Dehydrogenase replacement enzyme compositions and methods of use

Abstract

Disclosed are pharmaceutical compositions comprising an active agent that is an isolated polypeptide, or a modified form thereof, exhibiting dehydrogenase activity toward alcohols, aldehydes, or both. The active agent comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 1 (Class IV alcohol dehydrogenase, ADH7) or SEQ ID NO: 2 (mitochondrial aldehyde dehydrogenase 2, ALDH2). Modified forms include fusion polypeptides and polypeptides conjugated to half-life extension moieties (PEG, Fc, albumin, fatty acid) or tissue-targeting moieties (cell-penetrating peptides, receptor ligands, antibody fragments, homing peptides). The compositions optionally further comprise an enhancer (e.g., NAD+, NAD+ analogs, Nbenzylbenzamide allosteric activators, zinc, NADase inhibitors, activating peptides) and / or a dispersant (soluble hyaluronidase) for subcutaneous delivery. Also disclosed are methods of treating pathological accumulation of alcohols and aldehydes, including in subjects with ALDH2 deficiency, mRNA-lipid nanoparticle formulations, expression vectors, host cells, production methods, and kits.

Description

DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEINTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT)DESCRIPTION DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONS AND METHODS OF USECROSS REFERENCE TO RELATED APPLICATIONS

[0000] This application claims the benefit of priority of US Provision Application NO. 63 / 779,561 entitled “Dehydrogenase Replacement Enzyme Compositions and Methods Of Use” and filed on March 28, 2025. The contents of this application are incorporated by reference into the application in its entirety.TECHNICAL FIELD

[0001] The present invention relates generally to the fields of biochemistry, biomedical sciences, and enzyme replacement therapies. Particularly, the present invention relates to pharmaceutical compositions comprising isolated polypeptides having dehydrogenase activity towards alcohols, aldehydes, or both, and to modified forms thereof; to methods of treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject; to nucleic acid molecules, expression vectors, and recombinant host cells useful in the production of such polypeptides; and to kits comprising said pharmaceutical compositions.BACKGROUND ARTDehydrogenases and Their Role in Human Metabolism

[0002] Dehydrogenases are oxidoreductases found in organisms across all domains of life that catalyze oxidation-reduction reactions central to metabolic homeostasis. TheseDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEenzymes convert cognate substrates into end products through the removal of hydrogen atoms (oxidation), which are subsequently transferred to electron acceptors or cofactors (reduction) such as nicotinamide adenine dinucleotide (NAD+) or nicotinamide adenine dinucleotide phosphate (NADP+). In humans, alcohol dehydrogenases (ADH; EC 1.1.1.1 ) and aldehyde dehydrogenases (ALDH; EC 1.2.1.3) constitute large superfamilies of zinc-dependent and NAD+-dependent oxidoreductases, respectively, that serve indispensable roles in the metabolism and detoxification of endogenous and exogenous alcohols and aldehydes (see FIG. 1)

[0003] The human ADH superfamily comprises seven genes (ADH1A, ADH1B, ADH1C, ADH4, ADH5, ADH6, and ADH7) organized in five classes (I through V) on chromosome 4q23. These enzymes are expressed in a tissue-specific manner and display distinct substrate specificities and kinetic properties. The human ALDH superfamily is significantly larger, comprising nineteen functional genes distributed across multiple chromosomes, with ALDH2 (mitochondrial) and ALDH1A1 (cytosolic) serving as the principal enzymes responsible for acetaldehyde catabolism. Together, the ADH and ALDH enzyme families provide a layered, redundant defense against alcohol and aldehyde toxicities; an evolutionary adaptation that reflects the pervasiveness of these compounds in the biological environment.

[0004] The enzymatic activities of multiple ADH and ALDH isozymes are indispensable for human health, serving as regulatory and protective mechanisms against harmful endogenous and exogenous substrate exposure and accumulation. Systemic elimination of various alcohols and aldehydes is vital, as both transient and prolonged exposure have been linked to acute negative physiological manifestations and the development of chronic conditions. The protective roles of ADH and ALDH enzymes are highly relevant in modern society given the ubiquity of alcohols and aldehydes in food, fermented beverages, and industrial products. These include simple alcohols and aldehydes such as ethanol and acetaldehyde associated with alcoholic beverages, and methanol and formaldehyde found in common industrial processes.The Ethanol Metabolism PathwayDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0005] Ethanol is a water-soluble, low-molecular-weight compound that readily distributes across cell membranes and tissues. After oral ingestion, ethanol is absorbed primarily via intestinal passive diffusion, with peak blood levels typically reached within 30 to 90 minutes depending on feeding state, rate of consumption, and individual physiology. Although ethanol metabolism is complex and involves multiple organs, the liver is the principal metabolic site, accounting for approximately 80% of total systemic ethanol elimination.

[0006] In the liver, ethanol undergoes a two-step enzymatic oxidation scheme. In the first step, alcohol dehydrogenases (ADH) catalyze the NAD+-dependent oxidation of ethanol to acetaldehyde (see FIG. 1). In the second step, aldehyde dehydrogenases (ALDH) catalyze the NAD+-dependent oxidation of acetaldehyde to acetate. Both ADH and ALDH catalyze their respective reactions through an ordered bi-bi (Theorell-Chance) kinetic mechanism in which NAD+binds first to the enzyme active site, inducing a catalytically active conformation and forming a binary enzyme-NAD+complex, after which the alcohol or aldehyde substrate binds and undergoes hydride transfer, followed by dissociation of the reduced cofactor NADH. (see FIG. 2). This obligate ordered mechanism dictates that catalytic turnover is absolutely dependent on the availability of free NAD+at the enzyme active site; in the absence of sufficient NAD+, neither ADH nor ALDH can initiate a catalytic cycle irrespective of substrate concentration. Acetate is then released from the liver into systemic circulation and taken up by peripheral tissues, where it is converted to acetyl-CoA and enters the tricarboxylic acid (TCA) cycle for energy production or is channeled into lipid biosynthetic pathways.

[0007] In humans, five known classes of ADH enzymes, comprising multiple isozymes and polymorphic variants, catalyze the critical first step of ethanol oxidation to acetaldehyde. This enzymatic redundancy represents an evolutionary adaptation that confers a layered defense — both presystemic and systemic — against ethanol toxicity. Class IV ADH (ADH7), primarily expressed in the gastric mucosa and esophageal epithelium, supports presystemic first-pass metabolism that reduces ethanol exposure prior to intestinal absorption. In the liver, Class I ADH enzymes (ADH1A, ADH1B, ADH1C) account for the majority of systemic ethanol oxidation (see FIG. 3).DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONS AND METHODS OF USE

[0008] The kinetic properties of the ADH isozymes have critical clinical implications. Class I hepatic ADH enzymes operate with high affinity for ethanol but display saturable kinetics at clinically elevated ethanol concentrations. Specifically, ADH1B*1 has a Michaelis constant (Km) for ethanol of approximately 0.05 mM, ADH1 A has a Km of approximately 0.67 mM, and ADH1B*2 (a common East Asian variant) has a Km of approximately 0.9 mM. These enzymes reach maximal catalytic velocity (Vmax) at blood alcohol concentrations (BAC) well below the legal intoxication threshold. For example, ADH1 B*1 is essentially saturated at BAC of approximately 4.6 mg / dL (approximately 1 mM), a level reached after ingestion of less than one standard alcoholic drink. At a BAC corresponding to the legal intoxication limit of 80mg / dL (approximately 17.4 mM), major Class I ADH isozymes operate at or near their maximal velocity, resulting in zero-order elimination kinetics at a constant rate of approximately 15 to 20 mg / dL per hour (approximately 3.3 to 4.4 mM per hour).

[0009] Table 1 summarizes the kinetic properties of human ADH classes and isozymes, illustrating the wide variation in ethanol affinity and catalytic turnover rate across classes.Class Gene Km(ethanol) kcat Primary Tissue mM (min-1) DistributionI ADH1A / 1B / 1C 0.05-4 30-400 LiverII ADH4 30 20 LiverIII ADH5 >1,000 100 UbiquitousIV ADH7 25-37 1,510 Stomach, esophagusV ADH6 Unknown Unknown Liver (mRNA only)Table 1. Kinetic Properties of Human ADH Isozymes for Ethanol. Modified from Fames et al. 1994 [NPL1]; Yokoyama et al. 1995 [NPL2]; Eden berg 2007 [NPL3].

[0010] In contrast, Class IV ADH (ADH7) possesses a substantially higher Km for ethanol of approximately 25 to 37 mM with a catalytic turnover rate (kcat) ofDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONS AND METHODS OF USEapproximately 1 ,510 per minute. This high Km allows ADH7 to remain in the linear (unsaturated) kinetic range even at severely intoxicating and potentially lethal blood ethanol concentrations. At a life-threatening BAC of 200mg / dL (approximately 44mM), ADH7 operates at approximately half (54%) of its maximal velocity, and its catalytic rate continues to increase proportionally with ethanol concentration. These kinetic properties position ADH7 as a uniquely suitable therapeutic enzyme for augmenting ethanol metabolism at pathological concentrations where the predominant hepatic Class I ADH enzymes are fully saturated and unable to increase their metabolic rate.

[0011] Table 2 presents a reference of blood alcohol concentration (BAC) levels encountered in clinical practice, together with the associated clinical manifestations and the calculated saturation (%Vmax) of ADH7 (SEQ ID NO: 1) at each concentration based on Michaelis-Menten kinetics (Km 25 to 37 mM). As shown, ADH7 remains well below its maximal catalytic velocity across the entire pathological range, from the legal intoxication limit in the United States through potentially lethal concentrations. This is in marked contrast to Class I ADH isozymes that are essentially fully saturated (greater than 99% Vmax) at all concentrations above approximately 10 mM.BAC % BAC BAC Clinical Effects Severity ADH1 SEQ ID NO: (g / dL) (mg / dL) (mM) Saturation 1 (ADH7)Saturation (%Vmax)(%Vmax)0.05 50 11 Reduced Mild >99% 21-30% inhibition,impaired finemotor control0.08* 80* 17* *Legal intoxication Moderate >99% 30-41% limit; impairedcoordinationDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONS AND METHODS OF USEBAC % BAC BAC Clinical Effects Severity ADH1 SEQ ID NO: (g / dL) (mg / dL) (mM) Saturation 1 (ADH7)Saturation (%Vmax)(%Vmax)0.10 100 22 Slurred speech, Moderate- >99% 35-46% impaired reaction Severetime0.15 150 33 Nausea, vomiting, Severe >99% 44-57% loss of balance,blackouts0.20 200 44 Confusion, Life>99% 51-64% disorientation, threateningstaggering0.30 300 65 Stupor, loss of Potentially >99% 61-72% consciousness, Lethalsevere poisoning>0.40 400 87 Coma, respiratory Lethal >99% >68-78% depressionTable 2. Blood Alcohol Concentration (BAC) Levels, Associated Clinical Effects, and Calculated Saturation of ADH Isozymes. BAC 0.08% is the U.S. legal intoxication threshold. Class I ADH saturation based on ADH1B*1 Km = 0.05 mM. ADH7 saturation (° / 0Vmax) calculated as [EtOH] / (Km + [EtOH]) where Km = 25-37mM. Sources:StatPearls, Ethanol Toxicity (NBK557381);Farres et al. 1994 [NPL1]; Yokoyama et al. 1995 [NPL2];Edenberg 2007 [NPL3].

[0012] Because the capacity of the principal hepatic Class I ADH pathway is limited by saturation kinetics, overall ethanol metabolism in most acute intoxication scenarios proceeds at a constant rate corresponding to a decline of 15 to 20 mg / dL in BAC perDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEhour. However, these rates vary three- to four-fold among individuals and are influenced by genetics (e.g., ADH and ALDH polymorphisms, expression regulation), physiology (e.g., sex, body weight, age, feeding state), drug inhibition (e.g., cimetidine, aspirin), and comorbidities (e.g., liver disease). In the majority of individuals — except those with ALDH2 dysfunction (approximately 8% of the world population) — the capacity for aldehyde removal exceeds the rate of acetaldehyde generation, owing in large part to the remarkably low Km of mitochondrial ALDH2 for acetaldehyde (approximately 0.2 pM), which ensures that the enzyme operates at near-maximal catalytic velocity even at trace substrate concentrations. Consequently, Class I ADH-mediated oxidation of ethanol to acetaldehyde represents the principal rate-limiting step in ethanol metabolism, slowing ethanol clearance and prolonging the duration of intoxication following heavy alcohol consumption. In addition to ADH and ALDH, competing NAD+-consuming pathways — including the malate-aspartate shuttle, fatty acid oxidation, and the TCA cycle — further draw on the NAD+pool during ethanol metabolism; collectively, this demand progressively depletes the free NAD+available to support continued enzymatic turnover. This cofactor depletion is further compounded by extracellular NADases, particularly CD38, which rapidly catabolize NAD+in the extracellular, interstitial, and plasma compartments — where free NAD+concentrations are estimated at only 0.1-0.5 pM (Camacho-Pereira et al. 2016 [NPL4]).Alternative Oxidative and Non-Oxidative Ethanol Metabolic Pathways

[0013] As Class I ADH enzymes become saturated at elevated ethanol concentrations, excess ethanol is diverted to alternative oxidative and non-oxidative metabolic pathways that produce harmful byproducts (see FIG. 3). The microsomal ethanol oxidizing system (MEOS), catalyzed primarily by cytochrome P4502E1 (CYP2E1) in the hepatic endoplasmic reticulum, has a Km for ethanol of approximately 10 mM and becomes increasingly active at concentrations above the saturation threshold of Class I ADH. While CYP2E1 also oxidizes ethanol to acetaldehyde, it simultaneously generates reactive oxygen species (ROS) including superoxide anion, hydrogen peroxide, and hydroxyl radicals, as well as hydroxyethyl radicals, which contribute to oxidative stress, lipid peroxidation, and hepatocellular damage.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0014] Furthermore, under ethanol saturation conditions, non-oxidative ethanol metabolism proceeds through conjugation pathways that also produce potentially toxic metabolites. Fatty acid ethyl ester (FAEE) synthase catalyzes the conjugation of excess ethanol with common endogenous lipids such as palmitate, oleate, and stearate to form fatty acid ethyl esters. These FAEEs persist in tissues for at least 24 hours after ethanol exposure and are known mediators of hepatic and pancreatic injury by inducing endoplasmic reticulum stress, disrupting membrane integrity, and impairing mitochondrial function (see FIG. 3). Similarly, Phospholipase D catalyzes the formation of phosphatidylethanol (PEth), which accumulates in cell membranes and can be detected for up to 28 days following ethanol exposure. These non-oxidative metabolites serve as long-lasting biomarkers of ethanol exposure and contribute to organ-specific toxicities, particularly in the pancreas and heart. Accordingly, enhancement of the primary oxidative ADH-ALDH pathway through exogenous enzyme supplementation would be expected to reduce diversion of ethanol to these harmful alternative pathways and suppress the formation of corresponding toxic metabolites, and mitigate the risk of organ damage.Acetaldehyde and Formaldehyde Toxicity

[0015] Acetaldehyde (a direct ethanol metabolite) and formaldehyde are low-molecular-weight aldehydes classified by the International Agency for Research on Cancer (IARC) as Group 1 carcinogens — compounds for which there is sufficient evidence of carcinogenicity in humans. These aldehydes arise both endogenously, as byproducts of normal cellular metabolism (e.g., demethylation reactions, lipid peroxidation, amino acid catabolism), and exogenously, as constituents of food (e.g., ripe fruits, coffee, fermented beverages), tobacco smoke, and industrial emissions.

[0016] Both acetaldehyde and formaldehyde are highly reactive electrophilic compounds capable of damaging DNA through multiple mechanisms, including formation of interstrand crosslinks (ICLs), covalent DNA adducts (e.g., N2-ethylidene-deoxyguanosine, N2-ethyl-deoxyguanosine, propano-deoxyguanosine cyclic adducts), and DNA-protein crosslinks (DPCs). The water solubility and relatively long half-lives of these aldehydes allow them to diffuse widely and exert genotoxic effects distal to theirDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEsite of formation, causing mutations, chromosomal aberrations, and sister chromatid exchanges — ultimately contributing to malignant transformation, apoptosis, and disease.

[0017] In addition to their genotoxic effects, acetaldehyde and formaldehyde form adducts with cellular proteins, altering protein function and triggering inflammatory responses. Acetaldehyde-protein adducts in hepatic stellate cells stimulate collagen synthesis and promote hepatic fibrosis. Malondialdehyde-acetaldehyde (MAA) adducts act as neo-antigens, provoking immune responses that contribute to alcoholic liver disease. Lipid peroxidation-derived aldehydes including 4-hydroxynonenal (4-HNE), malondialdehyde (MDA), and acrolein further amplify oxidative damage and have been implicated in cardiovascular disease, neurodegenerative disorders, and metabolic syndrome.

