Raman imaging diagrams to determine the permeation of traceable active substances in the test samples. Refer to T / SHRH 064-2024 <Transdermal penetration evaluation of cosmetic ingredients by Raman spectroscopy in vivo> for the detailed experimental procedure. All subjects were informed of the study protocol and provided written informed consent prior to participation. Upon arrival, each subject was instructed to cleanse the designated test site using purified water. After cleansing, the subject remained seated in a temperature-and humidity-controlled environment for 30 minutes to allow for physiological equilibration of the skin.
[1744] The test sample (2.0 ± 0.2 mg) was uniformly applied to a defined 1 × 1 cm2 area on the volar forearm. Raman spectroscopic analysis was then performed on these areas to evaluate the dermal permeation profile of the sample. Measurements were taken at predetermined time points, 0, 1, 2, 4, 6, 8, 10, 12 hours post-application. Within each test area, five measurement points were randomly selected, and each point was measured in triplicate to ensure data reliability and reproducibility.
[1745] The acquired Raman spectra were analyzed to assess the spatial distribution and relative skin permeability of the test sample over time.
[1746] Raman spectral imaging data processing includes spectral processing and data analysis. The spectral processing includes cosmic ray removal, spectral smoothing, background noise elimination, baseline calibration and spectral normalization. Univariate data analysis mainly focuses on biochemical substances corresponding to a specific peak position. Raman spectrum data analysis shows the distribution of the substances in human skin.
[1747] For data analysis, the Labspec software was used to perform baseline calibration of Raman spectra and confirmation of characteristic peak positions. The processed Raman spectra data were calculated, including peak intensity, peak displacement, peak area and half-peak width, etc. At the same time, Labspec software was used to analyze the corresponding peak intensity at different depths and plot its spatial distribution.
[1748] The penetration behavior of the product was determined by utilizing its characteristic Raman signals that are distinct from the intrinsic signals of the skin to confirm its distribution in different skin depth space.
[1749] Sample preparation:
[1750] Sample 3: Weigh 15 mg of Ceramide NS into a vial. Add 45 μL of cetearyl glucoside / cetearyl alcohol, 90 μL of caprylic / capric triglyceride, and 1365 μL of water. Vortex thoroughly, then sonicate at 100 Hz for 5 minutes to obtain a uniform, semi-translucent dispersion. Dilute the resulting mixture with PBS (pH 5.0) to achieve a final Ceramide NS concentration of 0.3%.
[1751] Sample 4: Dissolve 50 mg of Conjugate-03 in 1620 μL of PBS (pH 5.0) . Sonicate at 100 Hz for 5 minutes until a clear solution forms. This yields a 3%Conjugate-03 solution, in which the Ceramide NS moiety accounts for approximately 0.3%by weight.
[1752] Sample 5: Dissolve 30 mg of Conjugate-04 in 1667 μL of PBS (pH 5.0) . Sonicate at 100 Hz for 5 minutes until a clear solution forms. This yields a 1.8%Conjugate-04 solution, in which the Ceramide NS moiety accounts for approximately 0.3%by weight.
[1753] Raman spectra were acquired at designated time points to assess the spatial distribution of the test compounds within skin layers. Data analysis was performed to quantify both the relative permeability and maximum penetration depth of the test compounds.
[1754] In Sample 3, the analyte was Ceramide NS. In Samples 4 and 5, both the Ceramide-peptide conjugate (Conjugate-03 or Conjugate-04) and the released Ceramide NS were analyzed separately.
[1755] Table 11. Penetrating ability of Samples 3-4
[1756] As shown in Table 11, Figure 32, and Figure 33, the results indicate that Ceramide NS conjugated with peptide (Conjugate-03) exhibits superior skin penetration compared to free Ceramide NS, with both the conjugate and the released Ceramide NS demonstrating higher relative permeability and deeper maximum penetration depths.
[1757] Table 12. Penetrating ability of Sample 3 and Sample 5
[1758] As shown in Table 12, Figure 32, and Figure 34, the results indicate that Ceramide NS conjugated with peptide (Conjugate-04) exhibits superior skin penetration compared to free Ceramide NS, with both the conjugate and the released Ceramide NS demonstrating higher relative permeability and deeper maximum penetration depths.
[1759] *****
[1760] The examples set forth above are provided to give those of ordinary skill in the art with a complete disclosure and description of how to make and use the claimed embodiments, and are not intended to limit the scope of what is disclosed herein. Modifications that are obvious to persons of skill in the art are intended to be within the scope of the following claims. All publications, patents, and patent applications cited in this specification are incorporated herein by reference as if each such publication, patent or patent application were specifically and individually indicated to be incorporated herein by reference.
Claims
A conjugate or a pharmaceutically acceptable salt or cosmetically acceptable salt thereof, wherein the conjugate comprises a peptide and a payload, with the peptide covalently binding to the payload via a linker, wherein the peptide has the following structure of Formula I:R11-W1-X-PP-W2-R12 (Formula I)wherein:R11 is an N-terminal modification;R12 is absent or a C-terminal modification;each of W1 and W2 is independently selected from a direct bond or a linking moiety;X is absent or a targeting moiety;wherein one or more of W1, W2 and X are connected to the linker;PP is selected from:(1) oligo-arginine or oligo-arginine-analog, or(2) oligo-arginine or oligo-arginine-analog, which is implanted with at least one spacer;wherein the oligo-arginine is an oligomer of arginine, wherein the arginine can be L or D form; and the oligo-arginine-analog is an oligomer of an arginine analog containing guanidyl;wherein one payload can bind to one or more the same or different peptides via the linker, or one or more the same or different payloads can bind to one peptide via the linker.The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to claim 1, wherein the linker is a cleavable linker or a non-cleavable linker, preferably a cleavable linker, more preferably a linker that can be induced for cleavage and traceless release by reduction, and is preferably selected from the group comprisingwherein t is an integer of from 1 to 5, preferably 1 to 3;preferably, the linker iswherein t is 1, and U is O;and more preferably, one bioactive lipid can bind to 1, 2, 3 or more the same or different peptides via the linker, or 1, 2, 3 or more the same or different bioactive lipids can bind to one peptide via the linker; and preferably, one bioactive lipid binds to one peptide by the linker.The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to claim 1 or 2, wherein the payload is a therapeutic agent, preferably selected from an agent for the treatment of androgenetic alopecia, for anti-aging, and for anesthesia; and more preferably the payload is selected from the group comprising finasteride, minoxidil, dutasteride, spironolactone, argireline, tranexamic acid, benzocaine, lidocaine, 5-fluorouracil (5-FU) , venetoclax, vismodegib, selumetinib, derazantinib, barasertib, alisertib, bemcentinib, ralimetinib, and bioactive lipid; preferably, the payload is a bioactive lipid; preferably, the bioactive lipid is selected from the group comprising a steroid or its ester, a fatty acid or t its ester, a phospholipid or its ester, a compound represented by Formula A and mixtures thereof,in which:R1 denotes:a hydrogen atom orin which, R6 denotes:a hydrogen atom, or either a saturated or unsaturated and linear or branched C1-C50, preferably C5-C50, hydrocarbon radical, it being possible for this radical to be substituted by one or more hydroxyl groups optionally esterified by an acid R7COOH, R7 being an optionally mono-or polyhydroxylated, saturated or unsaturated and linear or branched C1-C35 hydrocarbon radical, it being possible for the hydroxyl or hydroxyls of the R7 radical to be esterified by an optionally mono-or polyhydroxylated, saturated or unsaturated and linear or branched C1-C35 fatty acid;or an R8- (NR9-CO) -R10 radical, in which R9 denotes a hydrogen atom or a mono-or polyhydroxylated, preferably monohydroxylated, C1-C20 hydrocarbon radical, R8 and R10 are hydrocarbon radicals, the sum of the carbon atoms of which is between 9 and 30, R10 being a divalent radical;or an R13-O-CO- (CH2) p radical, in which R13 denotes a C1-C20 hydrocarbon radical and p is an integer varying from 1 to 12;R2 denotes:a hydrogen atom, a radical of saccharide type, in particular a (glycosyl) n, (galactosyl) m or sulphogalactosyl radical, a sulphate or phosphate residue, a phosphorylethylamine radical and a phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8;R3 denotes:a hydrogen atom or a hydroxylated or nonhydroxylated and saturated or unsaturated C1-C33 hydrocarbon radical, it being possible for the hydroxyl or hydroxyls to be esterified by an inorganic acid or an acid R7COOH, R7 having the same meanings as hereinabove, and it being possible for the hydroxyl or hydroxyls to be etherified by a (glycosyl) n, (galactosyl) m, phosphate, sulphogalactosyl, phosphorylethylamine or phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8; it also being possible for R3 to be substituted by one or more C1-C14 alkyl radicals;R4 denotes:a hydrogen atom, a methyl or ethyl radical, an optionally hydroxylated, saturated or unsaturated and linear or branched C3-C50 hydrocarbon radical or a -CH2-CHOH-CH2-O-R14 radical, in which R14 denotes a C10-C26 hydrocarbon radical, or an R13-O-CO- (CH2) p radical, R13 having the same meanings as hereinabove;R5 denotes:a hydrogen atom or an optionally mono-or polyhydroxylated, saturated or unsaturated and linear or branched C1-C30 hydrocarbon radical, it being possible for the hydroxyl or hydroxyls to be etherified by a (glycosyl) n, (galactosyl) m, sulphogalactosyl, phosphorylethylamine or phosphorylethylammonium radical, in which n is an integer varying from 1 to 4 and m is an integer varying from 1 to 8;preferably, R5 denotes: a hydrocarbon group having 9 to 17 carbon atoms, such as nonanyl, decanyl, undecanyl, dodecanyl, tridecanyl, tetradecanyl, pentadecanyl, hexadecanyl, and heptadecanyl;with the proviso that, when R3 and R5 denote hydrogen or when R3 denotes hydrogen and R5 denotes methyl, then R4 does not denote a hydrogen atom or a methyl or ethyl radical;preferably, R9 denotes: a hydrocarbon group having 9 to 17 carbon atoms;preferably, R10 denotes: an acyl group having 2 to 30 carbon atoms which can contain a hydroxyl group.The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to claim 1, the bioactive lipid is a natural ceramide, a synthetic ceramide, a pseudo-ceramide, a ceramide analog;preferably, the natural ceramide is selected from the group comprising: C2 ceramide, C8 ceramide, Cl6 ceramide, C18 ceramide, C20 ceramide and C24 ceramide;preferably, the pseudo-ceramide is selected from the group comprising: 1, 3-bis (N-2- (hydroxyethyl) palmitoylamino) -2-hydroxy propane, 1, 3-bis (N-2- (hydroxyethyl) lauroyl amino) -2-hydroxy propane, 1, 3-bis (N-2-(hydroxyethyl) isostearoylamino) -2-hydroxy propane, 1, 3-bis (N-2- (hydroxyethyl) stearoylamino) -2-hydroxypropane, and a mixture thereof;preferably, the ceramide analogs is selected from the group comprising: C6-serinol and (2S, 3R) - (4E, 6E) -2-octanoylamidooctadecadiene-l, 3-diol (4, 6-diene-ceramide) , 5R-OH-3E-Q-ceramide, adamantyl-ceramide and benzene-C4-ceramide, N- (2-hydroxy-l- (hydroxymethyl) ethyl) -palmitoylamide ("S16") ; N- (2-hydroxy-l -(hydroxymethyl) ethyl) -oleoylamide ("S18") ; N, N-bis (2-hydroxyethyl) palmitoylamide ("B16") ; N, N-bis (2-hydroxyethyl) oleoylamide ("Bl 8") ; N-tris (hydroxymethyl) raethyl-palmJtoylamide ("Tl 6") ; N-tris (hydroxymethyl) methyl-oleoylamide ("T18") ; N-acetyl sphingosine ("C2") ; D-threo-l-phenyl-2-decanoylamirio-3-morpholino-l propanol ("D-threo-PDMP") ; D-threo-1-phenyl-2-hexadecanoylamino-3 -morpholino-1-propanol ("D-Threo-PPMP") ; D-erythro-2-tetradecanoyl-l -phenyl-1-propanol (11D-MAPP") ; D-erythro-2- (N-myristoylamino) -l-phenyl-1-propanol ("MAPP") ; (IS, 2R) -D-erythro-2- (N-myristoylamino) -l-phenyl-l-propanol; and N-hexanoylsphingosine (C6-ceramide) ;preferably, the bioactive lipid is selected from the group comprising: Ceramide I, Ceramide TIC-001, Ceramide III, Ceramide IIIA, Ceramide IIIB, and Ceramide VI;preferably, the fatty acid is represented by formula B:in which, R15 denotes a hydrocarbon radical containing from 6 to 40 carbon atoms, preferably R15 is linear or branched, acyclic or cyclic, saturated or unsaturated, aliphatic or aromatic, substituted or unsubstituted, more preferably a linear or branched, acyclic C6-40 alkyl or alkenyl group or a C1-40 alkyl phenyl group, more particularly a C8-22 alkyl or alkenyl group or a C4-18 alkyl phenyl group, more preferably a C12-18 alkyl group or alkenyl group or a C6-16 alkyl phenyl group;preferably, the fatty acid is selected from the group comprising arachidic acid, arachidonic acid, beeswax acid, capric acid, caproic acid, caprylic acid, coconut acid, lauric acid, myristic acid, palmitic acid, stearic acid, behenic acid, oleic acid, undecylenic acid, tannic acid (tallic acid) , isostearic acid, linoleic acid, linolenic acid, undecanoic acid, rapeseed acid, tallow acid, wheat germ acid, eicosapentaenoic acid (EPA) , docosahexaenoic acid (DHA) , and mixtures thereof; preferably, the fatty acid ester is selected from the group comprising monoglycerides of C12 to C20 saturated or unsaturated fatty acids, esters of saturated or unsaturated fatty acids with diols, mono-and di-esters of polyethylene glycol with medium chain fatty acids, sorbitol or sorbitan esters, esters of sorbitol or sorbitan with polyethylene glycol and / or fatty acids;preferably, the sterol is selected from the group comprising cholesterol, cholesteryl