[0018] In humans, ALDH1A1 (cytosolic), ALDH2 (mitochondrial), and ADH5 (also known as formaldehyde dehydrogenase or S-nitrosoglutathione reductase) are the principal enzymes responsible for the detoxification of acetaldehyde and formaldehyde. Among these, mitochondrially-localized ALDH2 is the most catalytically efficient enzyme for acetaldehyde catabolism, with a Km for acetaldehyde of approximately 0.2 pM — approximately 900-fold lower than that of cytosolic ALDH1 A1. While ALDH2 is best known for its role in acetaldehyde catabolism, it also degrades formaldehyde, 4-HNE, MDA, and acrolein, making it a broad-spectrum aldehyde detoxification enzyme and a suitable candidate for therapeutic application.ALDH2 Deficiency: Prevalence, Mechanism, and Disease Associations

[0019] ALDH2 deficiency is one of the most common hereditary enzyme deficiencies in the human population, affecting approximately 35% to 40% of individuals of East Asian descent (Chen et al. 2014 [NPL5]) — including Chinese, Japanese, Korean, and Vietnamese populations — and approximately 8% of the global population, representing an estimated 540 million individuals worldwide. The predominant genetic basis is the ALDH2*2 allele (rs671; Glu487Lys or E487K), a single nucleotide polymorphism in exon 12 that results in substitution of a glutamate residue with lysine at position 487 of theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEmature polypeptide, located at a critical interface in the oligomerization domain of the ALDH2 homotetramer.

[0020] The E487K substitution exerts a dominant-negative effect on the ALDH2 tetramer. Because functional ALDH2 operates as a homotetramer, incorporation of even one ALDH2*2 subunit into the tetrameric assembly disrupts the NAD+ binding geometry and catalytic efficiency of adjacent wild-type subunits. The ALDH2*2 mutant enzyme exhibits an approximately 200-fold increase in Km for NAD+ and an approximately 10-fold reduction in kcat relative to the wild-type enzyme. As a consequence, individuals heterozygous for the ALDH2*2 allele retain only approximately 10% to 45% of normal ALDH2 enzymatic activity, while homozygous ALDH2*2 / *2 individuals retain only approximately 1 % to 5% of normal activity.

[0021] Individuals carrying the ALDH2*2 allele accumulate toxic acetaldehyde following ethanol consumption, leading to the characteristic alcohol flush reaction (also termed "Asian flush syndrome"), manifesting as facial flushing, tachycardia, nausea, headache, and general dysphoria (Brooks et al. 2009 [NPL6]). Pharmacogenetic studies have demonstrated that following a moderate ethanol intake of 0.5 g / kg, heterozygous ALDH2*1 / *2 individuals reach peak blood acetaldehyde concentrations of approximately 76 pM, whereas homozygous ALDH2*2 / *2 individuals reach comparable peak concentrations of approximately 75 pM after ingesting only 0.2 g / kg ethanol — a 2.5-fold lower dose — reflecting the more severely impaired acetaldehyde clearance in variant homozygotes. At matched ethanol doses, homozygous ALDH2*2 / *2 individuals exhibit 1.6- to3.3-fold higher peak blood acetaldehyde concentrations than heterozygotes. Both genotypes produce levels that are 5- to 20-fold higher than those observed in normal ALDH2*1 / *1 homozygotes, in whom circulating acetaldehyde remains near or below the limit of detection under comparable conditions. Beyond these acute symptoms, ALDH2 deficiency and the resulting chronic acetaldehyde and endogenous formaldehyde accumulation have been associated with a significantly increased risk for a broad spectrum of pathological conditions. Epidemiological studies have demonstrated that ALDH2-deficient individuals who consume alcohol have a 2- to 12-fold increased risk for esophageal squamous cell carcinoma, and elevated risks for oropharyngeal cancer, gastric cancer, hepatocellular carcinoma, and colorectal cancer. ALDH2 deficiency hasDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEfurther been associated with increased risk of cardiovascular diseases including coronary artery disease, hypertension, and impaired nitroglycerin bioactivation; neurodegenerative diseases including Alzheimer's disease; hematologic disorders including Fanconi anemia and bone marrow failure syndromes; and metabolic bone disease including osteoporosis.

[0022] ALDH2 deficiency has particular significance in the context of Fanconi anemia, a rare inherited disorder (affecting approximately 1 in 100,000 to 160,000 individuals) caused by defects in DNA interstrand crosslink (ICL) repair genes, resulting in progressive bone marrow failure, developmental abnormalities, and elevated predisposition to myeloid and squamous cell malignancies. Recent studies have demonstrated that detoxifying enzymes such as ALDH2 constitute a direct protective mechanism that removes genotoxic aldehydes (acetaldehyde and formaldehyde)to prevent formation of DNA ICLs, covalent DNA adducts, and DNA-protein crosslinks (Langevin et al. 2011 [NPL7]). This enzymatic protective layercomplements the Fanconi Pathway which is responsible for repairing residual DNA lesions. Both formaldehyde and acetaldehyde are IARC Group 1 carcinogens that arise endogenously from cellular metabolism (demethylation, lipid peroxidation) and exogenously from dietary and environmental sources, and their relatively long half-lives allow diffusion and genotoxic damage far from the point of origin. In individuals with concurrent ALDH2 deficiency and Fanconi Pathway mutations, the loss of both protective layers leads to accelerated DNA damage accumulation and hematopoietic failure. Critically, no approved therapies for Fanconi anemia address the underlying sources of aldehyde-mediated genotoxicity; current treatment is limited to symptomatic management with anabolic steroids, hematopoietic growth factors, blood transfusions, and hematopoietic stem cell transplantation, none of which reduce the genotoxic aldehyde burden. Accordingly, parenteral administration of recombinant ALDH2 to directly augment aldehyde detoxification capacity represents a novel therapeutic approach that would address the basis of aldehyde-mediated DNA damage in Fanconi anemia patients with ALDH2 deficiency.

[0023] Current treatment strategies for conditions associated with alcohol or aldehyde accumulation remain limited. Existing therapeutic modalities fall into several categoriesDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEsuch as enzyme inhibitors, small molecule modulators, gene therapy, oral enzyme preparations, recombinant ALDH2 monotherapy, enzyme-cofactor booster preparations, and nanocapsule enzyme delivery systems, each possessing drawbacks that underscore the need for a novel, comprehensive approach.Enzyme Inhibitors: Fomepizole and Disulfiram

[0024] Fomepizole (4-methylpyrazole; marketed as Antizol) is a competitive inhibitor of alcohol dehydrogenase approved for the treatment of methanol and ethylene glycol poisoning. Fomepizole binds to the catalytic site of ADH with approximately 8,000-fold greater affinity than ethanol, effectively blocking the conversion of methanol and ethylene glycol to their toxic metabolites (formic acid and glycolic acid / oxalic acid, respectively). However, fomepizole operates by inhibiting rather than enhancing alcohol metabolism, resulting in prolonged persistence of the parent toxic alcohol in the circulation. Fomepizole is not applicable to conditions of ethanol toxicity, does not address aldehyde accumulation, and does not augment the body's metabolic capacity.

[0025] Disulfiram (marketed as Antabuse) is an irreversible inhibitor of ALDH1A1 and ALDH2 used as an aversion therapy for alcohol use disorder. Disulfiram deliberately causes accumulation of toxic acetaldehyde following ethanol ingestion, producing an unpleasant disulfiram-ethanol reaction (DER) intended to deter alcohol consumption. The therapeutic goal of disulfiram is thus diametrically opposed to that of the present invention. Furthermore, disulfiram is associated with significant adverse effects including hepatotoxicity, peripheral neuropathy, psychosis, and optic neuritis, and carries a contraindication in patients with significant hepatic impairment. Disulfiram has no role in the treatment of alcohol or aldehyde toxicity and does not provide enzymatic supplementation.Small Molecule ALDH2 Activators and Enzyme Inducers

[0026] Small molecule allosteric activators of ALDH2, exemplified by the N-benzylbenzamide compound ALDA-1 (N-(1,3-benzodioxol-5-ylmethyl)-2,6-dichlorobenzamide; described in Mochly-Rosen, U.S. Patent No. 9,370,506 B2), have been identified that can increase the catalytic activity of both wild-type ALDH2 and theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEALDH2*2 mutant enzyme. ALDA-1 binds within the substrate access tunnel of ALDH2 and acts as a chemical chaperone, stabilizing the active site conformation. While ALDA-1 has shown promise in preclinical models of ischemia-reperfusion injury, it possesses several fundamental limitations as a therapeutic approach for dehydrogenase deficiencies. First, ALDA-1 requires the presence of residual endogenous ALDH2 enzyme as a target; in ALDH2*2 homozygous individuals with less than 5% residual activity, the absolute increase in catalytic capacity achievable through allosteric activation is inherently limited. Second, ALDA-1 does not address deficiencies or saturation of alcohol dehydrogenase (ADH), which constitutes the primary rate-limiting step in ethanol metabolism.

[0027] Alternative approaches using Nrf2 / ARE pathway inducers (e.g., sulforaphane and related isothiocyanate compounds; Talalay, U.S. Patent Application Publication No.2021 / 0401791) to transcriptionally upregulate endogenous ALDH expression suffer from additional limitations. Such inducers require a pre-treatment period of seven or more days to achieve meaningful transcriptional upregulation, rendering them unsuitable for acute intoxication or poisoning scenarios. Their mechanism of action is indirect and subject to a ceiling effect determined by the individual's baseline transcriptional capacity.Gene Therapy Approaches

[0028] Gene therapy strategies using adeno-associated virus (AAV) vectors to deliver functional ALDH2 transgenes have shown promise in preclinical mouse models. Stiles and colleagues (WO 2018 / 022783; U.S. Patent Application Publication No.2019 / 0160187) demonstrated that a single administration of AAVrh.10hALDH2 via intravenous or intranasal routes corrected ALDH2 deficiency in Aldh2-knockout mice, normalizing acetaldehyde levels following ethanol challenge and preventing multi-organ damage associated with chronic ethanol exposure. However, gene therapy approaches face several significant translational challenges. First, pre-existing and treatment-induced immune responses to AAV capsid proteins limit transduction efficiency and preclude re-administration in the majority of patients. Second, AAV vector integration, while rare, carries a risk of insertional mutagenesis. Third, transgene expression following AAV delivery is largely irreversible in post-mitotic tissues, precluding doseDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEtitration or cessation of therapy if adverse effects emerge. Fourth, AAV vectors exhibit serotype-dependent tissue tropism, and the liver-tropic serotypes employed in these studies (e.g., AAVrh.10), do not efficiently transduce extrahepatic tissues where aldehyde-mediated pathology is directly implicated in ischemia-reperfusion injury, neurodegeneration, and Fanconi anemia. Fifth, AAV-ALDH2 gene therapy targets only ALDH2 and does not augment ADH activity, leaving the rate-limiting first step of ethanol metabolism unresolved.Oral Enzyme Preparations

[0029] The use of animal-derived dehydrogenase enzyme preparations for the treatment of veisalgia (hangover) has been described by Wong (U.S. Patent No.11 ,208,631 B1 ), who discloses oral delivery of bovine or ovine liver-derived ADH and ALDH preparations in enteric-coated capsules at a 1 :40 ADH:ALDH molar ratio.However, because bovine and ovine liver extracts contain heterogeneous mixtures of multiple ADH and ALDH isoforms with distinct substrate specificities, kinetic parameters, and cofactor affinities, the stated molar ratio is analytically undefined in the absence of isoform-specific quantification and does not correspond to a reproducible or functionally characterized enzyme composition. Although Wong represents the earliest disclosure of a dual-enzyme (ADH plus ALDH) concept for assisted alcohol metabolism, this approach utilizes incompletely characterized enzyme preparations with significant limitations that preclude meaningful clinical translation. Oral administration of polypeptide therapeutics subjects them to the harsh proteolytic environment of the gastrointestinal tract, where gastric acid (pH 1.5-3.5) and pepsin rapidly denature and degrade proteins. Even with enteric coating, the bioavailability of functional enzyme activity in the systemic circulation is negligible, as intact protein absorption from the intestinal lumen into the bloodstream is extremely limited for macromolecules exceeding approximately 6 kDa in molecular weight. Any residual enzymatic activity is therefore confined to the gastrointestinal lumen and cannot augment aldehyde metabolism in hepatic or extrahepatic tissues. Furthermore, animal-derived enzyme preparations carry risks of immunogenic reactions due to species-specific sequence differences, contamination with animal-derived pathogens (including prion agents), and batch-to-DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEbatch variability inherent in tissue extraction processes — variability that is further compounded by the undefined isoform composition of crude liver extracts, in which the proportions of individual ADH and ALDH family members cannot be controlled or reproducibly specified. Wong's disclosure is limited to the oral, animal-derived formulation and the narrow indication of veisalgia; the patent does not address acute alcohol poisoning, methanol or formaldehyde toxicity, ALDH2 deficiency syndrome, ischemia-reperfusion aldehyde injury, aldehyde-mediated DNA damage in Fanconi anemia, neurodegenerative aldehyde accumulation, or any of the broader clinical indications for systemic aldehyde detoxification contemplated by the present invention.Oral Multi-Enzyme Systems with Cofactor Recycling

[0030] Multi-enzyme oral formulations combining alcohol dehydrogenase, aldehyde dehydrogenase, and cofactor recycling enzymes for gastrointestinal ethanol removal have been described by Whitmire (U.S. Patent No. 5,759,539). The Whitmire system combines yeast alcohol dehydrogenase (YADH), yeast aldehyde dehydrogenase (YALDH), and glycerol dehydrogenase (GDH) with dihydroxyacetone (DHA) as a substrate for enzymatic regeneration of NADH to NAD+, together with protease inhibitors, gastric acid sequestrants, and buffering agents to protect the enzymes during gastrointestinal transit. The Whitmire patent represents the earliest disclosure of an enzyme-based system that explicitly addresses cofactor limitation by incorporating an enzymatic NAD+ recycling mechanism. However, the Whitmire approach has significant limitations that distinguish it from the present invention. First, the system is designed exclusively for oral or mucosal administration and is confined to enzymatic activity within the gastrointestinal lumen; no parenteral route is disclosed, and the enzymes cannot reach the systemic circulation to augment aldehyde metabolism in hepatic or extrahepatic tissues. Second, all enzymes are of non-human origin (yeast and bacterial quinoprotein dehydrogenases), with inherent immunogenicity risks, batch variability, and no defined human polypeptide sequences or SEQ ID NOs. Third, the cofactor regeneration strategy relies on recycling the existing endogenous NAD+ / NADH pool through a third enzyme (glycerol dehydrogenase) and its substrate (dihydroxyacetone), and therefore cannot increase the total cofactor pool beyond what is already present at the site of enzymatic activity. This is a fundamental limitation for any parenteralDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEapplication, where exogenous enzyme is delivered to extracellular, interstitial, or subcutaneous compartments in which the endogenous NAD+ pool is negligibly small and cannot sustain catalytic activity regardless of recycling efficiency. In contrast, the direct co-formulation of exogenous NAD+ or NADase-resistant NAD+ analogs employed by the present invention adds new cofactor to the system, providing immediate cofactor availability at the site of action without dependence on an auxiliary enzymatic reaction or on the presence of a pre-existing endogenous cofactor pool. Fourth, the oral enzyme system is subject to the same proteolytic, pH, and bioavailability limitations described for other oral enzyme preparations: gastric acid and pepsin denaturation, limited macromolecular absorption from the intestinal lumen, and confinement of any residual enzymatic activity to the gastrointestinal tract. Fifth, the patent does not disclose dualenzyme fusion polypeptides, half-life extension moieties, tissue-targeting moieties, hyaluronidase dispersant, or mRNA-LNP formulations.Enzyme Cofactor Booster Preparations

[0031] Yen (U.S. Patent Application Publication No. 2024 / 0123039) describes compositions combining enzymes with cofactor boosters for alcohol detoxification, employing ADH and ALDH enzymes together with nicotinamide riboside (NR), nicotinamide mononucleotide (NMN), and a fructose / sorbitol-based enzymatic cofactor recycling system to enhance NAD+availability and sustain dehydrogenase catalytic activity. While this approach recognizes the importance of NAD+availability in driving dehydrogenase reactions, it relies on indirect strategies — biosynthetic precursors (NR and NMN) that require intracellular enzymatic conversion to NAD+, and an enzymatic cofactor recycling system (fructose-sorbitol dehydrogenase) — rather than direct coformulation of NAD+or its analogs with the active enzyme. This indirect approach is subject to several further limitations. First, the enzyme source is crude yeast extract rather than recombinant human protein, introducing the same batch variability, impurity, and potential immunogenicity concerns as the crude biological extract preparations described above. Second, the formulation is designed for oral prophylactic use (consumption before or after drinking), and is therefore subject to the same gastrointestinal degradation limitations described above for oral enzyme preparations.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEThird, the Yen application does not disclose defined human enzyme sequences, specific polypeptide fragments, or sequence identity thresholds. Fourth, there is no disclosure of parenteral formulation, half-life extension, tissue targeting, hyaluronidase dispersant, or mRNA-LNP formulations.Nanocapsule Enzyme Delivery Systems

[0032] Yang and colleagues (U.S. Patent Application Publication No. 2022 / 0133859) describe an enzyme nanocapsule system for alcohol intoxication, comprising polymer nanocapsules encapsulating alcohol oxidase (AOx) from Pichia pastoris, catalase (CAT) from bovine liver, and aldehyde dehydrogenase (ALDH) from Saccharomyces cerevisiae — described by the authors as a hepatocyte-mimicking antidote — for intravenous delivery to the liver. This system demonstrated a reduction in blood alcohol concentration in intoxicated mice. However, the nanocapsule system has significant limitations that distinguish it from the present invention. First, the system uses alcohol oxidase (EC 1.1.3.13) rather than alcohol dehydrogenase (ADH) for the first metabolic step. Alcohol oxidase generates hydrogen peroxide as a stoichiometric byproduct of ethanol oxidation, necessitating co-delivery of catalase to scavenge the cytotoxic peroxide — a complexity and safety concern absent from the NAD+-dependent ADH pathway employed by the present invention. Second, all three enzymes are derived from non-human sources (fungal and bovine), presenting significant barriers to clinical development as a human enzyme replacement therapy due to immunogenicity risks upon repeated administration. Third, the three-enzyme nanocapsule system requires complex polymer encapsulation through in situ polymerization and chemical crosslinking with cationic polymer shells, presenting manufacturing scalability challenges compared to conventional recombinant protein production. The cationic surface charge necessary for hepatic uptake is associated with cytotoxicity that has been well-documented in the nanoparticle literature; consistent with this, the authors reported elevated alanine aminotransferase (ALT) levels following nanocapsule administration. Fourth, the nanocapsule design delivers enzyme exclusively to hepatocytes and cannot address aldehyde accumulation in extrahepatic tissues where aldehyde-mediated pathology occurs, including in ischemia-reperfusion injury, neurodegeneration, and FanconiDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEanemia. Fifth, although the authors demonstrated that co-administration of exogenous NAD+alongside the nanocapsules improved acetaldehyde clearance by nanocapsule-encapsulated ALDH (n(ALDH)), the NAD+was administered as a separate injection rather than co-formulated within the nanocapsule system — confirming the cofactor limitation of n(ALDH) while leaving it unresolved from a pharmaceutical formulation standpoint. Sixth, the system does not employ recombinant human enzyme sequences, does not disclose defined polypeptide sequences or SEQ ID NOs, and does not include half-life extension moieties, tissue-targeting moieties, hyaluronidase dispersant, or mRNA-LNP formulations.Erythrocyte-Encapsulated Enzyme Delivery Systems

[0033] Encapsulation of dehydrogenase enzymes into erythrocytes for intravenous delivery as circulating bioreactors has been described (Magnani et al., Alcohol Alcohol.1990, 25, 627-637; Lizano et al., Biochim. Biophys. Acta 1998, 1425, 328-336).Magnani and colleagues loaded acetaldehyde dehydrogenase purified from Alcaligenes eutrophus into human erythrocytes by hypotonic hemolysis and isotonic resealing, achieving approximately 12- to 15-fold higher ALDH activity per mL of packed cells compared to native erythrocytes and demonstrating in vivo reduction of blood acetaldehyde in mice, with loaded erythrocytes circulating with a half-life of 6 to 7 days. Lizano and colleagues subsequently demonstrated co-encapsulation of both ADH and ALDH into human erythrocytes by electroporation, showing continuous in vitro ethanol degradation over 70 hours. While these studies represent the earliest demonstrations of parenteral enzyme delivery for alcohol metabolism, the erythrocyte encapsulation approach has fundamental limitations. First, the system requires donor blood collection, ex vivo electroporation or hypotonic hemolysis, enzyme loading, and reinfusion — a complex cell-processing workflow requiring specialized GMP cell-processing facilities and incompatible with emergency administration or patient self-administration. Second, the enzymes used are of non-human origin (bacterial Alcaligenes eutrophus ALDH; yeast-derived ADH), with no defined human polypeptide sequences or SEQ ID NOs. Third, because the enzyme is sequestered within the erythrocyte cytoplasm, it can only access substrates that diffuse across the red blood cell membrane, limiting its ability to detoxify aldehyde pools in the extracellular, interstitial, and tissue compartments whereDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEaldehyde-mediated damage occurs in ischemia-reperfusion injury, Fanconi anemia, and neurodegenerative conditions. Fourth, the intracellular encapsulation precludes coformulation with exogenous NAD+cofactor, relying instead on the limited endogenous NAD+pool within the erythrocyte — a particularly acute constraint given that erythrocytes lack mitochondria and cannot regenerate NAD+through oxidative phosphorylation — which becomes depleted as NADH accumulates with no recycling mechanism. Fifth, the approach does not provide for half-life extension moieties, tissuetargeting moieties, hyaluronidase dispersant, or mRNA-LNP formulations.ALDH2 Monotherapy

[0034] Katsnelson (U.S. Patent No. 10,016,489 B2) describes methods and compositions for treating toxicity resulting from ALDH2 deficiency using an exogenous ALDH2 enzyme preparation, claiming administration of ALDH2 or a composition comprising ALDH2 to reduce aldehyde toxicity in subjects with ALDH2 deficiency, including subjects with temporary deficiency (e.g., acute alcohol poisoning) and genetic ALDH2 deficiency (e.g., ALDH2*2 carriers).The patent discloses PEGylation as a halflife extension strategy and intraperitoneal injection in a rat model. However, the Katsnelson approach has several fundamental limitations. First, the patent does not disclose the source or method of production of the ALDH2 enzyme, including the expression system, host organism, purification protocol, or whether the enzyme was commercially obtained, rendering the disclosed experiments essentially non-reproducible. Second, the patent provides no enzyme characterization data such as specific activity (U / mg), kinetic parameters (Km, Vmax), purity analysis, or stability data, leaving the quality and identity of the therapeutic agent undefined. Third, the patent claims only ALDH2 and does not address the saturation of alcohol dehydrogenase (ADH) activity at clinically relevant ethanol concentrations — providing only the downstream aldehyde-catabolizing enzyme without augmenting the upstream ratelimiting ADH step leaves the fundamental metabolic bottleneck unresolved. Fourth, the patent does not disclose or claim specific polypeptide sequences, defined fragments, or sequence identity thresholds; no SEQ ID NOs are provided, leaving the scope of the claimed enzyme imprecisely defined. Fifth, the patent does not disclose co-formulationDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEwith exogenous NAD+cofactor, which is obligatory for ALDH2 catalytic activity and is severely depleted at extracellular and interstitial sites of action during heavy alcohol metabolism. Sixth, the patent does not disclose a hyaluronidase dispersant for subcutaneous delivery, limiting the practical utility for self-administration in acute and chronic management settings; although hyaluronic acid conjugation is mentioned as a surface modification for half-life extension, this is mechanistically distinct from the use of hyaluronidase to enhance subcutaneous bioavailability. Seventh, the patent does not disclose or claim a dual-enzyme fusion polypeptide, tissue-targeting moieties, or mRNA-LNP formulations. Eighth, the disclosed rat study (intraperitoneal injection of 300 U ALDH2) provides no dose-response data, no pharmacokinetic characterization, no acetaldehyde level measurements, and no quantitative efficacy measurements to support the broad dosage range of 0.001 to 5 g / kg body weight. Finally, although the patent discusses multiple modification strategies including PEGylation, Fc fusion, and albumin conjugation, none of these modifications are experimentally validated; all such modification strategies remain unvalidated by experimental data in the patent specification.Unmet Medical Need and Inventive Concept

[0035] Accordingly, despite the foregoing disclosures in the prior art, there remains a significant unmet medical need for pharmaceutical compositions and methods that can directly, systemically, and immediately augment or supplement dehydrogenase activity in subjects suffering from, or at risk for, pathological accumulation of alcohols, aldehydes, or both. No existing therapy addresses the complete two-step ethanol metabolism pathway through direct enzymatic supplementation using defined, recombinant human dehydrogenase polypeptides formulated for parenteral delivery. Nor does any prior art provide a recombinant human ADH7 polypeptide formulated for parenteral administration as a standalone therapy for the accelerated oxidation of ethanol at clinically relevant and pathological concentrations. Nor does any prior art provide a recombinant ALDH2 composition formulated for parenteral administration as a standalone therapy for the detoxification of acetaldehyde, formaldehyde, 4-hydroxynonenal (4-HNE), malondialdehyde (MDA), acrolein, and other cytotoxicDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEaldehydes that accumulate in ALDH2-deficient individuals, in aldehyde-mediated DNA damage disorders such as Fanconi anemia, and in conditions of oxidative stress and lipid peroxidation including ischemia-reperfusion injury, neurodegenerative disease, and chronic inflammatory conditions.

[0036] In particular, no prior art provides: (a) a pharmaceutical composition comprising defined recombinant human ADH7 polypeptide with specific sequence identity to SEQ ID NO: 1, whose uniquely high Km for ethanol (25 to 37 mM) enables operation in the unsaturated kinetic regime at pathological ethanol concentrations where endogenous hepatic Class I ADH enzymes are fully saturated — a kinetic advantage not recognized or exploited by any prior art disclosure — and which may be administered alone when only the first oxidation step is therapeutically required; (b) a pharmaceutical composition comprising defined recombinant human ALDH2 polypeptide with specific sequence identity to SEQ ID NO: 2, formulated as a standalone enzyme replacement therapy exploiting the broad substrate specificity of ALDH2 for the oxidation of not only acetaldehyde but also formaldehyde, 4-HNE, MDA, acrolein, and other cytotoxic shortchain aldehydes, thereby addressing aldehyde accumulation disorders independently of ethanol exposure, including but not limited to ALDH2*2 deficiency-associated conditions, aldehyde-mediated DNA interstrand crosslink accumulation in Fanconi anemia, methanol and formaldehyde poisoning, endogenous acetaldehyde and formaldehyde accumulation, and oxidative stress-mediated aldehyde toxicity; (c) a dual-enzyme composition or fusion polypeptide combining both ADH and ALDH activities using defined recombinant human polypeptides with specific sequence identities, addressing the complete two-step ethanol metabolic pathway through both the rate-limiting first step (ethanol to acetaldehyde) and the critical second step (acetaldehyde to acetate) in a single parenteral formulation; (d) co-formulation of exogenous NAD+or NAD+analogs with the active enzyme polypeptides in a single pharmaceutical composition to ensure cofactor availability at the site of action, particularly where endogenous NAD+pools may be depleted by multiple NADase-mediated degradation pathways during heavy alcohol metabolism or rendered inaccessible due to confinement within cytosolic and mitochondrial compartments distant from extracellular injection sites. This cofactor limitation was experimentally confirmed by Yang et al. (U.S. Patent ApplicationDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEPublication No. 2022 / 0133859), whose nanocapsule system required a separate injection of NAD+to enhance ALDH-mediated acetaldehyde clearance but did not incorporate the cofactor into the enzyme formulation. Furthermore, because the ordered bi-bi mechanism of both ADH and ALDH requires NAD+to bind first and induce the catalytically active conformation before substrate can enter the active site, coformulation ensures that the dehydrogenase polypeptides are pre-loaded with cofactor and in a substrate-ready conformation at the moment of administration, providing immediate catalytic activity rather than requiring the enzyme to scavenge cofactor from a depleted or negligible extracellular pool — a kinetic advantage critical for acute intoxication and poisoning indications where time to onset of therapeutic effect is paramount; (e) hyaluronidase co-administered with the dehydrogenase composition for subcutaneous self-administration, enabling acute emergency or chronic prophylactic use outside of hospital settings; (f) half-life extension moieties (PEGylation, Fc fusion, albumin conjugation, fatty acid acylation) specifically applied to dehydrogenase replacement polypeptides to extend activity, dosing intervals, and enable prophylactic regimens; (g) co-formulation with one or more adjunct agents that address complementary pathophysiological dimensions of alcohol or aldehyde toxicity not resolved by enzymatic metabolite clearance alone, such as hepatoprotective agents, neuromodulatory agents, or endocrine modulators of alcohol-related CNS depression, including but not limited to fibroblast growth factor 21 (FGF21) or analogs thereof; (h) tissue-targeting moieties (cell-penetrating peptides, receptor-binding ligands, antibody fragments, homing peptides) to direct dehydrogenase activity to selected tissues, including extrahepatic compartments not efficiently reached by prior art approaches; and (i) mRNA molecules encoding the dehydrogenase polypeptides formulated in lipid nanoparticles for transient, non-integrating in vivo expression as an alternative to viral gene therapy.

[0037] The present invention addresses each of these unmet needs by providing, for the first time, a comprehensive platform for dehydrogenase enzyme replacement therapy that is distinguished from the prior art by the combination of: (i) defined recombinant human polypeptide sequences with specific SEQ ID NOs and sequence identity thresholds; (ii) a standalone recombinant human ADH7 composition exploitingDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEthe uniquely high Km of ADH7 for ethanol (25 to 37 mM) to maintain catalytic activity at intoxication-level and pathological substrate concentrations that fully saturate endogenous hepatic Class I ADH isoforms — a kinetically superior first-step ethanol oxidation therapy not recognized or achieved by any prior art; (iii) dual-enzyme coverage of the complete ethanol metabolism pathway through the combination of ADH7 and ALDH2 in a single parenteral formulation, addressing both the rate-limiting first step (ethanol to acetaldehyde) and the critical second step (acetaldehyde to acetate) simultaneously; (iv) exploitation of the broad substrate specificity of ALDH2 for detoxification of acetaldehyde, formaldehyde, 4-HNE, MDA, acrolein, and other cytotoxic aldehydes, enabling treatment of aldehyde accumulation disorders beyond ethanol metabolism, including ALDH2*2 deficiency syndromes, aldehyde-mediated genotoxicity in Fanconi anemia, endogenous acetaldehyde and formaldehyde accumulation, methanol and formaldehyde poisoning, and oxidative stress-mediated aldehyde toxicity; (v) parenteral formulation providing immediate, systemic enzymatic activity upon administration, including systemic delivery to extrahepatic tissues that cannot be reached by liver-targeted approaches; (vi) dose-titratable and reversible treatment that can be adjusted or discontinued as needed, unlike irreversible gene therapy; (vii) cofactor co-formulation with NAD+and NAD+analogs resistant to NADase-mediated degradation in a single pharmaceutical composition, addressing the experimentally confirmed cofactor limitation of ALDH-based detoxification that prior art systems have identified but failed to resolve; (viii) hyaluronidase co-formulation enabling subcutaneous self-administration; (ix) multiple half-life extension and tissue-targeting strategies to prolong enzymatic activity in vivo, extend dosing intervals, and enable prophylactic regimens; and (x) mRNA-LNP formulations for transient, non-integrating in vivo expression as an alternative to viral gene therapy. These features, individually and in combination, represent a novel inventive concept that is neither anticipated nor rendered obvious by any single prior art reference or combination thereof.SUMMARY OF THE INVENTIONTechnical ProblemDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0038] The technical problem addressed by the present invention is the lack of effective pharmaceutical compositions for the direct enzymatic detoxification of pathologically accumulated alcohols and aldehydes in a subject, particularly in subjects with dehydrogenase substrate saturation during acute intoxication or acute poisoning conditions, reduced-activity dehydrogenase polymorphisms, environmentally or physiologically mediated reduction in dehydrogenase activity (e.g., fasting state, hepatic disease, drug interactions), genetic dehydrogenase deficiencies (e.g., ALDH2*2 carriers), or pathological aldehyde accumulation from endogenous and exogenous nonethanol-derived sources including lipid peroxidation products (4-HNE, MDA, acrolein), methanol and formaldehyde exposure, and oxidative stress-mediated aldehyde generation in ischemia-reperfusion injury and neurodegenerative conditions. Existing therapeutic approaches — including enzyme inhibitors (fomepizole, disulfiram), small molecule allosteric modulators (ALDA-1), gene therapy (AAV-ALDH2), oral enzyme preparations, parenteral ALDH2 monotherapy as disclosed by Katsnelson, enzyme-cofactor booster preparations (e.g., Yen), and nanocapsule enzyme delivery systems — do not provide direct, immediate, titratable, and systemically bioavailable parenteral enzymatic supplementation of single dehydrogenase (ADH or ALDH) or dual dehydrogenase (ADH plus ALDH) activity using defined recombinant human polypeptides with specific sequence identities. Furthermore, the NAD+cofactor depletion that accompanies heavy ethanol metabolism, combined with low extracellular NAD+concentrations and rapid NADase-mediated degradation in the interstitial and plasma compartments, creates a condition in which parenterally administered exogenous dehydrogenase polypeptides — whether delivered intravenously, subcutaneously, or by other parenteral routes — compete with endogenous NAD+-dependent enzymes essential for gluconeogenesis, fatty acid oxidation, and mitochondrial electron transport, unless exogenous cofactor is co-provided — a cofactor co-provision requirement not recognized or addressed by any prior art therapeutic approach.

[0039] In particular, since ethanol exerts significant neuromotor toxic effects at concentrations where the major hepatic Class I ADH enzymes are saturated (BAC exceeding approximately 10 mM, or ~46 mg / dL), the present invention exploits theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEunique suitability of Class IV ADH (ADH7) — with its high Km for ethanol of 25 to 37 mM — as a therapeutically superior detoxifying agent for augmenting systemic ethanol clearance at pathological intoxication levels beyond the capacity of endogenous hepatic metabolism.Solution to Problem

[0040] The present invention provides pharmaceutical compositions comprising an active agent that is an isolated polypeptide, or a modified form thereof, having dehydrogenase activity toward alcohols, aldehydes, or both. In certain embodiments, the active agent comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 1 (ADH7) polypeptide or SEQ ID NO: 2 (ALDH2) polypeptide, or fragments thereof comprising at least 90% of the full-length amino acid sequence of the respective SEQ ID NO (i.e., at least about 336 contiguous amino acids for fragments of SEQ ID NO: 1 and at least about 450 contiguous amino acids for fragments of SEQ ID NO: 2) that retain at least the catalytic domain and the cofactor-binding domain necessary for dehydrogenase activity. In certain further embodiments, the active agent is a modified form comprising a half-life extension moiety, a tissue-targeting moiety, a fusion polypeptide combining ADH and ALDH activities, or other post-translational or chemical modifications that alter pharmacokinetic or pharmacodynamic properties.