sulfate, cholesteryl acetate, cholesteryl stearate, cholesteryl isostearate, cholesteryl hydroxystearate, phytosterol and mixtures thereof;preferably, the phospholipid is selected from the group comprising dioleoylphosphatidylethanolamine (DOPE) , distearoylphosphatidylcholine (DSPC) , palmitoyloleoylphosphatidylcholine (POPC) , egg phosphatidylcholine (EPC) , dioleoylphosphatidylcholine (DOPC) , dipalmitoylphosphatidylcholine (DPPC) , dioleoylphosphatidylglycerol (DOPG) , dipalmitoylphosphatidylglycerol (DPPG) , distearoylphosphatidylethanolamine (DSPE) , phosphatidylethanolamine (PE) , dipalmitoylphosphatidylethanolamine, 1, 2-dioleoyl-sn-glycero-3-phospho-L-serine (DOPS) , 1, 2-diphytanoyl-sn-glycero-3-phosphoethanolamine (Diphytanoyl-PE) , 1, 2-dilauroyl-sn-glycero-3-phosphoethanolamine (DLPE) , 1, 2-dimyristoyl-sn-glycero-3-phosphoethanolamine (DMPE) , 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) , and mixtures thereof;preferably, the esters is selected from the group comprising: methyl ester, ethyl ester, trichloroethyl ester, propyl ester, butyl ester, pentyl ester, tert-butyl ester, benzyl ester, nitrobenzyl ester, methoxybenzyl ester, benzhydryl;preferably, the bioactive lipid is selected from the group comprising: N-stearoyl-dihydroxy-sphingosine, N- (27-octadecanoyloxy-heptacosanoyl) -phytosphingosine, N-stearoyl-phytosphingosine, N-linoleoyl-phytosphingosine, N-oleoyl-phytosphingosine, N-2-hydroxystearoyl-phytosphingosine, ceramide NDS, ceramide NS, ceramide NP, ceramide NH, ceramide ADS, ceramide AS, ceramide AP, ceramide AH, ceramide EODS, ceramide EOS, ceramide EOP, ceramide EOH, ceramide Nds, ceramide Ads, ceramide EOds, C2 Ceramide, C6 Ceramide, C8 Ceramide, C16 Ceramide, C18 Ceramide, C20 Ceramide, C24 Ceramide, (2S, 3R) - (4E, 6E) -2-octanoylamidooctadecadiene-1, 3-diol, 5R-OH-3E-Q-ceramide, Adamantyl-ceramide, Benzene-C4-ceramide, N- (2-hydroxy-1- (hydroxymethyl) ethyl) -palmitoylamide ("S16") , N- (2-hydroxy-1- (hydroxymethyl) ethyl) -oleoylamide ("S18") , N, N-bis (2-hydroxyethyl) palmitoylamide ("B16") , N, N-bis (2-hydroxyethyl) oleoylamide ("B18") , N-tris (hydroxymethyl) methyl-palmitoylamide ("T16") , N-tris (hydroxymethyl) methyl-oleoylamide ("T18") , D-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol ("D-threo-PDMP") , D-threo-1-phenyl-2-hexadecanoylamino-3-morpholino-1-propanol ("D-Threo-PPMP") , D-erythro-2-tetradecanoyl-1-phenyl-1-propanol ("D-MAPP") , D-erythro-2- (N-myristoylamino) -1-phenyl-1-propanol ("MAPP") , (1S, 2R) -D-erythro-2- (N-myristoylamino) -1-phenyl-1-propanol, C6-Serinol, N-docosanoyl-N-methyl-D-glucamine, Caprooyl Phytosphingosine, Caprooyl Sphingosine, Bis (N-hydroxyethyl-N-cetyl) malonamide, N- (2-hydroxyethyl) -N- (3-cetyloxy-2-hydroxypropyl) amide of cetylic acid, 2-N-linoleoylaminooctadecane-1, 3-diol, 2-N-oleoylaminooctadecane-1, 3-diol, 2-N-palmitoylaminooctadecane-1, 3-diol, 2-N-stearoylaminooctadecane-1, 3-diol, 2-N-behenoylaminooctadecane-1, 3-diol, 2-N- [2-hydroxypalmitoyl] aminooctadecane-1, 3-diol, 2-N-stearoylaminooctadecane-1, 3, 4-triol, 2-N-palmitoylaminohexadecane-1, 3-diol, sphingosine-1-phosphate, ceramide-1-phosphate,and mixtures thereof;preferably, the bioactive lipid is selected from ceramide NS, ceramide NP or ceramide EOP;preferably, one payload can bind to 1-2 the same or different peptides via the linker, or 1-2 the same or different payloads can bind to one peptide via the linker; and preferably, one payload binds to one peptide by the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 4, wherein R11 is an N-terminal modification selected from the group comprising acetylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification, glycosylation, fluorination, sulfonation; preferably, acetyl modification, fatty acid modification, and pyrenebutyrate modification;preferably, R11 is selected from the group comprising: Ac, C8, C10, C12, C14, C16, C18, C20, C22.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 5, wherein R12 is a C-terminal modification selected from the group comprising amidation, alkylation, lipidation, PEGylation, cholesterol modification, polycyclic aromatic hydrocarbon modification; preferably, NH2.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 6, wherein the linking moiety is preferably cysteine or lysine, wherein the cysteine or lysine can be L or D form.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 7, wherein the targeting moiety is selected from the group comprising transferrin, a Penetration Accelerating Sequence (PAS) , a Nuclear Localization Signal (NLS) sequence, an Endosomal Escape Enhancer, and a Heparin Sulfate Binding Peptides; and optionally, the targeting moiety is connected to the linker, preferably by Cys or Lys residue in the targeting moiety.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 8, wherein the transferrin can be a sequence of Lys-His-Ala-Ile-Tyr-Pro-Arg-His (SEQ ID NO. 689) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 9, wherein the PAS can be a sequence of Pro-Lys-Lys-Lys-Arg-Lys-Val-βAla-Lys-Phe-Phe-Leu-Ile-Pro-Lys-Gly (SEQ ID NO. 690) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 10, wherein the Endosomal Escape Enhancer can be selected from the group comprising WEAALAEALAEALAEHLAEALAEALEALAA (GALA, SEQ ID NO. 691) , LFEAIEGFIENGWEGMIDGWY (INF7, SEQ ID NO. 692) , WEAKLAKALAKALAKHLAKALAKALKACEA (KALA, SEQ ID NO. 693) , GLFHAIAHFIHGGWHGLIHGWYG (H5WYG, SEQ ID NO. 694) , and GLFGAIAGFIENGWEGMIDGWYG (HA2-Derived Peptide, SEQ ID NO. 695) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 11, wherein the Heparin Sulfate Binding Peptides can be selected from the group comprising LRSRTKIIRIR (HBPep, SEQ ID NO. 696) , SPKRKGGSRKYSPTSPTTSPTSKRKYSP (HS-20, SEQ ID NO. 697) , and KHKNKRKT (Platelet Factor 4, SEQ ID NO. 698) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 12, wherein the NLS sequence can be selected from the group comprising PKKKRKV (NLS1, SEQ ID NO. 699) , PKLKRQ (NLS2, SEQ ID NO. 700) , PAAKRVKLD (NLS3, SEQ ID NO. 701) , RPRK (SEQ ID NO. 702) , RRARRPRG (SEQ ID NO.703) , GKRKLITSEEERSPAKRGRKS (SEQ ID NO. 704) , KGKKGRTQKEKKAARARSKGKN (SEQ ID NO.705) , RKRCAAGVGGGPAGCPAPGSTPLKKPRR (SEQ ID NO. 706) , RKPVTAQERQREREEKRRRRQERAKEREKRRQERER (SEQ ID NO. 707) , RSGGNHRRNGRGGRGGYNRRNNGYHPY (SEQ ID NO. 708) , TLLLRETMNNLGVSDHAVLSRKTPQPY (SEQ ID NO. 709) , PGKMDKGEHRQERRDRPY, (SEQ ID NO. 710) , GKKKKGKPGKRREQRKKKRRT, (SEQ ID NO.711) , SANKVTKNKSNSSPYLNKRKGKPGPDS (SEQ ID NO. 712) , and VHSHKKKKIPTSPTFTTPKTLTLRRQPKYPRKSAPRRNKLDHY (SEQ ID NO. 713) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 13, wherein the oligo-arginine or oligo-arginine-analog is implanted with the spacer in such a way that one spacer is implanted in between every two adjacent residues in the oligo-arginine or oligo-arginine-analog; or in such a way that the spacer and the residues in the oligo-arginine or oligo-arginine-analog collectively form 2 or more unit structures of (X1X2X3) , wherein 0-1 in X1, X2 and X3 is the spacer and the other 2 or 3 are the residues of the oligo-arginine or oligo-arginine-analog.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 14, wherein the spacer and the oligo-arginine or oligo-arginine-analog collectively form 2-12, preferably 2-5 unit structures of (X1X2X3) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 15, wherein all the unit structures of (X1X2X3) are the same.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 16, wherein the spacer consists of 1-3, preferably 1 residue.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 17, wherein the residue in the spacer is selected from the group comprising β-alanine (βAla) , γ-Aminobutyric acid, Aminohexanoic acid (Ahx) , proline, and tryptophan, wherein the residue can be L or D form.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 18, wherein the residue in the oligo-arginine-analog is preferably selected from the group comprising 2- (6-guanidylhexyl) amino acetic acid (GuanidylC6NHPeptoid) , 2- (4-guanidylbutyl) amino acetic acid (GuanidylC4NHPeptoid) , and 2- (7-guanidylheptyl) amino acetic acid (GuanidylC7NHPeptoid) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to19, wherein the peptide has the following structures of Formula II, Formula III, Formula IV, Formula V, Formula VI, or Formula VII:R11-W1-PP-R12 (Formula II)wherein R11, W1, PP, and R12 are the same as defined in claim 1, and wherein W1 is connected to the linker;R11-X-PP-R12 (Formula III)wherein R11, X, PP, and R12 are the same as defined in claim 1; and wherein X is connected to the linker, preferably by Cys or Lys residue in X;R11-PP-W2-R12 (Formula IV)wherein R11, PP, W2, and R12 are the same as defined in claim 1; and wherein W2 is connected to the linker;R11-W1-PP-W2-R12 (Formula V)wherein R11, W1, PP, W2, and R12 are the same as defined in claim 1, and wherein one or both of W1 and W2 are connected to the linker;R11-W1-X-PP-R12 (Formula VI)wherein R11, W1, X, PP, and R12 are the same as defined in claim 1, and wherein one or both of W1 and X are connected to the linker, and wherein when X is connected to the linker, it is preferably connected by Cys or Lys residue in X;R11-X-PP-W2-R12 (Formula VII)wherein R11, X, PP, W2, and R12 are the same as defined in claim 1, and wherein one or both of X and W2 are connected to the linker, and wherein when X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the PP is oligo-arginine or oligo-arginine-analog.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 21, wherein the peptide has the following structure of Formula II:R11-W1-PP-R12 (Formula II)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is oligo-arginine; and wherein W1 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 21, wherein the peptide has the following structure of Formula III:R11-X-PP-R12 (Formula III)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is transferrin or PAS, and the PP is oligo-arginine; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 21, wherein the peptide has the following structure of Formula V:R11-W1-PP-W2-R12 (Formula V)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is oligo-arginine; and wherein W1 and W2 are connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 21, wherein the peptide is selected from the group comprising:Ac-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 718) ,C8-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 719) ,C10-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 720) ,C12-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 721) ,C14-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 722) ,C16-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 723) ,C18-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 724) ,C20-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 725) ,C22-Cys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 726) ,Ac-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 727) ,C8-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 728) ,C10-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 729) ,C12-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 730) ,C14-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 731) ,C16-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 732) ,C18-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 733) ,C20-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 734) ,C22-Lys-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 735) ,Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 736) ,C8-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 737) ,C10-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 738) ,C12-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 739) ,C14-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 740) ,C16-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 741) ,C18-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 742) ,C20-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 743) ,C22-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 744) ,Ac-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 745) ,C8-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 746) ,C10-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 747) ,C12-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 748) ,C14-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 749) ,C16-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 750) ,C18-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 751) ,C20-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 752) ,C22-Lys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 753) ,Ac-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 754) ,C8-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 755) ,C10-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 756) ,C12-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 757) ,C14-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 758) ,C16-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 759) ,C18-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 760) ,C20-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 761) ,C22-Cys-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 762) ,Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 763) ,C8-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 764) ,C10-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 765) ,C12-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 766) ,C14-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 767) ,C16-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 768) ,C18-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 769) ,C20-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 770) ,C22-Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 771) ,Ac-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 799) ,C8-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 800) ,C10-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 801) ,C12-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 802) ,C14-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 803) ,C16-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 804) ,C18-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 