[0041] In certain embodiments, the pharmaceutical composition further comprises an enhancer that increases the dehydrogenase activity of the active agent, selected from cofactors (NAD+ or analogs thereof), allosteric activators (N-benzylbenzamide compounds), divalent metallic cations (e.g., zinc), flavonoid NADase inhibitors (e.g., quercetin, apigenin), and activating peptides. In certain embodiments, the pharmaceutical composition further comprises a dispersant that is a recombinant or isolated hyaluronidase to improve subcutaneous tissue spreading and systemic absorption of the active agent. In certain embodiments, the pharmaceutical composition is formulated as a sterile aqueous liquid or lyophilized formulation suitable for parenteral administration, including intravenous, subcutaneous, intramuscular, or intraperitoneal administration.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0042] The present invention further provides methods of treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject by administering a therapeutically effective amount of said pharmaceutical composition. The present invention further provides isolated nucleic acid molecules encoding the active agent polypeptides, mRNA molecules formulated in lipid nanoparticles for transient in vivo expression, expression vectors, recombinant host cells, methods of producing the polypeptides, and kits comprising the pharmaceutical compositions.Advantageous Effects of Invention

[0043] The pharmaceutical compositions and methods of the present invention provide several advantages over the prior art, including the approaches disclosed in Katsnelson (U.S. Patent No. 10,016,489), Wong (U.S. Patent No. 11,208,631), Mochly-Rosen (U.S. Patent No. 9,370,506), Talalay (U.S. Patent Application Publication No. 2021 / 0401791), Stiles et al. (U.S. Patent Application Publication No. 2019 / 0160187; WO 2018 / 022783), Yen (U.S. Patent Application Publication No. 2024 / 0123039), Yang et al. (U.S. Patent Application Publication No. 2022 / 0133859) and Whitmire (U.S. Patent No. 5,759,539). Unlike the methods and compositions of Katsnelson (U.S. Patent No. 10,016,489), which administer exogenous ALDH2 alone to treat ALDH2 deficiency associated with alcohol poisoning, drug-disulfiram reactions, and ischemia-reperfusion injury, the compositions of the present invention optionally provide both ADH and ALDH activities, thereby addressing the rate-limiting first step of ethanol oxidation that Katsnelson leaves entirely dependent on the subject's endogenous ADH capacity. Furthermore, whereas Katsnelson relies on the subject's endogenous NAD+ pool and discloses only PEGylation as a half-life extension strategy, the compositions of the present invention co-formulate exogenous NAD+ or NADase-resistant NAD+ analogs to ensure immediate cofactor availability, provide multiple half-life extension modalities including PEGylation, albumin conjugation, Fc fusion, and acylation, and optionally comprise recombinant human hyaluronidase to enable subcutaneous administration with enhanced tissue dispersion and systemic absorption. Additionally, Katsnelson does not disclose defined polypeptide sequences or sequence identity thresholds, whereas the compositions of the present invention are defined by specific amino acid sequencesDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(SEQ ID NOs), enabling precise molecular characterization, reproducibility, and regulatory compliance. The present invention further encompasses a broader range of clinical indications including acute methanol and formaldehyde poisoning, Fanconi anemia-associated aldehyde accumulation, and neurodegenerative aldehyde-mediated pathology, none of which are addressed by Katsnelson.Unlike the dual-enzyme compositions of Wong (U.S. Patent No. 11,208,631), which combine ADH and ALDH enzymes extracted from bovine or ovine liver in a stated molar ratio of 1:40 that is analytically undefined due to the heterogeneous isoform composition of crude liver extracts, and are formulated primarily as oral enteric-coated dietary supplements for the prevention or alleviation of veisalgia, the compositions of the present invention comprise defined recombinant human dehydrogenase polypeptides of known sequence, purity, and specific activity, administered parenterally to achieve immediate systemic bioavailability. The use of defined recombinant human polypeptides rather than crude animal liver extracts eliminates batch-to-batch variability in enzyme content and activity, avoids the immunogenic risk of repeated administration of nonhuman proteins, and enables precise dose titration based on the subject's body weight, genotype, and clinical indication. Moreover, whereas Wong's compositions are directed to veisalgia in casual and frequent alcohol drinkers, the compositions and methods of the present invention are directed to acute alcohol intoxication, acute aldehyde poisoning, ischemia-reperfusion injury, Fanconi anemia-associated aldehyde accumulation, and other conditions in which rapid systemic enzymatic supplementation is medically indicated.Unlike ALDA-1 and related allosteric modulators (Mochly-Rosen), the compositions of the present invention supply exogenous catalytic activity independent of the subject's residual endogenous enzyme level, making them effective even in ALDH2*2 homozygous individuals with less than 5% residual activity.Unlike Nrf2 / ARE pathway inducers such as sulforaphane (Talalay), which require a pretreatment period of seven or more days to achieve meaningful transcriptional upregulation of endogenous ALDH expression and are subject to a ceiling effect determined by the individual's baseline transcriptional capacity, the compositions of theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEpresent invention provide immediate, dose-controllable dehydrogenase activity independent of the subject's transcriptional machinery.Unlike AAV-mediated ALDH2 gene therapy (Stiles et al.), which is limited by preexisting and treatment-induced anti-capsid immunity, risk of insertional mutagenesis, irreversibility of transgene expression in post-mitotic tissues, liver-tropic serotype tropism that fails to address extrahepatic aldehyde-mediated pathology, and augmentation of only ALDH2 without addressing the rate-limiting ADH-catalyzed first step of ethanol metabolism, the compositions of the present invention are non-immunogenic with respect to viral capsid responses, carry no risk of genomic integration, allow dose titration and cessation, achieve systemic distribution to extrahepatic tissues, and optionally provide both ADH and ALDH activities in a single administration.Unlike oral enzyme compositions formulated with cofactors and boosters (Yen), the compositions of the present invention are administered parenterally, thereby bypassing gastrointestinal proteolytic degradation, acidic denaturation, and first-pass hepatic metabolism, and achieving immediate systemic bioavailability of intact, catalytically active dehydrogenase polypeptides at controlled doses. Furthermore, whereas Yen relies on indirect cofactor replenishment through biosynthetic precursors (nicotinamide riboside and nicotinamide mononucleotide) that require intracellular enzymatic conversion to NAD+, the compositions of the present invention co-formulate NAD+ or NADase-resistant NAD+ analogs directly with the active enzyme, ensuring immediate cofactor availability independent of the subject's intracellular biosynthetic capacity.Unlike nanocapsule-based enzyme delivery systems (Yang et al.), which employ nonhuman enzymes (fungal alcohol oxidase, bovine catalase, and yeast ALDH) encapsulated within cationic polymer shells designed for hepatocyte-targeted intravenous delivery, the compositions of the present invention comprise defined recombinant human dehydrogenase polypeptides that achieve systemic distribution to both hepatic and extrahepatic tissues, avoid the stoichiometric hydrogen peroxide generation inherent to alcohol oxidase-based systems and the associated requirement for co-delivered catalase, eliminate the cationic polymer cytotoxicity and manufacturing complexity associated with in situ nanoencapsulation, and co-formulate exogenousDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USENAD+ or NADase-resistant NAD+ analogs directly with the active enzyme rather than requiring separate administration of cofactor.Unlike the cofactor regeneration approach of Whitmire (U.S. Patent No. 5,759,539), which recycles the existing endogenous NAD+ / NADH pool through an auxiliary enzyme, the co-formulation of exogenous NAD+ or NADase-resistant NAD+ analogs in the present invention directly increases cofactor availability at the site of enzymatic action, ensuring that the dehydrogenase polypeptides are in their catalytically active, cofactorbound conformation from the moment of administration.In addition to the foregoing advantages over specific prior art approaches, by enhancing extrahepatic alcohol and aldehyde clearance, the compositions and methods of the present invention reduce the metabolic burden on the liver, thereby mitigating hepatic exposure to toxic metabolites, hepatocellular accumulation of acetaldehyde, protein and DNA adduct formation, and oxidative stress, providing a hepatoprotective effect.

[0044] The selection of ADH7 (Class IV ADH) as the alcohol dehydrogenase active agent provides a unique kinetic advantage. The high Km of ADH7 for ethanol (25 to 37 mM) means that the exogenous enzyme continues to increase its catalytic rate proportionally at the elevated BAC (greater than 10 mM, corresponding to approximately 46 mg / dL or above) where endogenous hepatic Class I ADH enzymes are substantially saturated. This broad-spectrum activity across a wide substrate concentration range enables effective augmentation of ethanol metabolism precisely at the clinically relevant concentrations associated with intoxication, acute toxicity, and chronic organ damage.

[0045] The inclusion of half-life extension moieties (PEGylation, Fc fusion, albumin conjugation, fatty acid acylation) enables prolonged therapeutic effect, reduced dosing frequency, and improved pharmacokinetic profiles, extending the utility of the compositions from acute treatment to prophylactic and chronic dosing regimens.Additionally, the inclusion of a hyaluronidase dispersant enables subcutaneous delivery of relatively large injection volumes, thereby facilitating self-administration by patients outside of hospital settings — a critical advantage in emergency settings, including acute intoxication, and for chronic management of ALDH2 deficiency. The fusionDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEpolypeptide embodiments combining alcohol and aldehyde dehydrogenase activities in a single polypeptide chain provide enhanced sequential metabolic coverage, catalyzing both the conversion of ethanol to acetaldehyde and the subsequent conversion of acetaldehyde to acetate within a single therapeutic entity, potentially reducing the total protein dose required and simplifying the pharmaceutical formulation.

[0046] The co-formulation of the active agent with NAD+ cofactor or NAD+ analogs with enhanced resistance to degradation by NADase enzymes (e.g., CD38, SARM1, PARPs) ensures that cofactor availability does not limit enzymatic activity at the site of action and that dehydrogenase polypeptides are maintained in their catalytically active, cofactor-bound conformation from the moment of administration, addressing a key limitation of enzyme replacement in tissues where NAD+ pools may be depleted or subject to rapid turnover. The mRNA-LNP embodiments offer a transient, nonintegrating alternative to viral gene therapy that permits repeat dosing without diminished efficacy from anti-vector immune responses, enabling in vivo production of the active agent polypeptide by the patient's own cellular machinery without the risks of insertional mutagenesis, permanent genetic modification, or pre-existing and treatment-induced anti-capsid immunity associated with viral vector delivery.BRIEF DESCRIPTION OF THE DRAWINGS

[0047] The following drawings form part of the present specification and are included to further demonstrate certain aspects and embodiments of the invention.

[0048] FIG. 1 is a schematic diagram illustrating the alcohol metabolism pathway showing the conversion of alcohol to aldehyde by alcohol dehydrogenase (ADH) and the subsequent conversion of aldehyde to carboxylate by aldehyde dehydrogenase (ALDH), with NAD+ as a cofactor.

[0049] FIG. 2 is a schematic diagram illustrating the ethanol metabolism pathway showing the ordered bi-bi (Theorell-Chance) kinetic mechanism of ADH and ALDH whereby NAD+ binds first to form the catalytically active binary complex and substrate binds thereafter for catalysis with eventual release of acetaldehyde and acetate products and NADH.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0050] FIG. 3 is a schematic diagram summarizing the primary and alternative ethanol metabolic pathways. The primary pathway (left) shows presystemic metabolism by ADH7 and ADH1 converting ethanol to acetaldehyde, followed by ALDH2-mediated conversion of acetaldehyde to acetate for distribution to peripheral tissues. The alternative pathway (right) shows the diversion of ethanol, at elevated concentrations, to CYP2E1 and non-oxidative conjugation pathways.

[0051] FIG. 4 is a schematic diagram of the domain architecture of the active agent polypeptides of SEQ ID NO: 1 (ADH7) and SEQ ID NO: 2 (ALDH2), showing the catalytic domain, cofactor-binding domain, and key residues.

[0052] FIG. 5 is a schematic diagram illustrating the various half-life extension moiety configurations described in the present invention, including (A) PEGylation, (B) Fc fusion, (C) albumin fusion, and (D) fatty acid acylation.

[0053] FIG. 6 is a diagram illustrating the tissue-targeting moiety configurations, including (A) cell-penetrating peptides, (B) receptor-binding ligands, (C) antibody fragments, and (D) tissue-specific homing peptides.

[0054] FIG. 7 is a schematic representation of the fusion polypeptide showing the N-terminal ADH7 domain, central peptide linker, and C-terminal ALDH2 domain.

[0055] FIG. 8 is a schematic diagram illustrating the structure of the mRNA-LNP formulation, illustrating the ionizable cationic lipid, neutral helper lipid, cholesterol, and PEG-lipid components.

[0056] FIG. 9 is a bar graph showing SEQ ID NO: 1 (ADH7) activity as a function of NAD+ concentration (0.1, 0.25, 0.5, 1, 2.5, 5, 10, and 20 mM) at ethanol concentration of 200 mM. Absorbance was measured at 340 nm over 30 minutes. NADH production increased with increasing NAD+ concentration, confirming NAD+ concentrationdependent activity of the recombinant ADH7 polypeptide.

[0057] FIG. 10 is a graph showing activity of SEQ ID NO: 1 (ADH7) at clinically relevant ethanol concentrations of 10, 20, 40, and 80 mM, corresponding to approximately 0.05%, 0.09%, 0.18%, and 0.37% BAC, respectively. The rate of NADH productionDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEincreased with increasing ethanol concentration, demonstrating that ADH7 catalytic activity continues to rise across the pathological ethanol range.

[0058] FIG. 11 is a graph showing substrate depletion by SEQ ID NO: 2 (ALDH2) at clinically relevant acetaldehyde concentrations of 10, 25, 50, 75, and 100 pMderived from experimental kinetic parameters. The rate of acetaldehyde reduction is linear at each concentration, demonstrating that ALDH2 exhibits maximal catalytic activity across the entire pathological acetaldehyde range.

[0059] FIG. 12 is a bar graph showing coupled sequential metabolism of ethanol and acetaldehyde through the complete SEQ ID NO: 1 / SEQ ID NO: 2 (ADH7 / ALDH2) pathway. Activity profiles at different subunit molar ratios (ALDH2:ADH7) demonstrate a stoichiometric and synergistic relationship in sequential pathway metabolism of ethanol.

[0060] FIG. 13 is a bar graph showing coupled sequential metabolism of ethanol and acetaldehyde through the complete SEQ ID NO: 1 / SEQ ID NO: 2 (ADH7 / ALDH2) pathway at a subunit molar ratio of 2:1 (ALDH2:ADH7). Activity profiles demonstrate stoichiometric and synergistic relationship in sequential pathway metabolism of ethanol at clinically relevant ethanol concentrations of 10, 20, 40, and 80 mM.

[0061] FIG. 14 is a graph showing coupled sequential metabolism of ethanol and acetaldehyde through the complete SEQ ID NO: 1 / SEQ ID NO: 2 (ADH7 / ALDH2) pathway at a subunit molar ratio of 2:1 (ALDH2:ADH7) in human plasma. Activity profile demonstrates a stoichiometric and synergistic relationship in sequential pathway metabolism of ethanol in a physiological matrix at a clinically relevant ethanol concentration of 80 mM (BAC 0.37%; life-threatening intoxication severity).

[0062] FIG. 15 is a graph showing subcutaneous tissue spreading by SEQ ID NO: 1 (ADH7), SEQ ID NO: 2 (ALDH2), NAD+, and hyaluronidase co-formulation as measured in an ex vivo porcine skin spreading assay.

[0063] FIG. 16 is a schematic cross-sectional view (top) and external view (bottom) of a dual-chamber prefilled syringe for reconstitution and delivery of the pharmaceutical composition. Chamber 1 contains the lyophilized active agent composition; Chamber 2 contains the pharmaceutically acceptable diluent. Upon actuation of the plunger, theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEdiluent passes through the bypass channel to reconstitute the lyophilized composition, and the reconstituted solution is delivered through the needle assembly.DETAILED DESCRIPTION OF EMBODIMENTSDEFINITIONS

[0064] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the present invention belongs. The following definitions are provided for clarity.

[0065] As used herein, the term “substrate” refers to any substance(s), or combination(s) of substances that are recognized and acted upon by dehydrogenase active agents. Regardless of affinity or specificity, substrates are recognized and subjected to biological actions upon that include but are not limited to enzymatic catalysis, signaling, regulation, or transport.

[0066] As used herein, the term "isolated" refers to a polypeptide, nucleic acid, or other biological molecule that has been separated from at least one component of its natural environment. An "isolated polypeptide" includes a recombinant polypeptide, a polypeptide produced by chemical synthesis, or a polypeptide purified from a natural source.

[0067] As used herein, the term "polypeptide" refers to a polymer of amino acid residues linked by peptide bonds, including proteins, fragments, analogs, and fusion proteins. No specific length limitation is implied; the term encompasses full-length proteins, fragments thereof, and modified forms.

[0068] As used herein, the term "sequence identity" refers to the percentage of amino acid positions in a pair of aligned sequences at which the amino acid residues are identical, as determined using a standard alignment algorithm such as BLAST (Basic Local Alignment Search Tool) with default parameters or the Needleman-Wunsch global alignment algorithm. Unless otherwise specified, sequence identity is calculated over the full length of the reference sequence (SEQ ID NO: 1 or SEQ ID NO: 2).DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0069] As used herein, the term "conservative substitution" refers to replacement of an amino acid residue with another amino acid residue within the same physicochemical class, wherein the classes are: (i) nonpolar aliphatic residues: glycine (G), alanine (A), valine (V), leucine (L), isoleucine (I), and methionine (M); (ii) aromatic residues: phenylalanine (F), tyrosine (Y), and tryptophan (W); (iii) polar uncharged residues: serine (S), threonine (T), asparagine (N), and glutamine (Q); (iv) positively charged residues: lysine (K), arginine (R), and histidine (H); and (v) negatively charged residues: aspartate (D) and glutamate (E).

[0070] As used herein, the term "dehydrogenase activity" refers to the ability of a polypeptide to catalyze the oxidation of an alcohol to an aldehyde or ketone, or the oxidation of an aldehyde to a carboxylic acid, using a cofactor such as NAD+ or NADP+ or analogs thereof. Dehydrogenase activity may be measured by any art-recognized assay, including but not limited to spectrophotometric monitoring of NADH production at 340 nm, gas chromatographic measurement of substrate depletion, or coupled enzyme assays.

[0071] As used herein, the term "half-life extension moiety" refers to a chemical group or polypeptide domain that, when attached to or fused with the active agent polypeptide, increases the serum or plasma half-life of the active agent relative to the unmodified active agent. Non-limiting examples include polyethylene glycol (PEG) moieties, immunoglobulin Fc regions, human serum albumin (HSA), albumin-binding domains, and fatty acid acyl moieties.

[0072] As used herein, the term "tissue-targeting moiety" refers to a chemical group, peptide, or polypeptide domain that, when attached to or fused with the active agent polypeptide, directs or enhances the delivery of the active agent to a specific tissue, cell type, or subcellular compartment. Non-limiting examples include cell-penetrating peptides (CPPs), receptor-binding ligands, antibody fragments, and tissue-specific homing peptides.

[0073] As used herein, the term "enhancer" refers to a compound that, when present in the pharmaceutical composition together with the active agent, increases the dehydrogenase activity of the active agent relative to a control composition lacking saidDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEenhancer. Non-limiting examples include NAD+, NAD+ analogs, flavones, N-benzylbenzamide allosteric activators, divalent metallic cations, activating peptides, and mitochondrial electron transport chain modulators.

[0074] As used herein, the term "dispersant" refers to a soluble recombinant or isolated hyaluronidase enzyme that, when co-formulated with the active agent, increases the subcutaneous tissue spreading or absorption of the active agent. Dispersants as used herein are soluble, non-membrane-bound enzymes of EC class 3.2.1.35 that exhibit hyaluronidase activity at physiological pH.

[0075] As used herein, the term "pharmaceutically acceptable carrier, excipient, diluent, or buffer" refers to a substance that is suitable for use in contact with the tissues of a subject (e.g., a human) without causing undue toxicity, irritation, allergic response, or other adverse effects, and that is compatible with the active agent. Non-limiting examples include water for injection, saline, phosphate-buffered saline, acetate buffers, histidine buffers, Tris buffers, sugars (e.g., trehalose, sucrose), sugar alcohols (e.g., mannitol, sorbitol), surfactants (e.g., polysorbate 80), and amino acids (e.g., glycine, arginine).

[0076] As used herein, the term "therapeutically effective amount" refers to an amount of the pharmaceutical composition sufficient to provide a clinically significant reduction in the level of pathologically accumulated alcohols, aldehydes, or both in a subject, or to prevent the onset or progression of pathological accumulation, when administered according to a suitable dosing regimen.

[0077] As used herein, the term "subject" refers to any mammal, including but not limited to humans, non-human primates, rodents, canines, felines, bovines, ovines, equines, and porcines. In preferred embodiments, the subject is a human.

[0078] As used herein, the term "about" refers to a value that is within plus or minus 10% of the stated value.ACTIVE AGENT POLYPEPTIDES

[0079] The pharmaceutical compositions of the present invention comprise an active agent that is an isolated polypeptide exhibiting dehydrogenase activity towards alcohols,DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEaldehydes, or both. In various embodiments, the active agent comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% sequence identity to SEQ ID NO: 1, which encodes a Class IV alcohol dehydrogenase (ADH7) polypeptide, or to SEQ ID NO: 2, which encodes a mitochondrial aldehyde dehydrogenase 2 (ALDH2) polypeptide, or both. In certain embodiments, the active agent comprises only the polypeptide of SEQ ID NO: 2, or a variant or fragment thereof, for the treatment of conditions primarily associated with aldehyde accumulation, such as genetic ALDH2 deficiency, Fanconi anemia, or endogenous aldehyde-mediated toxicity. In certain embodiments, the active agent comprises only the polypeptide of SEQ ID NO: 1 , or a variant or fragment thereof, for the augmentation of alcohol oxidation capacity in subjects with saturated or insufficient endogenous ADH activity.

[0080] In certain embodiments wherein the active agent comprises both a polypeptide having at least 80% sequence identity to SEQ ID NO: 1 and a polypeptide having at least 80% sequence identity to SEQ ID NO: 2, the two polypeptides are present at a defined molar or weight ratio selected to coordinate the rates of the sequential ADH and ALDH reactions and to prevent transient accumulation of the toxic acetaldehyde intermediate. Because the polypeptide of SEQ ID NO: 1 (ADH7) exhibits a catalytic turnover number (kcat) of approximately 1,510 per minute, which is approximately 4- to 10-fold higher than the kcat of the polypeptide of SEQ ID NO: 2 (ALDH2)for acetaldehyde (approximately 280 per minute; (Klyosov AA 1996 [NPL8])), and because each mole of ethanol oxidized by ADH7 generates one mole of acetaldehyde that must be oxidized by ALDH2, a molar excess of ALDH2 relative to ADH7 is preferred in embodiments where the subject has reduced or absent endogenous ALDH2 activity, such as ALDH2*2 carriers. In subjects with functional endogenous ALDH2 (wild-type ALDH2*1 / *1), a lower proportion of exogenous ALDH2 may be sufficient, as the endogenous mitochondrial ALDH2 pool supplements exogenous aldehyde clearance. In certain embodiments, the molar ratio of the polypeptide of SEQ ID NO: 2 to the polypeptide of SEQ ID NO: 1 (ALDH2:ADH7) is from about 1 :20 to about 20:1 , such as from about 1:10 to about 10:1, from about 1:5 to about 5:1, from about 1:3 to about 3:1, or about 1:1. In certain embodiments, the weight-to-weight (w / w) ratio of the polypeptide of SEQ ID NO: 2 to the polypeptide of SEQ ID NO: 1 (ALDH2:ADH7) is from about 1 :20DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEto about 20:1, such as from about 1:10 to about 10:1, from about 1:5 to about 5:1, from about 1 :4 to about 4:1 , or about 1 :1. In a preferred embodiment for treatment of acute ethanol intoxication in a subject with ALDH2 deficiency, the molar ratio of ALDH2 to ADH7 (ALDH2:ADH7) is from about 1:1 to about 8:1; in more preferred embodiments, from about 2:1 to about 4:1, providing a molar excess of ALDH2 sufficient to match the rate of acetaldehyde generation across the full range of clinically relevant blood ethanol concentrations, including concentrations exceeding 80 mM.

[0081] SEQ ID NO: 1 is a polypeptide of 373 amino acids (see FIG. 4) in length (corresponding to the form of human ADH7 initiating at the second methionine residue (Met-13 of UniProt accession P40394, 386 amino acids), consistent with the originally characterized cDNA sequence (Fames et aL, 1994 [NPL1]) that folds into a characteristic homodimeric structure with two structural domains per subunit: a Rossmann-fold NAD+-binding domain (Pfam PF08240) and a catalytic domain (Pfam PF00107) containing one catalytic zinc-binding site (coordinated by Cys-46, His-67, Cys-173, and a water molecule) and one structural zinc-binding site (coordinated by four cysteine residues in a tetrahedral Cys4 cluster). Arg-47, immediately adjacent to the catalytic zinc ligand Cys-46, interacts with the pyrophosphate moiety of the NAD+ cofactor and is conserved from Class I ADH, where it contributes to tight coenzyme binding. In the polypeptide of SEQ ID NO: 1, however, the coenzyme-tightening effect of Arg-47 is offset by compensating residues Glu-230, Asn-260, Asn-261, His-271, and Asn-363, which collectively weaken NAD+ binding affinity and yield the characteristically high dissociation constant for the binary enzyme-NAD+ complex (Kia approximately 1.6 mM) that distinguishes Class IV from Class I ADH (Fames et al., 1994 [NPL1]). This weak coenzyme binding is kinetically coupled to the high catalytic turnover rate (kcat approximately 1,510 per minute) because rapid NADH release, rather than hydride transfer, is rate-limiting in the ordered bi-bi mechanism. Val-294, located in the middle section of the substrate-binding cleft, restricts the substrate pocket relative to the corresponding Ala-294 in rat Class IV ADH and is primarily responsible for the approximately 37 mM Km of the polypeptide of SEQ ID NO: 1 for ethanol (Fames et aL, 1994 [NPL1]). Additionally, X-ray crystallographic analysis of the polypeptide of SEQ ID NO: 1 complexed with NAD+ has identified Met-57, Met-141, and Phe-309 as residuesDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEthat narrow the middle region of the substrate-binding pocket, contributing to the substantially decreased Km values observed with increasing chain length of alcohol substrates, while Thr-48 and Phe-93 undergo movements that widen the substrate pocket near the catalytic zinc, contributing to the high Km for small substrates such as ethanol. These structure-function relationships indicate that the kinetic properties of the polypeptide of SEQ ID NO: 1 — the combination of high Km for ethanol, high catalytic turnover, and weak coenzyme binding — arise from a specific constellation of active site residues that is distinct from all other human ADH classes and that uniquely suits this polypeptide for therapeutic application at pathological ethanol concentrations. The polypeptide of SEQ ID NO: 1 catalyzes the reversible NAD+-dependent oxidation of primary and secondary alcohols to the corresponding aldehydes or ketones. In a preferred embodiment, the polypeptide of SEQ ID NO: 1 exhibits specific activity towards ethanol with a Km of approximately 37 mM and a kcat of approximately 1,510 per minute, as measured by the rate of NADH production at 340 nm.

[0082] SEQ ID NO: 2 is a polypeptide of 500 amino acids (see FIG. 4) in length (corresponding to the mature form of human ALDH2 after removal of the 17-amino acid mitochondrial targeting sequence from the 517-amino acid precursor; UniProt accession P05091) that folds into a characteristic ALDH superfamily homotetrameric structure comprising, per subunit, an NAD+-binding domain, a catalytic domain containing the nucleophilic Cys-302 residue and the general base Glu-268, and an oligomerization domain in which the Glu-487 residue forms critical inter-subunit contacts. The polypeptide of SEQ ID NO: 2 catalyzes the irreversible NAD+-dependent oxidation of aldehydes, including acetaldehyde, formaldehyde, 4-hydroxynonenal, malondialdehyde, and acrolein, to the corresponding carboxylic acids. In a preferred embodiment, the polypeptide of SEQ ID NO: 2 exhibits specific activity towards acetaldehyde with a Km of approximately 0.2 pM and a kcat of approximately 280 per minute, as measured by the rate of NADH production at 340 nm.

[0083] In certain embodiments, the active agent is an isolated fragment of SEQ ID NO: 1 or SEQ ID NO: 2 comprising at least 90% of the full-length amino acid sequence of the respective SEQ ID NO. For SEQ ID NO: 1 (373 amino acids), such fragments comprise at least about 336 contiguous amino acids and retain the catalytic zinc-bindingDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEsite, the structural zinc-binding site, and the Rossmann-fold NAD-r-binding domain. For SEQ ID NO: 2 (500 amino acids), such fragments comprise at least about 450 contiguous amino acids and retain the NAD+-binding domain, the catalytic domain including the nucleophilic Cys-302 and general base Glu-268, and the oligomerization domain including the Glu-487 residue critical for homotetrameric assembly. Such fragments retain at least the catalytic domain or the cofactor-binding domain necessary for dehydrogenase activity. In certain embodiments, the fragment retains at least 10%, at least 25%, at least 50%, or at least 75% of the dehydrogenase activity of the full-length polypeptide, as measured under equivalent assay conditions.

[0084] In certain embodiments, the active agent is an isolated polypeptide having at least 80% sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2, wherein each amino acid difference relative to SEQ ID NO: 1 or SEQ ID NO: 2 is a conservative substitution within the same physicochemical class as defined herein. Such conservative substitutions are expected to preserve the overall three-dimensional structure and enzymatic activity of the polypeptide, while potentially modulating properties such as thermal stability, pH optimum, cofactor affinity, or immunogenicity profile.

[0085] The active agent polypeptides of the present invention may be recombinant polypeptides expressed in a host cell selected from bacterial cells (e.g., Escherichia coli), insect cells (e.g., Spodoptera frugiperda Sf9 or Sf21), yeast cells (e.g., Komagataellaphaffii, syn. Pichia pastoris), and mammalian cells (e.g., Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK293) cells, and baby hamster kidney (BHK) cells). The choice of expression system may influence the post-translational modification profile, glycosylation pattern, solubility, and immunogenicity of the resulting polypeptide.MODIFIED FORMS OF ACTIVE AGENT POLYPEPTIDESHalf-Life Extension Moieties

[0086] In certain embodiments, the active agent comprises a modified form of the polypeptide wherein the modified form comprises covalent attachment of a half-life extension moiety (see FIG. 5). Proteins administered parenterally typically have shortDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEcirculating half-lives due to renal clearance, proteolytic degradation, and receptor-mediated endocytosis. Covalent attachment of a half-life extension moiety increases the apparent molecular weight, reduces renal filtration, and / or provides protection from proteolysis, thereby extending the serum half-life and reducing dosing frequency. The clinical utility of half-life extension for enzyme replacement therapeutics is well established; for example, pegunigalsidase alfa (a PEGylated alpha-galactosidase A for Fabry disease, approved 2023) demonstrated reduced immunogenicity and extended half-life relative to unmodified enzyme.

[0087] In one embodiment, the half-life extension moiety is a polyethylene glycol (PEG) moiety conjugated to a lysine residue, a cysteine residue, or the N-terminus of the polypeptide. Suitable PEG moieties include linear or branched PEG molecules having a molecular weight of from about 5 kDa to about 60 kDa, such as from about 10 kDa to about 40 kDa. PEGylation may be performed using N-hydroxysuccinimide (NHS)-PEG, maleimide-PEG, or aldehyde-PEG chemistry, as is well known in the art.

[0088] In one embodiment, the half-life extension moiety is a human immunoglobulin Fc region, preferably an lgG1, lgG2, or lgG4 Fc region, or an aglycosylated variant thereof (e.g., comprising an N297A or N297G mutation), fused to the N-terminus or C-terminus of the polypeptide. The Fc region provides extended half-life through interaction with the neonatal Fc receptor (FcRn), which mediates pH-dependent recycling of Fc-containing proteins from endosomes back to the cell surface, thereby rescuing the protein from lysosomal degradation. An aglycosylated Fc variant is preferred where reduced effector function is desirable.

[0089] In one embodiment, the half-life extension moiety is human serum albumin (HSA) or an albumin-binding domain (ABD) fused to the polypeptide. HSA has a circulating half-life of approximately 19 to 21 days, and fusion to HSA or an ABD exploits the FcRn-mediated recycling pathway to extend the half-life of the fusion partner.

[0090] In one embodiment, the half-life extension moiety is a fatty acid acyl moiety, such as a palmitoyl or stearoyl moiety, conjugated to the polypeptide. Fatty acid acylation facilitates non-covalent binding to circulating albumin, thereby extending the half-life of the conjugate. This approach has been clinically validated in the GLP-1DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEreceptor agonist semaglutide, which achieves a half-life of approximately 165 hours through albumin binding mediated by a C18 fatty acid side chain.Tissue-Targeting Moieties

[0091] In certain embodiments, the active agent comprises a modified form of the polypeptide wherein the modified form comprises covalent attachment of a tissuetargeting moiety (see FIG. 6). Tissue-targeting moieties are used to direct the active agent to specific tissues or cell types where dehydrogenase activity is needed, thereby improving local efficacy and potentially reducing the required systemic dose.

[0092] In one embodiment, the tissue-targeting moiety is a cell-penetrating peptide (CPP) that facilitates intracellular delivery of the active agent. Suitable CPPs include, but are not limited to, a TAT peptide (derived from the HIV-1 TAT protein transduction domain, typically amino acids 47-57: YGRKKRRQRRR), a polyarginine peptide (e.g., Arg9), and a penetratin peptide (derived from the Antennapedia homeodomain). CPPs enable the active agent to cross cell membranes and access intracellular compartments where dehydrogenase activity may be beneficial. The use of CPPs for intracellular enzyme delivery has been validated in preclinical studies, including demonstrations that TAT-conjugated enzymes achieve intracellular enzymatic activity within 30 minutes of administration with functional persistence for up to 48 hours.

[0093] In one embodiment, the tissue-targeting moiety is a receptor-binding ligand that specifically binds a cell-surface receptor. Suitable receptor-binding ligands include ligands for the transferrin receptor (for targeting hepatocytes and crossing the bloodbrain barrier), ligands for the insulin receptor, and ligands for the asialoglycoprotein receptor (ASGPR) (for liver-targeted delivery). ASGPR-targeted delivery is particularly relevant for liver-directed enzyme therapy, as the liver is the primary site of ethanol and acetaldehyde metabolism, and ASGPR is a well-validated hepatocyte-specific receptor for targeted delivery of protein therapeutics.

[0094] In one embodiment, the tissue-targeting moiety is an antibody fragment specific for a tissue-specific antigen. Suitable antibody fragments include single-chain variableDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEfragments (scFvs), Fab fragments, and camelid-derived single-domain antibodies (VHHs, also known as nanobodies).

[0095] In one embodiment, the tissue-targeting moiety is a tissue-specific homing peptide identified by phage or yeast display. Suitable homing peptides include peptides comprising an RGD motif (for targeting endothelial cells), an NGR motif (for targeting angiogenic vasculature), and brain-homing sequences.