805) ,C20-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 806) ,C22-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 807) ,Ac-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 808) ,C8-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 809) ,C10-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 810) ,C12-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 811) ,C14-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 812) ,C16-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 813) ,C18-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 814) ,C20-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 815) ,C22-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-CONH2 (SEQ ID No. 816) ,Ac-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 817) ,C8-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 818) ,C10-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 819) ,C12-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 820) ,C14-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 821) ,C16-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 822) ,C18-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 823) ,C20-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 824) ,C22-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 825) ,Ac-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 826) ,C8-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 827) ,C10-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 828) ,C12-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 829) ,C14-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 830) ,C16-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 831) ,C18-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 832) ,C20-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 833) ,C22-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys-CONH2 (SEQ ID No. 834) ,Palm-Cys-Arg-Arg-Arg-Arg-Arg-Arg-NH2 (SEQ ID No. 1208) ,Ac-Cys-Arg-Arg-Arg-Arg-Arg-Arg-NH2 (SEQ ID No. 1210) ;preferably, the peptide is selected from the group comprising:Ac-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 47) ,C8-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 48) ,C10-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 49) ,C12-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 50) ,C14-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 51) ,C16-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 52) ,C18-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 53) ,C20-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 54) ,C22-Cys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 55) ,Ac-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 56) ,C8-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 57) ,C10-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 58) ,C12-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 59) ,C14-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 60) ,C16-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 61) ,C18-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 62) ,C20-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 63) ,C22-Lys-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 64) ,Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 65) ,C8-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 66) ,C10-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 67) ,C12-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 68) ,C14-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 69) ,C16-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 70) ,C18-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 71) ,C20-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 72) ,C22-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 73) ,Ac-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 74) ,C8-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 75) ,C10-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 76) ,C12-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 77) ,C14-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 78) ,C16-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 79) ,C18-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 80) ,C20-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 81) ,C22-Lys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-CONH2 (SEQ ID No. 82) ,Ac-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 83) ,C8-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 84) ,C10-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 85) ,C12-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 86) ,C14-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 87) ,C16-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 88) ,C18-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 89) ,C20-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 90) ,C22-Cys-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 91) ,Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 92) ,C8-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 93) ,C10-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 94) ,C12-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 95) ,C14-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 96) ,C16-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 97) ,C18-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 98) ,C20-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 99) ,C22-Cys-DArg-DArg-DArg-DArg-DArg-DArg-DArg-DArg-Cys-CONH2 (SEQ ID No. 100) ,Ac-Cys-DArg-DArg-DArg-DArg-DArg-DArg-NH2 (SEQ ID No. 1209) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that one spacer is implanted in between every two adjacent residues in the oligo-arginine or oligo-arginine-analog, wherein the spacer consists of one residue.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the residue is preferably β-alanine.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula II:R11-W1-PP-R12 (Formula II)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined in claim 26; and wherein W1 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula III:R11-X-PP-R12 (Formula III)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is NLS, and the PP is the same as defined in claim 26; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula IV:R11-PP-W2-R12 (Formula IV)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W2 is Cys or Lys, and the PP is the same as defined in claim 26; and wherein W2 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula V:R11-W1-PP-W2-R12 (Formula V)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 26; and wherein W1 and / or W2 are connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula VI:R11-W1-X-PP-R12 (Formula VI)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined in claim 26; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide has the following structure of Formula I:R11-W1-X-PP-W2-R12 (Formula I)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 26; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 26, wherein the peptide is selected from the group comprising:Ac-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 101) ,C8-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 102) ,C10-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 103) ,C12-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 104) ,C14-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 105) ,C16-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 106) ,C18-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 107) ,C20-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 108) ,C22-Cys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 109) ,Ac-Cys-Arg-βAla-Arg-βAla-Arg-βAla-Arg-βAla-Arg-βAla-Arg-NH2 (SEQ ID No. 1211) ,Palm-Cys-Arg-βAla-Arg-βAla-Arg-βAla-Arg-NH2 (SEQ ID No. 1212) ,Ac-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 110) ,C8-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 111) ,C10-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 112) ,C12-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 113) ,C14-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 114) ,C16-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 115) ,C18-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 116) ,C20-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 117) ,C22-Lys-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 118) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 119) (NLS1-Arg- (βAla-Arg) 5) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 120) (NLS1-Arg- (βAla-Arg) 5) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 121) (NLS1-Arg- (βAla-Arg) 5) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 122) (NLS1-Arg- (βAla-Arg) 5) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 123) (NLS1-Arg- (βAla-Arg) 5) ,C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 124) (NLS1-Arg- (βAla-Arg) 5) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 125) (NLS1-Arg- (βAla-Arg) 5) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 126) (NLS1-Arg- (βAla-Arg) 5) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 127) (NLS1-Arg- (βAla-Arg) 5) , Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 128) (NLS1-Arg- (βAla-Arg) 5) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 129) (NLS1-Arg- (βAla-Arg) 5) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 130) (NLS1-Arg- (βAla-Arg) 5) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 131) (NLS1-Arg- (βAla-Arg) 5) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 132) (NLS1-Arg- (βAla-Arg) 5) ,C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 133) (NLS1-Arg- (βAla-Arg) 5) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 134) (NLS1-Arg- (βAla-Arg) 5) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 135) (NLS1-Arg- (βAla-Arg) 5) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2, (SEQ ID No. 136) (NLS1-Arg- (βAla-Arg) 5) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 137) (NLS1-Arg- (βAla-Arg) 4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 138) (NLS1-Arg- (βAla-Arg) 4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 139) (NLS1-Arg- (βAla-Arg) 4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 140) (NLS1-Arg- (βAla-Arg) 4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 141) (NLS1-Arg- (βAla-Arg) 4) ,C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 142) (NLS1-Arg- (βAla-Arg) 4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 143) (NLS1-Arg- (βAla-Arg) 4) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 144) (NLS1-Arg- (βAla-Arg) 4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 145) (NLS1-Arg- (βAla-Arg) 4) ,Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 146) (NLS1-Arg- (βAla-Arg) 4) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 147) (NLS1-Arg- (βAla-Arg) 4) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 148) (NLS1-Arg- (βAla-Arg) 4) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 149) (NLS1-Arg- (βAla-Arg) 4) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 150) (NLS1-Arg- (βAla-Arg) 4) ,C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 151) (NLS1-Arg- (βAla-Arg) 4) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 152) (NLS1-Arg- (βAla-Arg) 4) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 153) (NLS1-Arg- (βAla-Arg) 4) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 154) (NLS1-Arg- (βAla-Arg) 4) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 155) (NLS2-Arg- (βAla-Arg) 4) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 156) (NLS2-Arg- (βAla-Arg) 4) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 157) (NLS2-Arg- (βAla-Arg) 4) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 158) (NLS2-Arg- (βAla-Arg) 4) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 159) (NLS2-Arg- (βAla-Arg) 4) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 160) (NLS2-Arg- (βAla-Arg) 4) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 161) (NLS2-Arg- (βAla-Arg) 4) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 162) (NLS2-Arg- (βAla-Arg) 4) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 163) (NLS2-Arg- (βAla-Arg) 4) ,Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 164) (NLS2-Arg- (βAla-Arg) 4) ,C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 165) (NLS2-Arg- (βAla-Arg) 4) ,C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 166) (NLS2-Arg- (βAla-Arg) 4) ,C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 167) (NLS2-Arg- (βAla-Arg) 4) ,C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 168) (NLS2-Arg- (βAla-Arg) 4) ,C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 169) (NLS2-Arg- (βAla-Arg) 4) ,C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 170) (NLS2-Arg- (βAla-Arg) 4) ,C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 171) (NLS2-Arg- (βAla-Arg) 4) ,C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 172) (NLS2-Arg- (βAla-Arg) 4) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 173) (NLS3-Arg- (βAla-Arg) 4) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 174) (NLS3-Arg- (βAla-Arg) 4) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 175) (NLS3-Arg- (βAla-Arg) 4) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 176) (NLS3-Arg- (βAla-Arg) 4) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 177) (NLS3-Arg- (βAla-Arg) 4) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 178) (NLS3-Arg- (βAla-Arg) 4) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 179) (NLS3-Arg- (βAla-Arg) 4) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 180) (NLS3-Arg- (βAla-Arg) 4) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 181) (NLS3-Arg- (βAla-Arg) 4) ,Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 182) (NLS3-Arg- (βAla-Arg) 4) ,C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 183) (NLS3-Arg- (βAla-Arg) 4) ,C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 184) (NLS3-Arg- (βAla-Arg) 4) ,C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 185) (NLS3-Arg- (βAla-Arg) 4) ,C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 186) (NLS3-Arg- (βAla-Arg) 4) ,C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 187) (NLS3-Arg- (βAla-Arg) 4) ,C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 188) (NLS3-Arg- (βAla-Arg) 