[0096] In certain embodiments, the tissue-targeting moiety is conjugated to the active agent via a linker. The linker may be a non-cleavable peptide linker (e.g., a flexible glycine-serine linker) or a cleavable linker that is susceptible to cleavage by a tissuespecific protease (e.g., matrix metalloproteinase (MMP), cathepsin B, or plasmin) or a change in endosomal pH. Cleavable linkers are advantageous where release of the active agent from the targeting moiety is desired after cellular uptake.Post-Translational Modifications

[0097] The active agent polypeptides of SEQ ID NO: 1 and SEQ ID NO: 2 are not natively N-glycosylated in their endogenous cellular context: the polypeptide of SEQ ID NO: 1 (ADH7) is a cytoplasmic enzyme, and the polypeptide of SEQ ID NO: 2 (ALDH2) is a mitochondrial matrix enzyme; neither protein transits the endoplasmic reticulum (ER)-Golgi secretory pathway in its native subcellular compartment, and accordingly neither acquires N-linked glycans in vivo. However, when expressed as a secreted recombinant protein from a mammalian host cell (e.g., CHO or HEK293 cells) using a heterologous signal peptide that directs the polypeptide through the ER-Golgi secretory pathway, each polypeptide is exposed to the host cell N-glycosylation machinery.Sequence analysis of the mature polypeptide of SEQ ID NO: 1 identifies one endogenous consensus N-glycosylation sequon at Asn-154 (Asn-Thr-Ser), and sequence analysis of the full-length precursor polypeptide of SEQ ID NO: 2 identifies one endogenous consensus N-glycosylation sequon at Asn-438 (Asn-Asn-Ser). These endogenous sequons may be glycosylated at low or variable occupancy when the polypeptide is expressed via the secretory pathway, depending on the host cell line, the local sequence context, and the accessibility of each sequon within the folded protein structure. In embodiments where glycosylation at these endogenous sequons isDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEundesired — for example, to produce a homogeneous, non-glycosylated recombinant polypeptide — the Asn residue at each sequon may be substituted with a conservative replacement such as Gin (N154Q for SEQ ID NO: 1; N438Q for SEQ ID NO: 2) or the Ser / Thr residue within the sequon may be substituted with Ala (S156A for SEQ ID NO: 1; S440A for SEQ ID NO: 2), thereby abolishing the consensus N-glycosylation motif while preserving the polypeptide backbone and dehydrogenase activity.

[0098] In certain embodiments, one or more additional N-glycosylation sites are engineered into the active agent polypeptide by introducing consensus Asn-X-Thrsequons (where Thr is preferred over Ser for higher glycosylation efficiency) at surface-exposed positions distal to the catalytic active site, the zinc-binding residues (for SEQ ID NO: 1), the catalytic Cys-302 and Glu-268 residues (for SEQ ID NO: 2), and the NAD+ cofactor-binding domain. Suitable positions for sequon introduction are identified by analysis of the three-dimensional crystal structure of each polypeptide and selection of solvent-accessible loop regions where the side chain of the engineered Asn residue is oriented toward the protein exterior. Expression in Chinese hamster ovary (CHO) cells produces predominantly complex-type, sialylated N-glycans; expression in human embryonic kidney 293 (HEK293) cells produces a mixture of high-mannose and complex-type glycans. Expression under certain conditions, including incomplete processing by Golgi-resident mannosidase II, may also yield hybrid-type glycoforms comprising both high-mannose and complex-type branches on the same N-glycan; such hybrid-type glycoforms may be enriched by lectin affinity chromatography using Phaseolus vulgaris erythroagglutinin (PHA-E), which preferentially binds bisecting GIcNAc residues characteristic of hybrid structures. Glycoform selection or enrichment is performed by methods known in the art, including lectin affinity chromatography (e.g., concanavalin A for high-mannose glycoforms; Sambucus nigra agglutinin for sialylatedglycoforms), ion-exchange chromatography exploiting the charge contribution of terminal sialic acid residues, and hydrophilic interaction liquid chromatography (HILIC) of released glycans followed by pooling of fractions corresponding to the desired glycoform. Sialylatedglycoforms are expected to exhibit extended serum half-life relative to non-glycosylated or high-mannose glycoforms due to shielding from asialoglycoprotein receptor (ASGPR)-mediated hepatic clearance and increasedDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEhydrodynamic radius. Retention of dehydrogenase activity following glycoform engineering is confirmed by the spectrophotometric assay described in Example 1.

[0099] In certain embodiments, the active agent polypeptide comprises one or more additional post-translational modifications selected from phosphorylation, O-linked glycosylation, and acetylation. Phosphorylation at one or more surface-exposed serine, threonine, or tyrosine residues distal to the catalytic active site and the cofactor-binding domain may be introduced by in vitro kinase treatment or by co-expression with a kinase in a eukaryotic host cell, and is expected to modulate net surface charge, solubility, and serum half-life of the polypeptide without substantially impairing dehydrogenase activity. Candidate phosphorylation sites are identified by computational prediction (e.g., NetPhos) and confirmed by mass spectrometry. O-linked glycosylation at one or more serine or threonine residues may occur when the polypeptide is expressed in a mammalian host cell possessing active polypeptide GalNAc-transferases (ppGalNAc-Ts), and may be enriched by lectin affinity chromatography using Vicia villosa agglutinin (VVA) or Jacalin. N-terminal acetylation, which occurs co-translationally in eukaryotic expression systems, may reduce immunogenicity and increase serum stability of the recombinant polypeptide. Acetylation at one or more internal lysine residues may be introduced by in vitro chemical acetylation (e.g., using sulfo-NHS-acetate) at surface-exposed lysine residues distal to the catalytic site and the zinc-binding residues (for SEQ ID NO: 1) or the catalytic Cys-302 (forSEQ ID NO: 2), and is expected to modulate surface charge and reduce receptor-mediated clearance. Retention of dehydrogenase activity following any such modification is confirmed by the spectrophotometric assay described in Example 1.FUSION POLYPEPTIDES

[0100] In a particularly preferred embodiment, the active agent is a fusion polypeptide (see FIG. 7) comprising, from N-terminus to C-terminus: (a) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 1 and exhibiting dehydrogenase activity towards alcohols; (b) a peptide linker; and (c) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 2 and exhibiting dehydrogenase activityDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEtowards aldehydes. Such a fusion polypeptide exhibits dehydrogenase activity towards both alcohols and aldehydes, thereby catalyzing both sequential steps of ethanol metabolism — the oxidation of ethanol to acetaldehyde and the subsequent oxidation of acetaldehyde to acetate — within a single polypeptide chain. This dual-function architecture ensures coordinate metabolic activity and prevents transient accumulation of the toxic acetaldehyde intermediate.

[0101] In a further embodiment, the fusion polypeptide comprises two or more copies of the amino acid sequence of (c) of paragraph

[0100] , each connected by a peptide linker, thereby providing an ALDH2:ADH7 subunit ratio of at least 2:1 within a single polypeptide chain independent of oligomeric assembly.

[0102] The peptide linker connecting the ADH and ALDH domains may be selected from: (i) a flexible glycine-serine linker comprising (Gly4Ser)n, wherein n is 1 to 5, to provide conformational flexibility between the two enzyme domains and minimize steric interference with active site accessibility; (ii) a rigid alpha-helical linker (e.g., A(EAAAK)nA, where n is 1 to 5) to maintain a defined spatial orientation between the domains; and (iii) a protease-cleavable linker comprising a Factor Xa (IEGR), thrombin (LVPRGS), or TEV protease (ENLYFQS) recognition sequence to enable in situ or in vitro separation of the two enzyme domains if desired.

[0103] Without wishing to be bound by theory, the fusion polypeptide of paragraph

[0100] is expected to assemble into higher-order oligomeric complexes that reflect the native quaternary structures of the constituent enzyme domains. The polypeptide of SEQ ID NO: 1 (ADH7) natively functions as a homodimer, while the polypeptide of SEQ ID NO: 2 (ALDH2) natively functions as a homotetramer. Accordingly, oligomeric assembly of the fusion polypeptide is expected to yield complexes comprising at least two ADH7 subunits and at least four ALDH2 subunits, resulting in an effective ALDH2:ADH7 subunit molar ratio of at least 2:1. This intrinsic stoichiometry is consistent with the experimentally determined optimal subunit molar ratio for synergistic coupled metabolism as demonstrated herein (see FIG. 12), wherein a 2:1 ALDH2:ADH7 subunit molar ratio produced a 3- to 6-fold enhancement in NADH production relative to ADH7 alone across clinically relevant ethanol concentrations. Thus, the fusionDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEpolypeptide architecture inherently provides a stoichiometrically optimized dual-enzyme system without requiring exogenous ratio optimization during formulation.ENHANCERS

[0104] In certain embodiments, the pharmaceutical composition further comprises an enhancer that increases the dehydrogenase activity and stability of the active agent towards alcohols, aldehydes, or both relative to a control composition lacking said enhancer.

[0105] In one embodiment, the enhancer is selected from: (a) a pharmaceutically acceptable organic electron acceptor; (b) a pharmaceutically acceptable allosteric activator or chaperone; (c) a pharmaceutically acceptable NADase modulator; (d) a pharmaceutically acceptable divalent metallic cation (e.g., Zn2+, Mg2+, or Mn2+); (e) a pharmaceutically acceptable mitochondrial electron transport chain modulator; and (f) combinations thereof.

[0106] In a preferred embodiment, the enhancer is beta-nicotinamide adenine dinucleotide (NAD+), or a pharmaceutically acceptable salt, prodrug, analog, or derivative thereof. NAD+ serves as the obligate cofactor for both the ADH- and ALDH-catalyzed dehydrogenase reactions. Both ADH7 and ALDH2 catalyze their respective oxidations via an ordered bi-bi (Theorell-Chance) mechanism in which NAD+ binds first to form the catalytically active binary complex (holo-enzyme) and NADH is released last; in the absence of bound NAD+, the enzyme adopts an inactive apo-conformation. The dissociation constant for the binary enzyme-NAD+ complex (Kia) differs substantially between the two enzymes: Kia is approximately 1.6 mM for ADH7 and approximately 41 pM for ALDH2, such that ADH7 requires approximately 39-fold higher NAD+ concentrations than ALDH2 to achieve equivalent fractional saturation of the catalytically active holo-conformation. Accordingly, for compositions comprising both the ADH and ALDH active agents, the NAD+ concentration sufficient to saturate ADH7 will inherently provide near-complete saturation of ALDH2. Furthermore, because NAD+ is consumed stoichiometrically during each catalytic turnover (one mole of NAD+ is reduced to NADH per mole of substrate oxidized), and because the complete oxidationDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEof ethanol to acetate through the sequential ADH and ALDH reactions consumes two moles of NAD+ per mole of ethanol, the total NAD+ requirement reflects both the equilibrium binding requirement and the stoichiometric substrate demand. Coformulation of exogenous NAD+ with the active agent ensures that cofactor availability does not limit enzymatic activity in the local tissue environment, maintains the enzyme in its catalytically active holo-conformation, and compensates for the low free NAD+ concentrations present in extracellular fluid and plasma (estimated at less than 0.5 pM in human plasma), particularly at sites of subcutaneous or intramuscular injection where endogenous NAD+ pools may be insufficient to support supraphysiological levels of dehydrogenase activity. In certain embodiments, the NAD+ enhancer is present at a molar ratio of at least 0.05 to 1 active agent (0.05:1), such as from 0.05:1 to 10,000:1, from 1:1 to 1,000:1, from 10:1 to 500:1, or from 50:1 to 200:1. In certain embodiments, the NAD+ enhancer is present at a concentration of from about 0.01 mM to about 80 mM. In certain embodiments wherein the active agent comprises a polypeptide having at least 90% sequence identity to SEQ ID NO: 2 without a polypeptide having at least 90% sequence identity to SEQ ID NO: 1, the NAD+ enhancer is present at a concentration of from about 0.01 mM to about 20 mM, such as from about 0.1 mM to about 10 mM, or from about 0.5 mM to about 5 mM. In certain embodiments wherein the active agent comprises a polypeptide having at least 90% sequence identity to SEQ ID NO: 1, alone or in combination with a polypeptide having at least 90% sequence identity to SEQ ID NO: 2, the NAD+ enhancer is present at a concentration of from about 0.1 mM to about 80 mM, such as from about 5 mM to about 80 mM, from about 5 mM to about 50 mM, or from about 10 mM to about 35 mM.

[0107] In another preferred embodiment, the enhancer is a modified nicotinamide adenine dinucleotide analog (NAD+ analog) containing chemical modifications that confer resistance to degradation by NADase enzymes while maintaining cofactor functionality. Endogenous NAD+ is subject to degradation by multiple enzymatic pathways, including CD38 (a major NADase that catalyzes hydrolysis of NAD+ to nicotinamide and ADP-ribose), SARM1 (an NADase activated during axonal degeneration), poly(ADP-ribose) polymerases (PARPs), and sirtuins. A representative NAD+ analog is carbanicotinamide adenine dinucleotide (carba-NAD; CAS Registry No.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE112345-60-5), which exhibits enhanced stability against NADase degradation while retaining the ability to serve as a cofactor for NAD+-dependent dehydrogenases. Coformulation of exogenous NAD+ analogs with the active agent ensures cofactor availability to counter against enzymatic degradation. In certain embodiments, the composition comprises a combination of NAD+ and one or more NAD+ analogs to augment cofactor bioavailability through competitive saturation against NADase degradation.

[0108] In certain embodiments, the enhancer is an allosteric activator belonging to the N-benzylbenzamide chemical class. A representative and non-limiting compound of this class is N-(1,3-benzodioxol-5-ylmethyl)-2,6-dichlorobenzamide (also referred to herein as "ALDA-1"; CAS Registry No. 349438-38-6). ALDA-1 and its structural analogs operate by a mechanism distinct from that of cofactor-competitive agents. N-benzylbenzamide compounds bind within the substrate access tunnel of ALDH2 and act as non-essential activators, augmenting enzymatic turnover by stabilizing the active site conformation without competing with the cofactor at therapeutic concentrations. When co-formulated with the exogenous active agent polypeptide (SEQ ID NO: 2), ALDA-1 is expected to further increase the catalytic efficiency of the exogenous enzyme, providing synergistic enhancement of aldehyde dehydrogenase activity.

[0109] In certain embodiments, the enhancer is Zn2+ provided as a pharmaceutically acceptable zinc salt, including but not limited to zinc gluconate, zinc acetate, zinc sulfate, and zinc chloride. The active agent polypeptide of SEQ ID NO: 1 contains two zinc ions per subunit — one catalytic and one structural — that are essential for enzymatic activity. Exogenous zinc supplementation at physiological concentrations (1 to 50 pM Zn2+) directly stabilizes both the catalytic and structural zinc sites, thereby increasing the ADH catalytic rate and protecting against zinc dissociation that may occur during formulation, storage, or upon dilution in biological fluids following administration.

[0110] In another embodiment, the enhancer is a flavone, or a pharmaceutically acceptable salt, prodrug, analog, or derivative thereof, excluding isoflavones and any flavonoid compound exhibiting net inhibition of dehydrogenase activity at the concentration used. Flavones are a class of polyphenolic compounds that includeDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEquercetin, kaempferol, chrysin, and apigenin. Without being bound by theory, certain flavones have been reported to inhibit CD38 NADase activity (e.g., quercetin IC50 approximately 13.8 pM ; apigenin IC50 approximately 10.3 pM ), thereby preserving endogenous NAD+ pools and maintaining cofactor availability for the co-formulated dehydrogenase active agent. By inhibiting CD38-mediated NAD+ degradation, flavone enhancers are expected to prolong the catalytic activity of the active agent at the site of administration.

[0111] In another embodiment, the enhancer is a peptide of from 3 to 20 amino acids that increases dehydrogenase activity towards an alcohol, an aldehyde, or both relative to a control lacking said peptide. Without being bound by theory, such peptides may coordinate a zinc ion at the active site of the active agent, stabilizing the catalytic zinc coordination geometry and thereby enhancing catalytic turnover. In a specific embodiment, the peptide has the sequence Lys-Pro-Cys (KPC) or a conservative variant thereof retaining zinc-coordinating capacity. The cysteine thiolate and lysine amine groups of such a peptide are expected to interact with the catalytic zinc ion, while the proline residue provides conformational rigidity to position the coordinating residues optimally.

[0112] In another embodiment, the enhancer is a mitochondrial electron transport chain modulator that promotes regeneration of NAD+ from NADH at the site of enzymatic activity, thereby sustaining cofactor availability for the co-formulated dehydrogenase active agent. Representative mitochondrial electron transport chain modulators include, but are not limited to, coenzyme Q10 (ubiquinone; 2,3-dimethoxy-5-methyl-6-decaprenyl-1,4-benzoquinone), which serves as an electron carrier between Complex l / ll and Complex III of the mitochondrial electron transport chain and facilitates oxidation of NADH to NAD+; idebenone (2-(10-hydroxydecyl)-5,6-dimethoxy-3-methyl-2,5-cyclohexadiene-1 ,4-dione), a short-chain synthetic analog of coenzyme Q10 with enhanced aqueous solubility and oral bioavailability; and riboflavin (vitamin B2), a precursor of flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), which serve as prosthetic groups for NADH dehydrogenase (Complex I) and thereby support NADH-to-NAD+ conversion. Without being bound by theory, co-formulation of such modulators with the active agent and exogenous NAD+ is expected to enhance theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEeffective catalytic lifetime of the dehydrogenase active agent by accelerating local regeneration of consumed NAD+ cofactor, particularly at subcutaneous or intramuscular injection sites where mitochondrial oxidative capacity of surrounding tissue cells contributes to the local NAD+ / NADH redox environment.DISPERSANT (HYALURONIDASE)

[0113] In certain embodiments, the pharmaceutical composition further comprises a dispersant that is a soluble recombinant or isolated hyaluronidase. Hyaluronic acid (HA) is a major glycosaminoglycan component of the extracellular matrix in subcutaneous tissue and represents a significant barrier to the dispersion and absorption of injected macromolecular therapeutics. Recombinant human hyaluronidase PH20 (rHuPH20) degrades HA by cleaving the beta-1, 4-glycosidic bond between N-acetylglucosamine and glucuronic acid residues, thereby increasing the dispersion and absorption of coadministered drugs and enabling high-volume subcutaneous injection of up to 600 mL.

[0114] The use of rHuPH20 as a dispersant for subcutaneous drug delivery is clinically validated and has been incorporated into multiple approved pharmaceutical products, including trastuzumab and hyaluronidase-oysk (Herceptin Hylecta, approved 2019), rituximab and hyaluronidase (Rituxan Hycela, approved 2017), daratumumab and hyaluronidase-fihj (DarzalexFaspro, approved 2020), and pertuzumab / trastuzumab / hyaluronidase-zzxf (Phesgo, approved 2020), among others. These approved products demonstrate the safety and efficacy of co-formulating recombinant hyaluronidase with therapeutic proteins for subcutaneous administration.

[0115] The dispersant of the present invention is of EC class 3.2.1.35, is not membrane-bound under physiological conditions, and exhibits hyaluronidase activity at a pH of from 6.8 to 7.4 and over a broader pH range of 6.5 to 8.5. When co-formulated with the active agent, the dispersant increases subcutaneous tissue spreading of the active agent by at least 20% relative to the active agent formulated without the dispersant, as measured in an ex vivo porcine skin spreading assay. The dispersant is not the sole active pharmaceutical ingredient of the composition.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0116] In certain embodiments, the active agent and the dispersant are present in a molar ratio of from 1:1 to 1:100 and interact cooperatively to increase the rate of alcohol or aldehyde clearance relative to the additive effect of each component administered separately.

[0117] In certain embodiments, the dispersant is a soluble recombinant hyaluronidase comprising: (a) a catalytic (beta / alpha)8 TIM barrel domain comprising a conserved DXXD catalytic tetrad motif; (b) an EGF-like domain C-terminal to the TIM barrel domain; and (c) a C-terminus truncated such that the polypeptide lacks a functional glycosylphosphatidylinositol (GPI) anchor attachment signal sequence. Such a dispersant is expressed by a recombinant mammalian host cell and has a molecular weight of from 50 kDa to 80 kDa as determined by SDS-PAGE under reducing conditions.

[0118] In certain embodiments, the dispersant comprises an amino acid sequence having at least 90% sequence identity to residues 36 to 482 of a human hyaluronidase precursor (e.g., human HYAL1 or PH20) or residues 30 to 447 of a bovine hyaluronidase precursor, and exhibits hyaluronidase activity at a pH of from 6.8 to 7.4.ADJUNCT AGENTS

[0119] In certain embodiments, the pharmaceutical composition of the present invention is co-formulated with, co-packaged with, or co-administered with fibroblast growth factor 21 (FGF21), an FGF21 analog, or an FGF21 fusion protein. FGF21 is an endogenous hepatokine that is robustly and rapidly induced by ethanol metabolism through the ADH-ALDH pathway in the liver. Ethanol catabolism by alcohol dehydrogenase and aldehyde dehydrogenase generates the metabolic intermediates glycerol-3-phosphate and acetyl-CoA, which activate the transcription factor ChREBP and promote histone acetylation at the Fgf21 gene promoter, respectively, resulting in rapid transcriptional induction of FGF21 in hepatocytes. This mechanistic link between the ADH-ALDH metabolic pathway and FGF21 induction establishes a direct physiological connection between the active agents of the present invention and the FGF21 co-administration embodiment.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0120] Exogenous FGF21 administration is expected to provide complementary therapeutic benefits through at least three distinct and independent mechanisms. First, hepatoprotection against alcohol-induced steatosis, inflammation, and oxidative injury; preclinical studies have demonstrated that FGF21 deficiency exacerbates chronic alcohol-induced liver injury and that exogenous FGF21 administration protects the liver from ethanol-induced hepatic damage. Second, suppression of alcohol preference and alcohol-seeking behavior through central nervous system action; FGF21 signals via the FGFR1c / beta-Klotho receptor complex in the brain, activating an amygdalo-striatal circuit that suppresses ethanol consumption, and preclinical studies have demonstrated that FGF21 analogs reduce alcohol intake, alcohol preference, and progressive-ratio breakpoints for alcohol self-administration. Third, broad metabolic regulation including reduction of hepatic lipid accumulation, improvement of triglyceride clearance, and reduction of atherogenic lipoproteins; clinical studies with long-acting FGF21 analogs have demonstrated significant reductions in liver fat, triglycerides, and improvement of liver fibrosis.

[0121] Suitable FGF21 agents for co-administration include native human FGF21, glycoPEGylated FGF21 analogs, Fc-FGF21 fusion proteins, and long-acting FGF21 variants engineered for extended half-life. In certain embodiments, the FGF21 or FGF21 analog is administered at a dose of about 0.01 to about 10 mg / kg body weight. The FGF21 or FGF21 analog may be co-formulated with the active agent polypeptides in a single pharmaceutical composition, provided in a separate container and co-packaged with the pharmaceutical composition in a kit, or administered separately.PHARMACEUTICAL FORMULATIONS

[0122] The pharmaceutical compositions of the present invention are formulated with a pharmaceutically acceptable carrier, excipient, diluent, or buffer. In certain embodiments, the composition is formulated as a sterile aqueous liquid formulation or a lyophilized formulation for reconstitution prior to administration.

[0123] In certain embodiments, the sterile aqueous liquid formulation has a pH of from 6.0 to 8.0, such as from 6.5 to 7.5, and further comprises one or more stabilizersDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEselected from trehalose, sucrose, mannitol, sorbitol, and polysorbate 80. Additional excipients may include tonicity agents (e.g., sodium chloride), buffering agents (e.g., histidine, phosphate, Tris, or acetate), and antioxidants (e.g., methionine).

[0124] In certain embodiments, the composition is contained in a delivery device selected from: a prefilled syringe; an autoinjector; a pen injector comprising a singlechamber cartridge; a pen injector comprising a dual-chamber cartridge having a first chamber containing a lyophilized form of the composition and a second chamber containing a pharmaceutically acceptable diluents (see FIG. 16); a vial; and an intravenous infusion bag. The dual-chamber pen injector configuration is particularly advantageous for compositions in which the active agent requires lyophilization for longterm stability and reconstitution immediately prior to administration, enabling patient self-administration in a home care setting.NUCLEIC ACIDS, mRNA-LNP FORMULATIONS, EXPRESSION VECTORS, AND HOST CELLS

[0125] The present invention further provides isolated nucleic acid molecules encoding the active agent polypeptides. In certain embodiments, the nucleic acid molecule is a complementary DNA (cDNA) molecule or comprises a codon-optimized nucleotide sequence that does not occur in nature. Codon optimization may be performed to enhance expression in a specific host cell type, such as E. coli, P. pastoris, CHO, or HEK293 cells.

[0126] In certain embodiments, the invention provides an mRNA molecule encoding the active agent polypeptide (see FIG. 8), formulated in a lipid nanoparticle (LNP). The LNP comprises: (a) an ionizable cationic lipid; (b) a neutral helper lipid; (c) a structural lipid comprising cholesterol; and (d) a PEG-lipid. The ionizable cationic lipid, neutral helper lipid, structural lipid, and PEG-lipid are present in a molar ratio of about 40-50 : 10-15 : 35-45 : 1-3, respectively. The LNP has a mean hydrodynamic diameter of about 50 nm to about 200 nm and is formulated for intramuscular or subcutaneous administration.

[0127] In certain embodiments, the mRNA comprises one or more modified nucleosides selected from N1-methylpseudouridine, pseudouridine, 5-methylcytidine, and 2-DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEthiouridine. Modified nucleosides reduce innate immune activation by evading Toll-like receptor (TLR) 3, TLR7, and TLR8 recognition, and enhance translational efficiency and mRNA stability, as first demonstrated by Kariko and Weissman.

[0128] The present invention further provides expression vectors comprising the nucleic acid molecule operably linked to at least one promoter functional in a host cell. Suitable expression vectors include plasmids, adeno-associated virus (AAV) vectors, lentiviral vectors, adenoviral vectors, and baculovirus vectors. Suitable promoters include the cytomegalovirus (CMV) promoter, the elongation factor 1 -alpha (EF1 -alpha) promoter, the phosphoglycerate kinase (PGK) promoter, the alcohol oxidase 1 (AOX1) promoter, and the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) promoter. In certain embodiments, the expression vector further comprises a signal peptide sequence operably linked to the N-terminus of the polypeptide that directs secretion from the host cell.

[0129] The present invention further provides recombinant host cells comprising the expression vector. Suitable host cells include Komagataellaphaffii (syn. Pichia pastoris), Escherichia coli, Spodoptera frugiperda Sf9 or Sf21 cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK293) cells, and baby hamster kidney (BHK) cells.METHODS OF TREATMENT

[0130] The present invention provides methods of treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject in need thereof, comprising administering to said subject a therapeutically effective amount of the pharmaceutical composition described herein. Without being bound by theory, parenteral administration of the exogenous dehydrogenase active agent provides enzymatic alcohol and aldehyde clearance capacity in extrahepatic compartments, thereby reducing the metabolic burden on the liver. Furthermore, by augmenting the primary oxidative ADH-ALDH pathway, exogenous enzyme supplementation is expected to reduce diversion of excess ethanol to alternative metabolic pathways, including CYP2E1 -mediated oxidation (which generates reactive oxygen species) and non-oxidative conjugationDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEpathways which generate fatty acid ethyl esters (FAEEs) and phosphatidylethanol (PEth), thereby mitigating the formation of toxic byproducts associated with hepatic, pancreatic, and cardiac injury.

[0131] Pathological accumulation of alcohols, aldehydes, or both may be associated with a condition selected from ethanol toxicity, methanol toxicity, formaldehyde toxicity, acetaldehyde toxicity, ethylene glycol poisoning, fetal alcohol spectrum disorder, genetic alcohol or aldehyde dehydrogenase deficiencies, reduced-activity alcohol or aldehyde dehydrogenase polymorphisms, Fanconi anemia, bone marrow failure syndromes, alcohol use disorder, cardiovascular disease, Alzheimer's disease, liver cancer, and gastroesophageal cancer. Pathological ethanol toxicity is characterized by blood alcohol concentrations in the range of approximately 10 mM to 80 mM (approximately 46 to 368 mg / dL), with concentrations above approximately 87 mM (approximately 400 mg / dL or 0.40 g / dL) considered potentially lethal.

[0132] In preferred embodiments, the subject is a human having a genetic aldehyde dehydrogenase 2 (ALDH2) deficiency or dysfunction, such as a subject homozygous or heterozygous for the ALDH2*2 (E487K) allele.

[0133] Administration is preferably parenteral, selected from intravenous, intramuscular, subcutaneous, intradermal, and intraperitoneal administration. Subcutaneous administration is particularly preferred for chronic or prophylactic use and may be facilitated by co-formulation with the hyaluronidase dispersant.

[0134] In certain embodiments, administering the pharmaceutical composition results in a reduction in the level of alcohols, aldehydes, or both in a biological sample obtained from said subject relative to a pre-administration baseline level. The biological sample may be selected from exhaled breath gas (as measured by a breathalyzer or similar device), exhaled breath condensate, plasma, serum, cerebrospinal fluid, urine, and tissue biopsy.

[0135] The kinetic properties of the SEQ ID NO: 1 (ADH7) polypeptide confer a dosedependent increase in systemic ethanol clearance that is additive to the endogenous hepatic elimination rate of approximately 7 g per hour. Because ADH7 exhibits a Michaelis constant (Km) for ethanol of approximately 25 to 37 mM, the enzymeDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEoperates at increasing fractional saturation — and therefore increasing catalytic contribution — at progressively higher blood alcohol concentrations: approximately 21% of maximal velocity (Vmax) at 10 mM (0.046% BAG), approximately 35% at 20 mM (0.092% BAC), approximately 51% at 40 mM (0.184% BAC), and approximately 68% at 80 mM (0.369% BAC). At a dose of about 1 mg / kg body weight, the ADH7 polypeptide provides an additional ethanol clearance capacity of approximately 1.6 to 5.0 g per hour across the range of 10 to 80 mM blood ethanol concentration, representing an approximately 1.2-fold to 1.7-fold increase in total systemic clearance. At a dose of about 2 mg / kg body weight, the additional clearance capacity is approximately 3.1 to 10.0 g per hour, representing an approximately 1.4-fold to 2.4-fold increase. At a dose of about 4 mg / kg body weight, the additional clearance capacity is approximately 6.2 to 20.0 g per hour, representing an approximately 1.9-fold to 3.9-fold increase in total clearance. In certain embodiments, the therapeutically effective amount of the active agent polypeptide comprising SEQ ID NO: 1 is from about 0.5 mg / kg to about 10 mg / kg body weight; in preferred embodiments, from about 1 mg / kg to about 5 mg / kg body weight. This direct relationship between fractional saturation and substrate concentration ensures that the exogenous ADH7 polypeptide provides its greatest relative contribution to ethanol clearance at the highest and most clinically dangerous blood alcohol concentrations, where endogenous Class I ADH enzymes are fully saturated and unable to increase their metabolic rate.

[0136] In embodiments wherein the pharmaceutical composition comprises both a polypeptide having dehydrogenase activity towards alcohols (SEQ ID NO: 1) and a polypeptide having dehydrogenase activity towards aldehydes (SEQ ID NO: 2), the relative amounts of the two polypeptides may be adjusted based on the clinical indication, the target blood alcohol concentration, and the endogenous ALDH2 status of the subject. The catalytic turnover number (kcat) of ADH7 for ethanol (approximately 1,510 per minute) substantially exceeds that of ALDH2 for acetaldehyde (280 per minute), such that on a per-subunit molar basis, ADH7 generates acetaldehyde faster than ALDH2 can consume it. The minimum molar ratio of ALDH2 to ADH7 (ALDH2:ADH7) required to match the rate of acetaldehyde production increases with blood ethanol concentration due to the increasing fractional saturation of ADH7:DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEapproximately 1:1 at 10 mM ethanol (approximately 0.046% BAC), approximately 1.9:1 at 17.4 mM ethanol (U.S. legal intoxication limit), approximately 2.8:1 at 40 mM ethanol, and approximately 3.7:1 at 80 mM ethanol. Because the molecular weight of the ALDH2 subunit (approximately 56 kDa) exceeds that of the ADH7 subunit (approximately 40 kDa), the corresponding minimum weight-to-weight ratios (ALDH2:ADH7) are approximately 1.3:1 at 10 mM ethanol, approximately 1.9:1 at 17.4 mM, approximately 3.1 :1 at 40 mM, and approximately 4.1:1 at 80 mM. These rate-matching ratios represent theoretical minima in the absence of endogenous ALDH2 activity; in subjects with functional endogenous ALDH2 (wild-type ALDH2*1 / *1 genotype), the endogenous mitochondrial ALDH2 pool substantially supplements the exogenous enzyme, permitting the use of lower ALDH2:ADH7 ratios or ADH7-enriched formulations.Unexpectedly, the present inventors have discovered that coupled administration of the polypeptides of SEQ ID NO: 1 and SEQ ID NO: 2 produces a synergistic enhancement of NADH production that substantially exceeds the theoretical 2-fold maximum predicted by stoichiometric coupling alone (i.e., one NADH from the ADH7-catalyzed step plus one NADH from the ALDH2-catalyzed step per molecule of ethanol). At an ALDH2:ADH7 subunit molar ratio of 2:1 , the coupled system produced approximately 3.4-fold to 5.4-fold greater NADH production relative to ADH7 alone across clinically relevant ethanol concentrations of 10 to 80 mM (see FIG. 13). At an ALDH2:ADH7 subunit molar ratio of 4:1, NADH production reached approximately 8.1-fold relative to ADH7 alone, plateauing at this level through an 8:1 ratio (see FIG. 12). Without wishing to be bound by theory, this synergistic enhancement is believed to result from the continuous removal of acetaldehyde by ALDH2, which relieves product inhibition of the ADH7-catalyzed forward reaction and shifts the equilibrium of ethanol oxidation towards product formation, thereby increasing the effective catalytic rate of ADH7 beyond what is achievable in the absence of the coupled ALDH2 partner. This synergistic mechanism was further confirmed in human plasma, where the coupled system at a 2:1 subunit molar ratio produced approximately 3.1 -fold greater NADH production relative to ADH7 alone at 80 mM ethanol (see FIG. 14), demonstrating that the synergistic enhancement is maintained in a physiological matrix.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEAs a consequence of this synergistic coupling, effective rate-matched metabolism of ethanol and acetaldehyde is achieved at ALDH2:ADH7 subunit molar ratios substantially lower than the theoretical minima calculated from kcat values alone. In preferred embodiments, the ALDH2:ADH7 subunit molar ratio is from about 1:1 to about 8:1 ; in more preferred embodiments, from about 2:1 to about 4:1. An ALDH2:ADH7 subunit molar ratio of 2:1 corresponds to a holoenzyme ratio of approximately 1 :1 (one ALDH2 tetramer per ADH7 dimer) and is the intrinsic stoichiometry provided by fusion polypeptide embodiments described.When the ALDH2:ADH7 molar ratio meets or exceeds the synergistically effective ratios described above, the steady-state acetaldehyde concentration maintained by the coupled enzymatic system is determined by the Michaelis-Menten kinetics of ALDH2 (Km for acetaldehyde approximately 0.2 pM) and the fraction of ALDH2 catalytic capacity utilized. At an ALDH2:ADH7 subunit molar ratio of 2:1 , the ALDH2 polypeptide operates below its maximal capacity, maintaining steady-state acetaldehyde at approximately 0.2 to 0.4 pM. At higher ratios (4:1 and above), steady-state acetaldehyde is maintained below 0.2 pM (at or below the Km of ALDH2). These steady-state concentrations represent a reduction of greater than 98% relative to peak blood acetaldehyde concentrations of approximately 75 pM observed in untreated ALDH2-deficient heterozygous (ALDH2*1 / 2) individuals following moderate ethanol consumption, and are comparable to or below the circulating acetaldehyde concentrations observed in normal ALDH21 / *1 homozygous individuals (approximately 2 to 5 pM). Accordingly, in embodiments wherein the pharmaceutical composition comprises both the polypeptide of SEQ ID NO: 1 and the polypeptide of SEQ ID NO: 2 at an ALDH2:ADH7 subunit molar ratio of at least 2:1 , administration of the composition to an ALDH2-deficient subject is expected to reduce blood acetaldehyde concentration by at least 20%, at least 50%, at least 90%, or at least 98% relative to the preadministration acetaldehyde level.