4) ,C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 189) (NLS3-Arg- (βAla-Arg) 4) ,C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2, (SEQ ID No. 190) (NLS3-Arg- (βAla-Arg) 4) ,Ac-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 191) ,C8-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 192) ,C10-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 193) ,C12-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 194) ,C14-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 195) ,C16-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 196) ,C18-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 197) ,C20-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 198) ,C22-Cys-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 199) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 200) (NLS1-Arg- (βAla-Arg) 5)C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 201) (NLS1-Arg- (βAla-Arg) 5)C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 202) (NLS1-Arg- (βAla-Arg) 5)C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 203) (NLS1-Arg- (βAla-Arg) 5)C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 204) (NLS1-Arg- (βAla-Arg) 5)C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 205) (NLS1-Arg- (βAla-Arg) 5)C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 206) (NLS1-Arg- (βAla-Arg) 5)C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 207) (NLS1-Arg- (βAla-Arg) 5)C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2, (SEQ ID No. 208) (NLS1-Arg- (βAla-Arg) 5)Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 209) (NLS1-Arg- (βAla-Arg) 4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 210) (NLS1-Arg- (βAla-Arg) 4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 211) (NLS1-Arg- (βAla-Arg) 4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 212) (NLS1-Arg- (βAla-Arg) 4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 213) (NLS1-Arg- (βAla-Arg) 4) ,C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 214) (NLS1-Arg- (βAla-Arg) 4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 215) (NLS1-Arg- (βAla-Arg) 4) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 216) (NLS1-Arg- (βAla-Arg) 4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 217) (NLS1-Arg- (βAla-Arg) 4) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 218) (NLS2-Arg- (βAla-Arg) 4) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 219) (NLS2-Arg- (βAla-Arg) 4) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 220) (NLS2-Arg- (βAla-Arg) 4) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 221) (NLS2-Arg- (βAla-Arg) 4) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 222) (NLS2-Arg- (βAla-Arg) 4) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 223) (NLS2-Arg- (βAla-Arg) 4) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 224) (NLS2-Arg- (βAla-Arg) 4) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 225) (NLS2-Arg- (βAla-Arg) 4) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 226) (NLS2-Arg- (βAla-Arg) 4) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 227) (NLS3-Arg-(βAla-Arg) 4) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 228) (NLS3-Arg-(βAla-Arg) 4) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 229) (NLS3-Arg-(βAla-Arg) 4) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 230) (NLS3-Arg-(βAla-Arg) 4) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 231) (NLS3-Arg-(βAla-Arg) 4) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 232) (NLS3-Arg-(βAla-Arg) 4) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 233) (NLS3-Arg-(βAla-Arg) 4) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 234) (NLS3-Arg-(βAla-Arg) 4) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 235) (NLS3-Arg-(βAla-Arg) 4) ,Ac-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 835) ,C8-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 836) ,C10-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 837) ,C12-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 838) ,C14-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 839) ,C16-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 840) ,C18-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 841) ,C20-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 842) ,C22-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 843) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 844) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 845) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 846) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 847) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 848) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 849) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 850) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 851) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-CONH2 (SEQ ID No. 852) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 853) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 854) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 855) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 856) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 857) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 858) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 859) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 860) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 861) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 862) ,C8-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 863) ,C10-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 864) ,C12-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 865) ,C14-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 866) ,C16-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 867) ,C18-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 868) ,C20-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 869) ,C22-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 870) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 871) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 872) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 873) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 874) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 875) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 876) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 877) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 878) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-CONH2 (SEQ ID No. 879) ,Ac-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 880) ,C8-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 881) ,C10-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 882) ,C12-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 883) ,C14-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 884) ,C16-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 885) ,C18-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 886) ,C20-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 887) ,C22-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 888) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 889) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 890) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 891) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 892) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 893) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 894) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 895) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 896) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 5-Cys-CONH2 (SEQ ID No. 897) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 898) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 899) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 900) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 901) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 902) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 903) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 904) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 905) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 906) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 907) ,C8-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 908) ,C10-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 909) ,C12-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 910) ,C14-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 911) ,C16-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 912) ,C18-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 913) ,C20-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 914) ,C22-Pro-Lys-Leu-Lys-Arg-Gln-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 915) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 916) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 917) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 918) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 919) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 920) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 921) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 922) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 923) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp-Arg- (βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 924) ,Acetyl- (GuanidylC6NHPeptoid-Ahx) 7GuanidylC6NHPeptoid-Cys-NH2, (SEQ ID No. 236)C18-Ahx-GuanidylC6NHPeptoid- (Ahx-GuanidylC6NHPeptoid) 7-Cys-NH2 (SEQ ID No. 237) ;preferably, the peptide is selected from the group comprising:Ac-Cys-DArg-βAla-DArg-βAla-DArg-βAla-DArg-βAla-DArg-βAla-DArg-NH2 (SEQ ID No. 1213) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same unit structures of (X1X2X3) , wherein X2 is the spacer and X1 and X3 are arginine or arginine-analog, wherein the spacer consists of one residue.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the residue is preferably Aminohexanoic acid or β-alanine.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula II:R11-W1-PP-R12 (Formula II)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, and the PP is the same as defined in claim 35;and wherein W1 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula III:R11-X-PP-R12 (Formula III)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, X is NLS, and the PP is the same as defined in claim 35; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula IV:R11-PP-W2-R12 (Formula IV)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, and the PP is the same as defined in claim 35;and wherein W2 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula V:R11-W1-PP-W2-R12 (Formula V)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 35; and wherein W1 and / or W2 are connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula VI:R11-W1-X-PP-R12 (Formula VI)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined in claim 35; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide has the following structure of Formula I:R11-W1-X-PP-W2-R12 (Formula I)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 35; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 35, wherein the peptide is selected from the group comprising:Ac- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 238) ,C8- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 239) ,C10- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 240) ,C12- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 241) ,C14- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 242) ,C16- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 243) ,C18- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 244) ,C20- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 245) ,C22- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 246) ,Ac- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 247) ,C8- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 248) ,C10- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 249) ,C12- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 250) ,C14- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 251) ,C16- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 252) ,C18- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 253) ,C20- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 254) ,C22- (Arg-Ahx-Arg) 4-Lys-CONH2 (SEQ ID No. 255) ,Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 256) ,C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 257) ,C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 258) ,C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 259) ,C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 260) ,C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 261) ,C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 262) ,C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 263) ,C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 264) ,Ac- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 265) ,C8- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 266) ,C10- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 267) ,C12- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 268) ,C14- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 269) ,C16- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 270) ,C18- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 271) ,C20- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 272) ,C22- (Arg-βAla-Arg) 4-Lys-CONH2 (SEQ ID No. 273) ,Ac-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 274) ,C8-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 275) ,C10-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 276) ,C12-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 277) ,C14-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 278) ,C16-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 279) ,C18-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 280) ,C20-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 281) ,C22-Cys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 282) ,Ac-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 283) ,C8-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 284) ,C10-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 285) ,C12-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 286) ,C14-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 287) ,C16-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 288) ,C18-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 289) ,C20-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 290) ,C22-Lys- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 291) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 292) (NLS1- (Arg-βAla-Arg) 4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 293) (NLS1- (Arg-βAla-Arg) 4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 294) (NLS1- (Arg-βAla-Arg) 4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 295) (NLS1- (Arg-βAla-Arg) 4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 296) (NLS1- (Arg-βAla-Arg) 4) ,C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 297) (NLS1- (Arg-βAla-Arg) 4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 298) (NLS1- (Arg-βAla-Arg) 4) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 299) (NLS1- (Arg-βAla-Arg) 4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 300) (NLS1- (Arg-βAla-Arg) 4) ,Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 301) (NLS1- (Arg-βAla-Arg) 4) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 302) (NLS1- (Arg-βAla-Arg) 4) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 303) (NLS1- (Arg-βAla-Arg) 4) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 304) (NLS1- (Arg-βAla-Arg) 4) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 305) (NLS1- (Arg-βAla-Arg) 4) ,C16-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 306) (NLS1- (Arg-βAla-Arg) 4) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 307) (NLS1- (Arg-βAla-Arg) 4) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 308) (NLS1- (Arg-βAla-Arg) 4) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2, (SEQ ID No. 309) (NLS1- (Arg-βAla-Arg) 4) ,Ac-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 310) ,C8-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 311) ,C10-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 312) ,C12-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 313) ,C14-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 314) ,C16-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 315) ,C18-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 316) ,C20-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 317) ,C22-Cys- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 318) ,Ac-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 319) ,C8-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 320) ,C10-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 321) ,C12-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 322C14-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 323) ,C16-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 324) ,C18-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 325) ,C20-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 326) ,C22-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 327Ac-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 328) ,C8-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 329) ,C10-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 330) ,C12-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 331C14-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 332) ,C16-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 333) ,C18-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 334) ,C20-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 335) ,C22-Cys- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 336) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 337) (NLS1- (Arg-βAla-Arg) 4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 338) (NLS1- (Arg-βAla-Arg) 4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 339) (NLS1- (Arg-βAla-Arg) 4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 340) (NLS1- (Arg-βAla-Arg) 4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 341) (NLS1- (Arg-βAla-Arg) 4) ,C16-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 342) (NLS1- (Arg-βAla-Arg) 4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 343) (NLS1- (Arg-βAla-Arg) 4) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 344) (NLS1- (Arg-βAla-Arg) 4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2, (SEQ ID No. 345) (NLS1- (Arg-βAla-Arg) 4) ,Ac- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 925) ,C8- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 926) ,C10- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 927) ,C12- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 928) ,C14- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 929) ,C16- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 930) ,C18- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 931) ,C20- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 932) ,C22- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 933) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 934) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 935) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 936) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 937) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 938) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 939) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 940) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 941) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-CONH2 (SEQ ID No. 942) ,Ac- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 943) ,C8- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 944) ,C10- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 945) ,C12- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 946) ,C14- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 947) ,C16- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 948) ,C18- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 949) ,C20- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 950) ,C22- (Arg-Ahx-Arg) 4-Cys-CONH2 (SEQ ID No. 951) ,Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 952) ,C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 953) ,C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 954) ,C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 955) ,C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 956) ,C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 957) ,C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 958) ,C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 959) ,C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 960) ,Ac- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 961) ,C8- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 962) ,C10- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 963) ,C12- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 964) ,C14- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 965) ,C16- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 966) ,C18- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 967) ,C20- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 968) ,C22- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 969) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 970) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 971) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 972) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 973) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 974) ,C16-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 975) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 976) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 977) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (Arg-βAla-Arg) 4-Cys-CONH2 (SEQ ID No. 978) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same unit structures of (X1X2X3) , wherein X1 is proline and X2 and X3 are arginine or arginine-analog, wherein proline and arginine can be L or D form.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide has the following structure of Formula II:R11-W1-PP-R12 (Formula II)wherein R11 is a fatty acid modification or acetyl modification, R12 is absent or NH2, W1 is Cys or Lys, and the PP is the same as defined in claim 44; and wherein W1 is connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide has the following structure of Formula III:R11-X-PP-R12 (Formula III)wherein R11 is a fatty acid modification or acetyl modification, R12 is absent or NH2, X is NLS, and the PP is the same as defined in claim 44; preferably, the NLS is selected from NLS1, NLS2 or NLS3; and wherein X is connected to the linker, preferably by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide has the following structure of Formula V:R11-W1-PP-W2-R12 (Formula V)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 44; and wherein W1 and / or W2 are connected to the linker.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide has the following structure of Formula VI:R11-W1-X-PP-R12 (Formula VI)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, W1 is Cys or Lys, and the PP is the same as defined in claim 44; and wherein W1 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide has the following structure of Formula I:R11-W1-X-PP-W2-R12 (Formula I)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2 or absent, each of W1 and W2 is Cys or Lys, and the PP is the same as defined in claim 44; and wherein W1 and / or W2 and / or X are connected to the linker, wherein if X is connected to the linker, it is preferably connected by Cys or Lys residue in X.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 44, wherein the peptide is selected from the group comprising:Ac-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 772) ,C8-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 773) ,C10-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 774) ,C12-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 775) ,C14-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 776) ,C16-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 777) ,C18-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 778) ,C20-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 779) ,C22-Cys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 780) ,Ac-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 781) ,C8-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 782) ,C10-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 783) ,C12-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 784) ,C14-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 785) ,C16-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 786) ,C18-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 787) ,C20-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 788) ,C22-Lys- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 789) ,Ac-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 364) ,C8-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 365) ,C10-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 366) ,C12-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 367) ,C14-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 368) ,C16-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 369) ,C18-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 370) ,C20-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 371) ,C22-Cys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 372) ,Ac-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 373) ,C8-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 374) ,C10-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 375) ,C12-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 376) ,C14-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 377) ,C16-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 378) ,C18-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 379) ,C20-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 380) ,C22-Lys- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 381) ,Ac-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 382) ,C8-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 383) ,C10-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 384) ,C12-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 385) ,C14-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 386) ,C16-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 387) ,C18-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 388) ,C20-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 389) ,C22-Cys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 390) ,Ac-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 391) ,C8-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 392) ,C10-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 393) ,C12-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 394) ,C14-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 395) ,C16-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 396) ,C18-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 397) ,C20-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 398) ,C22-Lys- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 399) ,Ac-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 400) ,C8-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 401) ,C10-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 402) ,C12-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 403) ,C14-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 404) ,C16-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 405) ,C18-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 406) ,C20-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 407) ,C22-Cys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 408) ,Ac-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 409) ,C8-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 410) ,C10-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 411) ,C12-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 412) ,C14-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 413) ,C16-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 414) ,C18-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 415) ,C20-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 416) ,C22-Lys- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 417) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 418) (NLS1-pRR3) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 419) (NLS1-pRR3) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 420) (NLS1-pRR3) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 421) (NLS1-pRR3) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 422) (NLS1-pRR3) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 423) (NLS1-pRR3) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 424 (NLS1-pRR3) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 425) (NLS1-pRR3) ,Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 426) (NLS1-pRR3) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 427) (NLS1-pRR3) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 428) (NLS1-pRR3) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 429) (NLS1-pRR3) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 430) (NLS1-pRR3) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 431) (NLS1-pRR3) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 432) (NLS1-pRR3) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 433) (NLS1-pRR3) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 434) (NLS2-pRR3) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 435) (NLS2-pRR3) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 436) (NLS2-pRR3) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 437) (NLS2-pRR3) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 438) (NLS2-pRR3) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 439) (NLS2-pRR3) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 440) (NLS2-pRR3) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 441) (NLS2-pRR3) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 442) (NLS2-pRR3) ,Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 443) (NLS2-pRR3) ,C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 444) (NLS2-pRR3) ,C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 445) (NLS2-pRR3) ,C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 446) (NLS2-pRR3) ,C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 447) (NLS2-pRR3) ,C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 448) (NLS2-pRR3) ,C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 449) (NLS2-pRR3) ,C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 450) (NLS2-pRR3) ,C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 451) (NLS2-pRR3) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 452) (NLS3-pRR3) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 453) (NLS3-pRR3) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 454) (NLS3-pRR3) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 455) (NLS3-pRR3) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 456) (NLS3-pRR3) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 457) (NLS3-pRR3) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 458) (NLS3-pRR3) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 459) (NLS3-pRR3) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 460) (NLS3-pRR3) ,Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 461) (NLS3-pRR3) ,C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 462) (NLS3-pRR3) ,C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 463) (NLS3-pRR3) ,C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 464) (NLS3-pRR3) ,C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 465) (NLS3-pRR3) ,C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 466) (NLS3-pRR3) ,C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 467) (NLS3-pRR3) ,C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 468) (NLS3-pRR3) ,C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2, (SEQ ID No. 469) (NLS3-pRR3) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 470) (NLS1-pRR4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 471) (NLS1-pRR4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 472) (NLS1-pRR4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 473) (NLS1-pRR4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 474) (NLS1-pRR4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 475) (NLS1-pRR4) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 476) (NLS1-pRR4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 477) (NLS1-pRR4) ,Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 478) (NLS1-pRR4) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 479) (NLS1-pRR4) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 480) (NLS1-pRR4) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 481) (NLS1-pRR4) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 482) (NLS1-pRR4) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 483) (NLS1-pRR4) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 484) (NLS1-pRR4) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 485) (NLS1-pRR4) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 486) (NLS2-pRR4) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 487) (NLS2-pRR4) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 488) (NLS2-pRR4) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 489) (NLS2-pRR4) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 490) (NLS2-pRR4) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 491) (NLS2-pRR4) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 492) (NLS2-pRR4) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 493) (NLS2-pRR4) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 494) (NLS2-pRR4) ,Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 495) (NLS2-pRR4) ,C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 496) (NLS2-pRR4) ,C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 497) (NLS2-pRR4) ,C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 498) (NLS2-pRR4) ,C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 499) (NLS2-pRR4) ,C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 500) (NLS2-pRR4) ,C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 501) (NLS2-pRR4) ,C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 502) (NLS2-pRR4) ,C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 503) (NLS2-pRR4) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 504) (NLS3-pRR4) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 505) (NLS3-pRR4) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 506) (NLS3-pRR4) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 507) (NLS3-pRR4) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 508) (NLS3-pRR4) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 509) (NLS3-pRR4) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 510) (NLS3-pRR4) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 511) (NLS3-pRR4) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 512) (NLS3-pRR4) ,Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 513) (NLS3-pRR4) ,C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 514) (NLS3-pRR4) ,C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 515) (NLS3-pRR4) ,C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 516) (NLS3-pRR4) ,C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 517) (NLS3-pRR4) ,C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 518) (NLS3-pRR4) ,C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 519) (NLS3-pRR4) ,C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 520) (NLS3-pRR4) ,C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2, (SEQ ID No. 521) (NLS3-pRR4) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 522) (NLS1-pRR5) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 523) (NLS1-pRR5) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 524) (NLS1-pRR5) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 525) (NLS1-pRR5) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 526) (NLS1-pRR5) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 527) (NLS1-pRR5) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 528) (NLS1-pRR5) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 529) (NLS1-pRR5) ,Ac-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 530) (NLS1-pRR5) ,C8-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 531) (NLS1-pRR5) ,C10-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 532) (NLS1-pRR5) ,C12-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 533) (NLS1-pRR5) ,C14-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 534) (NLS1-pRR5) ,C18-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 535) (NLS1-pRR5) ,C20-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 536) (NLS1-pRR5) ,C22-Lys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 537) (NLS1-pRR5) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 538) (NLS2-pRR5) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 539) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 540) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 541) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 542) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 543) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 544) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 545) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) , (SEQ ID No. 546) ,Ac-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 547) (NLS2-pRR5) ,C8-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 548) (NLS2-pRR5) ,C10-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 549) (NLS2-pRR5) ,C12-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 550) (NLS2-pRR5) ,C14-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 551) (NLS2-pRR5) ,C16-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 552) (NLS2-pRR5) ,C18-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 553) (NLS2-pRR5) ,C20-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 554) (NLS2-pRR5) ,C22-Lys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 555) (NLS2-pRR5) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 556) (NLS3-pRR5) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 557) (NLS3-pRR5) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 558) (NLS3-pRR5) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 559) (NLS3-pRR5) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 560) (NLS3-pRR5) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 561) (NLS3-pRR5) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 562) (NLS3-pRR5) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 563) (NLS3-pRR5) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 564) (NLS3-pRR5) ,Ac-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 565) (NLS3-pRR5) ,C8-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 566) (NLS3-pRR5) ,C10-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 567) (NLS3-pRR5) ,C12-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 568) (NLS3-pRR5) ,C14-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 569) (NLS3-pRR5) ,C16-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 570) (NLS3-pRR5) ,C18-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 571) (NLS3-pRR5) ,C20-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 572) (NLS3-pRR5) ,C22-Lys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2, (SEQ ID No. 573) (NLS3-pRR5) ,Ac-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 790) ,C8-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 791) ,C10-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 792) ,C12-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 793) ,C14-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 794) ,C16-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 795) ,C18-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 796) ,C20-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 797) ,C22-Cys- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 798) ,Ac-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 583) ,C8-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 584) ,C10-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 585) ,C12-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 586) ,C14-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 587) ,C16-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 588) ,C18-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 589) ,C20-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 590) ,C22-Cys- (DPro-Arg-Arg) 5-Cys-COOH, (SEQ ID No. 591) ,Ac-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 592) ,C8-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 593) ,C10-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 594) ,C12-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 595) ,C14-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 596) ,C16-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 597) ,C18-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 598) ,C20-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 599) ,C22-Cys- (DPro-Arg-Arg) 4-Cys-COOH, (SEQ ID No. 600) ,Ac-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 601) ,C8-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 602) ,C10-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 603) ,C12-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 604) ,C14-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 605) ,C16-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 606) ,C18-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 607) ,C20-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 608) ,C22-Cys- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 609) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 610) (NLS1-pRR3) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 611) (NLS1-pRR3) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 612) (NLS1-pRR3) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 613) (NLS1-pRR3) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 614) (NLS1-pRR3) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 615) (NLS1-pRR3) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 616) (NLS1-pRR3) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 617) (NLS1-pRR3) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 618) (NLS2-pRR3) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 619) (NLS2-pRR3) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 620) (NLS2-pRR3) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 621) (NLS2-pRR3) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 622) (NLS2-pRR3) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 623) (NLS2-pRR3) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 624) (NLS2-pRR3) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 625) (NLS2-pRR3) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 626) (NLS2-pRR3) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 627) (NLS3-pRR3) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 628) (NLS3-pRR3) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 629) (NLS3-pRR3) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 630) (NLS3-pRR3) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 631) (NLS3-pRR3) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 632) (NLS3-pRR3) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 633) (NLS3-pRR3) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 634) (NLS3-pRR3) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2, (SEQ ID No. 635) (NLS3-pRR3) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 636) (NLS1-pRR4) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 637) (NLS1-pRR4) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 638) (NLS1-pRR4) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 639) (NLS1-pRR4) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 640) (NLS1-pRR4) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 641) (NLS1-pRR4) ,C20-CysPro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 642) (NLS1-pRR4) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 643) (NLS1-pRR4) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 644) (NLS2-pRR4) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 645) (NLS2-pRR4) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 646) (NLS2-pRR4) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 647) (NLS2-pRR4) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 648) (NLS2-pRR4) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 649) (NLS2-pRR4) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 650) (NLS2-pRR4) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 651) (NLS2-pRR4) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 652) (NLS2-pRR4) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 653) (NLS3-pRR4) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 654) (NLS3-pRR4) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 655) (NLS3-pRR4) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 656) (NLS3-pRR4) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 657) (NLS3-pRR4) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 658) (NLS3-pRR4) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 659) (NLS3-pRR4) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 660) (NLS3-pRR4) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2, (SEQ ID No. 661) (NLS3-pRR4) ,Ac-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 662) (NLS1-pRR5) ,C8-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 663) (NLS1-pRR5) ,C10-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 664) (NLS1-pRR5) ,C12-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 665) (NLS1-pRR5) ,C14-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 666) (NLS1-pRR5) ,C18-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 667) (NLS1-pRR5) ,C20-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 668) (NLS1-pRR5) ,C22-Cys-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 669) (NLS1-pRR5) ,Ac-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 670) (NLS2-pRR5) ,C8-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 671) (NLS2-pRR5) ,C10-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 672) (NLS2-pRR5) ,C12-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 673) (NLS2-pRR5) ,C14-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 674) (NLS2-pRR5) ,C16-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 675) (NLS2-pRR5) ,C18-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 676) (NLS2-pRR5) ,C20-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 677) (NLS2-pRR5) ,C22-Cys-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 678) (NLS2-pRR5) ,Ac-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 679) (NLS3-pRR5) ,C8-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 680) (NLS3-pRR5) ,C10-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 681) (NLS3-pRR5) ,C12-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 682) (NLS3-pRR5) ,C14-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 683) (NLS3-pRR5) ,C16-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 684) (NLS3-pRR5) ,C18-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 685) (NLS3-pRR5) ,C20-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 686) (NLS3-pRR5) ,C22-Cys-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2, (SEQ ID No. 687) (NLS3-pRR5) ;Ac- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 979) ,C8- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 980) ,C10- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 981) ,C12- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 982) ,C14- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 983) ,C16- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 984) ,C18- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 985) ,C20- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 986) ,C22- (DPro-Arg-Arg) 3-COOH (SEQ ID No. 987) ,Ac- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 988) ,C8- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 989) ,C10- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 990) ,C12- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 991) ,C14- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 992) ,C16- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 993) ,C18- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 994) ,C20- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 995) ,C22- (DPro-Arg-Arg) 5-COOH (SEQ ID No. 996) ,Ac- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 997) ,C8- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 998) ,C10- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 999) ,C12- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1000) ,C14- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1001) ,C16- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1002) ,C18- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1003) ,C20- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1004) ,C22- (DPro-Arg-Arg) 4-COOH (SEQ ID No. 1005) ,Ac- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1006) ,C8- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1007) ,C10- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1008) ,C12- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1009) ,C14- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1010) ,C16- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1011) ,C18- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1012) ,C20- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1013) ,C22- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1014) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1015) , C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1016) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1017) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1018) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1019) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1020) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1021) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1022) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1023) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1024) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1025) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1026) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1027) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1028) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1029) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1030) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1031) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1032) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1033) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1034) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1035) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1036) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1037) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1038) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1039) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-CONH2 (SEQ ID No. 1040) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1041) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1042) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1043) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1044) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1045) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1046) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1047) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1048) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1049) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1050) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1051) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1052) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1053) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1054) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1055) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1056) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1057) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1058) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1059) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1060) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1061) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1062) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1063) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1064) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1065) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-CONH2 (SEQ ID No. 1066) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1067) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1068) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1069) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1070) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1071) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1072) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1073) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1074) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1075) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1076) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1077) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1078) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1079) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1080) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1081) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1082) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-CONH2 (NLS2-pRR5) (SEQ ID No. 1083) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1084) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1085) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1086) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1087) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1088) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1089) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1090) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1091) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-CONH2 (SEQ ID No. 1092) ,Ac- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1093) ,C8- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1094) ,C10- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1095) ,C12- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1096) ,C14- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1097) ,C16- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1098) ,C18- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1099) ,C20- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1100) ,C22- (DPro-Arg-Arg) 3-Cys-COOH (SEQ ID No. 1101) ,Ac- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1102) ,C8- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1103) ,C10- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1104) ,C12- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1105) ,C14- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1106) ,C16- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1107) ,C18- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1108) ,C20- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1109) ,C22- (DPro-Arg-Arg) 5-Cys-COOH (SEQ ID No. 1110) ,Ac- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1111) ,C8- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1112) ,C10- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1113) ,C12- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1114) ,C14- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1115) ,C16- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1116) ,C18- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1117) ,C20- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1118) ,C22- (DPro-Arg-Arg) 4-Cys-COOH (SEQ ID No. 1119) ,Ac- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1120) ,C8- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1121) ,C10- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1122) ,C12- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1123) ,C14- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1124) ,C16- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1125) ,C18- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1126) ,C20- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1127) ,C22- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1128) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1129) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1130) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1131) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1132) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1133) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1134) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1135) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1136) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1137) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1138) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1139) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1140) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1141) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1142) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1143) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1144) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1145) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1146) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1147) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1148) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1149) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1150) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1151) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1152) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1153) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 3-Cys-CONH2 (SEQ ID No. 1154) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1155) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1156) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1157) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1158) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1159) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1160) ,C20-CysPro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1161) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1162) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1163) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1164) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1165) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1166) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1167) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1168) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1169) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1170) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1171) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1172) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1173) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1174) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1175) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1176) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1177) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1178) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1179) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 4-Cys-CONH2 (SEQ ID No. 1180) ,Ac-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1181) ,C8-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1182) ,C10-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1183) ,C12-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1184) ,C14-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1185) ,C18-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1186) ,C20-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1187) ,C22-Pro-Lys-Lys-Lys-Arg-Lys-Val- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1188) ,Ac-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1189) ,C8-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1190) ,C10-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1191) ,C12-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1192) ,C14-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1193) ,C16-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1194) ,C18-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1195) ,C20-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1196) ,C22-Pro-Lys-Leu-Lys-Arg-Gln- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1197) ,Ac-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1198) ,C8-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1199) ,C10-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1200) ,C12-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1201) ,C14-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1202) ,C16-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1203) ,C18-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1204) ,C20-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1205) ,C22-Pro-Ala-Ala-Lys-Arg-Val-Lys-Leu-Asp- (DPro-Arg-Arg) 5-Cys-CONH2 (SEQ ID No. 1206) .preferably, the peptide is selected from the group comprising:Ac-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 346) ,C8-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 347) ,C10-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 348) ,C12-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 349) ,C14-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 350) ,C16-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 351) ,C18-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 352) ,C20-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 353) ,C22-Cys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 354) ,Ac-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 355) ,C8-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 356) ,C10-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 357) ,C12-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 358) ,C14-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 359) ,C16-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 360) ,C18-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 361) ,C20-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 362) ,C22-Lys- (DPro-Arg-DArg) 3-COOH (SEQ ID No. 363) ,Ac-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 574) ,C8-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 575) ,C10-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 576) ,C12-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 577) ,C14-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 578) ,C16-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 579) ,C18-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 580) ,C20-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 581) ,C22-Cys- (DPro-Arg-DArg) 3-Cys-COOH, (SEQ ID No. 582) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the PP is oligo-arginine or oligo-arginine-analog implanted with the spacer in such a way that the spacer and the oligo-arginine or oligo-arginine-analog collectively form the same or different unit structures of (X1X2X3) , wherein 1 in X1, X2 and X3 is the spacer and the other 2 are the residues of the oligo-arginine or oligo-arginine-analog, and the spacer consists of 1 residue.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 51, wherein the residue of the spacer is preferably tryptophan.The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to claim 51, wherein the peptide has the following structure of Formula II:R11-W1-PP-R12 (Formula II)wherein R11 is a fatty acid modification or acetyl modification, R12 is NH2, W1 is Cys or Lys, and the PP is the same as defined in claim 51; and wherein W1 is connected to the linker;preferably, the peptide is selected from the group comprising:C18-Cys-Arg-Arg-Trp-Trp-Arg-Arg-Trp-Arg-Arg-CONH2 (SEQ ID No. 688) ,C18-Arg-Arg-Trp-Trp-Arg-Arg-Trp-Arg-Arg-CONH2 (SEQ ID No. 1207) ,Ac-Cys-Arg-Arg-Arg-Arg-Trp-NH2 (SEQ ID No. 1223) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 20, wherein the peptide is selected from the group comprising:Ac-Cys-Trp-Arg-Arg-Arg-Arg-Arg-Arg-Trp-NH2 (SEQ ID No. 1214) ,Ac-Cys-Arg-Trp-Arg-Trp-Arg-NH2 (SEQ ID No. 1215) ,Ac-Cys-Arg-Phe-Arg-Phe-Arg-Phe-Arg-NH2 (SEQ ID No. 1216) ,Ac-Cys-Arg-Leu-Arg-Leu-Arg-Leu-Arg-NH2 (SEQ ID No. 1217) ,Ac-Cys-Arg-Arg-Arg-Arg-Trp-Trp-NH2 (SEQ ID No. 1218) ,Ac-Cys-Arg-Lys-Lys-Arg-Arg-Gln-Arg-NH2 (SEQ ID No. 1219) ,Ac-Cys-Arg-Lys-Arg-Lys-Arg-Lys-NH2 (SEQ ID No. 1220) ,Ac-Cys-Leu-Ile-Ile-Leu-Arg-Arg-Arg-Ile-Arg-NH2 (SEQ ID No. 1221) ,Ac-Cys-Arg-Gln-Ile-Lys-Ile-Trp-Phe-NH2 (SEQ ID No. 1222) .The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is 5-fluorouracil (5-FU) , and the conjugate is preferably selected from:The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Argireline, and the conjugate is preferably selected from:The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Benzocaine, and the conjugate is preferably selected from:The conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Ceramide, and the conjugate is preferably selected from:The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Finasteride, and the conjugate is preferably selected from:The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Minoxidil, and the conjugate is preferably selected from:The conjugate or pharmaceutically acceptable salt or cosmetically acceptable salt thereof according to any one of claims 1 to 54, wherein the payload is Tranexamic acid, and the conjugate is preferably selected from:A pharmaceutical composition comprising the conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 61, and a pharmaceutical excipient,preferably the pharmaceutical composition is selected from the group comprising ointment, cream, solution, tincture, gel, spray, powder, foam, spirit, powder, lotion, oil, emulsion, suspension, paste, film, and aerosol.A cosmetic composition comprising the conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 61,preferably, the cosmetic composition is selected from the group comprising skin lotion, milk lotion, nourishing cream, massage cream, essence, eye cream, cleansing cream, cleansing foam, cleansing water, pack, spray, powder, hair tonic, hair cream, hair lotion, hair shampoo, hair rinse, hair conditioner, hair spray, hair aerosol, pomade, sol-gel, emulsion, oil, wax and aerosol.The conjugate or pharmaceutically acceptable salt thereof according to any one of claims 1 to 61 or the pharmaceutical composition according to claim 62 for use in the treatment of a disease.The conjugate or pharmaceutically acceptable salt thereof or pharmaceutical composition for use according to claim 64, wherein the disease is preferably androgenetic alopecia.The conjugate or pharmaceutically acceptable salt thereof according to any one of claims 1 to 61 or the pharmaceutical composition according to claim 62 for use in anesthesia.The conjugate or cosmetically acceptable salt thereof according to any one of claims 1 to 61 or the cosmetic composition according to claim 63 for use in anti-ageing or cosmetic application.Use of the conjugate or pharmaceutically acceptable salt thereof according to any one of claims 1 to 61 or the pharmaceutical composition according to claim 63 for the manufacture of a medicament for the treatment of a disease.The use according to claim 68, wherein the disease is preferably androgenetic alopecia.Use of the conjugate or pharmaceutically acceptable salt thereof according to any one of claims 1 to 61 or the pharmaceutical composition according to claim 62 for the manufacture of a medicament for anesthesia.Use of the conjugate or cosmetically acceptable salt thereof according to any one of claims 1 to 61 or the cosmetic composition according to claim 63 for the manufacture of an anti-ageing agent or a cosmetic,preferably, the function of the anti-ageing agent or the cosmetic is at least one function chosen from rejuvenating and repairing damage to skin, promoting collagen biosynthesis in skin, treating hyperpigmentation of skin, treating a skin condition, increasing permeation of a chemical denervation agent through skin, treating rhytides caused by muscular contraction, treating a fungal infection, treating onychomycosis;preferably, the skin condition is at least one condition chosen from acne, actinic damage, dandruff, eczema, fine lines, psoriasis, warts and wrinkles.A method for treating a disease, comprising administering the conjugate or pharmaceutically acceptable salt thereof according to any one of claims 1 to 61 or the pharmaceutical composition according to claim 62 to a subject in need thereof.The method according to claim 72, wherein the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition is topically administered to the subject.The method according to claim 73, wherein the conjugate or pharmaceutically acceptable salt thereof or the pharmaceutical composition topically administered to the skin or mucosa of the subject.A method for treating skin comprising: applying the conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 61 or the cosmetic composition according to claim 63 to the skin of a subject in need thereof; preferably, the conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 61 or the cosmetic composition according to claim 63 is topically administered to the skin of the subject;preferably, the conjugate or pharmaceutically / cosmetically acceptable salt thereof according to any one of claims 1 to 61 or the cosmetic composition according to claim 63 topically administered to the skin or mucosa of the skin of the subject; preferably, the skin is aged (either intrinsic or extrinsic) skin, xerosis of the skin, dry skin, wrinkles or other imperfections in the skin caused by aging or muscular contraction, irregular pigmentation or lightening of the skin, fungal infections of the skin, and pain in the skin caused by external factors such as insect bites or burns;preferably, the method exhibits at least one effect chosen from anti-aging, skin hydration, skin protection, skin brightening, skin whitening, reducing wrinkles or melasma, rejuvenating and repairing skin damage, promoting collagen biosynthesis in skin, treating hyperpigmentation, treating skin conditions, increasing permeation of chemical denervation agents through skin, treating rhytides caused by muscular contraction, treating fungal infections, treating onychomycosis, as well as anti-cellulite, deodorant, anti-perspirant, nail care, and hair care uses;preferably, the skin condition is at least one condition chosen from acne, actinic damage, dandruff, eczema, fine lines, psoriasis, warts and wrinkles.