[0137] In certain embodiments, the method further comprises administering a second therapeutic agent, distinct from the active agent, that reduces the biosynthesis or enhances the degradation of alcohols, aldehydes, or both. The second therapeutic agent may be an activator or positive allosteric modulator of dehydrogenase activity, aDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEdistinct enzyme exhibiting dehydrogenase activity, an activating peptide, or a combination thereof. The active agent and the second therapeutic agent may be administered simultaneously, sequentially, or separately, and may be present in a single pharmaceutical composition or in separate compositions.KITS

[0138] The present invention provides kits comprising: (a) the pharmaceutical composition; and (b) instructions for use directing administration of the pharmaceutical composition to a subject for treating or preventing pathological accumulation of alcohols, aldehydes, or both. In certain embodiments, the kit further comprises a second therapeutic agent in a separate container and instructions for co-administration.

[0139] In certain embodiments, the pharmaceutical composition is provided as a lyophilized composition in a first container and the kit further comprises a pharmaceutically acceptable diluent in a second container. The first and second containers may be chambers of a dual-chamber cartridge configured for use with a pen injector, said dual-chamber cartridge comprising a first chamber containing said lyophilized composition and a second chamber containing said diluent, and the kit further comprises a pen injector configured to receive said dual-chamber cartridge (see FIG. 16).EXAMPLESThe following examples illustrate certain aspects and embodiments of the present invention. Examples 1 through 10 describe experiments that have been performed and are presented in the past tense. Examples 11 through 32 are prophetic examples presented in the present tense describing expected results based on the principles disclosed herein.Example 1: Dehydrogenase Activity Assay

[0140] This example describes an assay for measuring the dehydrogenase activity of the purified active agent polypeptides.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0141] Dehydrogenase activity towards alcohols (for SEQ ID NO: 1 -derived polypeptides) or aldehydes (for SEQ ID NO: 2-derived polypeptides) was measured spectrophotometrically by monitoring the reduction of NAD+ to NADH at 340 nm (extinction coefficient 6,220 M-1 cm-1) using a UVA / is spectrophotometer in a thermostatted cuvette at 25 degrees Celsius.

[0142] For the alcohol dehydrogenase activity assay, a standard reaction mixture (210 pL total volume) contained 50 mM Tris buffer (pH 8.0), 10 mM NAD+, and varying concentrations of ethanol (1 mM to 500 mM) in water. The reaction was initiated by adding the purified enzyme (1 to 25pg) and monitoring the increase in absorbance at 340 nm for at least 5 minutes. One unit (II) of enzyme activity is defined as the amount of enzyme that catalyzes the production of 1 micromole of NADH per minute under the assay conditions.

[0143] For the aldehyde dehydrogenase activity assay, a standard reaction mixture (210 pL total volume) contained 50 mM Tris buffer (pH 8.0), 10 mM NAD+, and varying concentrations of acetaldehyde or formaldehyde (0.1 mM to 100 mM) in water. The reaction was initiated by adding the purified enzyme (1 to 25 pg) and monitoring the increase in absorbance at 340 nm for at least 5 minutes.

[0144] Kinetic parameters (Km and Vmax) were determined by fitting the initial velocity data to the Michaelis-Menten equation using nonlinear regression analysis. Specific activity was expressed as units per milligram of protein (U / mg).Example 2: Recombinant Expression of SEQ ID NO: 1 (ADH7) in CHO Cells

[0145] This example describes the expression of the active agent polypeptide SEQ ID NO: 1 (ADH7) in Chinese hamster ovary (CHO) cells.

[0146] A codon-optimized nucleotide sequence encoding SEQ ID NO: 1 (ADH7) was synthesized and cloned into the pcDNA3.4 mammalian expression vector (ThermoFisher) downstream of the CMV promoter and upstream of the WPRE element, and in-frame with a human IgG kappa signal peptide sequence for secretion.

[0147] CHO-ES cells (Expression Systems) were transiently transfected using polyethylenimine (PEI). Enzymes were produced as a suspension culture in serum-freeDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEmedia. Expression was carried out transiently in vented flasks under orbital agitation in mild hypothermic conditions following transfection. Cell viability and protein expression were monitored (Beckman Coulter Vi-Cell) and the batch culture was harvested at days 7 to 12 with a target cell viability of 65 to 70%. Upon harvest, the culture was centrifuged, clarified, and sterile-filtered using vacuum filtration (Sartorius). Supernatant polypeptides were concentrated and buffer-exchanged using a 10 kDa MWCO tangential flow filtration (TFF) membrane and purified with liquid chromatography (GE AKTA) using columns containing Cibacron Blue F3G-A affinity, ion exchange, and size exclusion media (Cytiva). Polypeptides were assessed for purity using analytical size exclusion HPLC (Agilent) and characterized for molecular mass by SDS-PAGE (Biorad). Functionality was confirmed by dehydrogenase activity assays containing ethanol substrate and NAD+ cofactor (Sigma), yielding a protein with subunit molecular weight of approximately 40kDa and a Km of approximately 25mM.Example 3: Recombinant Expression of SEQ ID NO: 2 (ALDH2) in E. Coli Cells

[0148] This example describes the recombinant expression of an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 2 from Escherichia coli.

[0149] A codon-optimized nucleotide sequence encoding SEQ ID NO: 2 was synthesized and cloned into the pET-28a(+) expression vector (MilliporeSigma) downstream of the T7 promoter. The construct was transformed into E. coli BL21(DE3) competent cells by heat shock.

[0150] Transformants were selected on LB agar plates containing 50 pg / mL kanamycin. High-expressing clones were identified by screening expression in small-scale cultures induced with 0.5 mM isopropyl p-D-1-thiogalactopyranoside (IPTG) at 18 degrees Celsius for 16 to 20 hours. Co-expression of the GroEL / GroES chaperonin system (plasmid pGro7, Takara) was employed to facilitate proper folding and tetramer assembly of the ALDH2 polypeptide. Expression levels were assessed by dehydrogenase activity assay.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0151] A selected high-expressing clone was grown in 2 L of Terrific Broth (TB) medium supplemented with 50 pg / mL kanamycin and 34 pg / mL chloramphenicol at 37 degrees Celsius to an OD600 of approximately 0.6 to 0.8. Chaperone expression was induced by addition of 0.5 mg / mL L-arabinose, followed by IPTG induction at 0.5 mM, and cultures were shifted to 18 degrees Celsius for 16 to 20 hours. Cells were harvested by centrifugation, resuspended in lysis buffer (50 mM sodium phosphate pH 7.4, 300 mM NaCI, 10 mM imidazole, 1 mM EDTA), and lysed by high-pressure homogenization. The soluble fraction was clarified by centrifugation and purified with liquid chromatography (GE AKTA) using columns containing 2',5'-ADP affinity, ion exchange, and size exclusion media (Cytiva). Polypeptides were assessed for purity using analytical size exclusion HPLC (Agilent) and characterized for molecular mass by SDS-PAGE (BioRad). Functionality was confirmed by dehydrogenase activity assays containing acetaldehyde substrate and NAD+ cofactor (Sigma), yielding a protein with subunit molecular weight of approximately 55 kDa and a Km of approximately 0.2 pM.Example 4: NAD+ Cofactor Dependence of SEQ ID NO: 1 (ADH7)

[0152] This example demonstrates that the dehydrogenase activity of the polypeptide of SEQ ID NO: 1 (ADH7) is dependent on the concentration of the NAD+ cofactor.

[0153] The purified active agent polypeptide (SEQ ID NO: 1) was incubated with 200 mM ethanol substrate and NAD+ at concentrations of 0.1, 0.25, 0.5, 1.0, 2.5, 5, 10, and 20 mM in assay buffer. NADH production was monitored by absorbance at 340 nm over 30 minutes (Biotek Agilent).

[0154] As shown in FIG. 9, dehydrogenase activity increased in a dose-dependent manner with increasing NAD+ concentration from 0.1 to 20 mM. Minimal activity was observed at NAD+ concentrations below 0.5 mM, with activity increasing substantially above 1.0 mM and continuing to increase through 20 mM without reaching a plateau. These results confirm the ordered bi-bi kinetic mechanism of ADH7, wherein NAD+ binding is required for catalytic activity, and demonstrate that co-formulation of the active agent with NAD+ at concentrations of at least about 1 mM, preferably at leastDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEabout 5 mM, provides substantially enhanced dehydrogenase activity relative to compositions lacking exogenous NAD+.Example 5: Dose-Dependent Ethanol Oxidation by SEQ ID NO: 1 (ADH7) Across Clinically Relevant Blood Alcohol Concentrations

[0155] This example describes an assay evaluating the catalytic activity of the polypeptide of SEQ ID NO: 1 (ADH7) across clinically relevant pathological ethanol concentrations.

[0156] The purified polypeptide of SEQ ID NO: 1 (21 pg) was incubated at 25 degrees Celsius in a reaction mixture (210pL) containing 50 mM Tris buffer (pH 8.0) and 10 mM NAD+ with ethanol at concentrations of 10 mM, 20 mM, 40 mM, and 80 mM, corresponding to approximately 0.05%, 0.09%, 0.18%, and 0.37% blood alcohol concentration (BAC), respectively. NADH production was monitored continuously by absorbance at 340 nm over 120 minutes using a UVA / is spectrophotometer (Biotek Agilent). As shown in FIG. 10, the rate of NADH production increased with increasing ethanol concentration, demonstrating that ADH7 catalytic activity continues to rise across the pathological BAC range, consistent with its high Michaelis constant (Km 25 to 37 mM) for ethanol. Absorbance at A340 = 1.0 indicates the upper limit of spectrophotometric linearity, such that values above this threshold may underestimate true enzymatic activity. These results confirm that SEQ ID NO: 1 maintains increasing catalytic throughput at ethanol concentrations where endogenous hepatic Class I ADH enzymes are fully saturated.Example 6: Acetaldehyde Clearance by SEQ ID NO: 2 (ALDH2) at Pathologically Relevant Concentrations

[0157] This example describes the predicted clearance of acetaldehyde by the polypeptide of SEQ ID NO: 2 (ALDH2) at concentrations spanning the pathological range observed in ALDH2-deficient individuals.

[0158] Acetaldehyde clearance curves were modeled at initial concentrations of 10, 25, 50, 75, and 100 pM using experimentally determined kinetic parameters for the purified polypeptide of SEQ ID NO: 2: a maximal catalytic rate (Vmax) of 52 pM per minute, aDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEKm for acetaldehyde of 0.2 pM, determined from progress curve analysis of the polypeptide of SEQ ID NO: 2 under assay conditions of 10 mM acetaldehyde substrate (Sigma), 100 mM NAD+ cofactor, and 15 pg total protein in 210 pL at 25 degrees Celsius. As shown in FIG. 11, the polypeptide of SEQ ID NO: 2 achieves complete clearance (to below 1 pM) of acetaldehyde at all concentrations tested within approximately 2 minutes. Acetaldehyde at 100 pM, representing the most severe pathological levels observed in homozygous ALDH2*2 / *2 individuals, was cleared to below 1 pM in approximately 2 minutes; acetaldehyde at 25 pM, representing peak levels in heterozygous ALDH2*1 / *2 individuals, was cleared in approximately 30 seconds. The rate of acetaldehyde reduction was approximately linear at each starting concentration, reflecting the fact that the enzyme operates at near-maximal catalytic velocity (greater than 98% of Vmax) across the entire pathological acetaldehyde range, owing to the remarkably low Km of ALDH2 for acetaldehyde (0.2 pM). These results demonstrate that the polypeptide of SEQ ID NO: 2 possesses sufficient catalytic capacity to rapidly eliminate acetaldehyde at all clinically relevant pathological concentrations.Example 7: Synergistic Coupled Metabolism at Varying ALDH2:ADH7 Subunit Molar Ratios

[0159] This example demonstrates the effect of varying the subunit molar ratio of ALDH2 (SEQ ID NO: 2) to ADH7 (SEQ ID NO: 1) on coupled sequential metabolism of ethanol.

[0160] Reaction mixtures (210 pL) were prepared containing 40 mM ethanol, 10 mM NAD+, and the polypeptide of SEQ ID NO: 1 (ADH7) at a fixed amount, with the polypeptide of SEQ ID NO: 2 (ALDH2) added at subunit molar ratios (ALDH2:ADH7) of 0:1 (ADH7 alone), 1 :1, 2:1, 4:1, and 8:1 in Tris buffer (pH 8.0) at 25 degrees Celsius. A control containing the polypeptide of SEQ ID NO: 2 alone (ALDH2 alone, no ADH7) was included to confirm the absence of NADH production without ADH7-generated acetaldehyde substrate. NADH production was monitored by absorbance at 340 nm, and initial rates were calculated from the linear portion of each progress curve. Fold increase in NADH production was calculated relative to the ADH7-alone condition.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0161] As shown in FIG. 12, ALDH2 alone produced no detectable NADH, confirming that acetaldehyde must be generated in situ by ADH7 for the coupled pathway to proceed. At an ALDH2:ADH7 subunit molar ratio of 1:1, NADH production increased 2.8-fold relative to ADH7 alone. At a ratio of 2:1, the increase was 6.0-fold, and at 4:1, the increase reached 8.1-fold. No further increase was observed at 8:1 (8.1-fold), indicating that the synergistic enhancement plateaus at a subunit molar ratio of approximately 4:1. These fold increases substantially exceed the theoretical maximum of 2-fold predicted by stoichiometric coupling alone (one NADH from the ADH7-catalyzed step plus one NADH from the ALDH2-catalyzed step per molecule of ethanol oxidized), demonstrating a synergistic enhancement attributable to the continuous removal of acetaldehyde by ALDH2, which relieves product inhibition of the ADH7-catalyzed forward reaction and shifts the equilibrium of ethanol oxidation toward product formation. Notably, an ALDH2:ADH7 subunit molar ratio of 2:1 corresponds to a holoenzyme ratio of approximately 1 :1 (one ALDH2 homotetramer per ADH7 homodimer) and is the intrinsic stoichiometry provided by certain fusion polypeptide embodiments of the invention.Example 8: Synergistic Coupled Metabolism Across Clinically Relevant Ethanol Concentrations

[0162] This example demonstrates that the synergistic enhancement of coupled sequential metabolism by the polypeptides of SEQ ID NO: 1 (ADH7) and SEQ ID NO: 2 (ALDH2) is maintained across the clinically relevant range of blood ethanol concentrations.

[0163] Reaction mixtures (210 pL) were prepared containing 10 mM NAD+ and ethanol at concentrations of 10, 20, 40, and 80 mM (corresponding to approximately 0.05%, 0.09%, 0.18%, and 0.37% BAC, respectively) in Tris buffer (pH 8.0) at 25 degrees Celsius. Each ethanol concentration was tested under two conditions: the polypeptide of SEQ ID NO: 1 alone (ADH7 alone), and the polypeptides of SEQ ID NO: 2 (ALDH2) and SEQ ID NO: 1 (ADH7) combined at an ALDH2:ADH7 subunit molar ratio of 2:1. NADH production was monitored by absorbance at 340 nm, and initial rates (AA340 / min) were calculated from the linear portion of each progress curve.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0164] As shown in FIG. 13, the ADH7-alone rate increased with ethanol concentration (0.011, 0.016, 0.023, and 0.034 AA340 / min at 10, 20, 40, and 80 mM, respectively), consistent with Michaelis-Menten kinetics and a Km of approximately 25 to 37 mM for ethanol. The coupled dual-enzyme system at 2:1 subunit molar ratio produced substantially higher initial rates at every ethanol concentration tested (0.058, 0.067, 0.100, and 0.114 AA340 / min at 10, 20, 40, and 80 mM, respectively), corresponding to fold increases of 5.4, 4.1, 4.3, and 3.4 relative to ADH7 alone. These fold increases exceed the theoretical 2-fold maximum from stoichiometric coupling at all ethanol concentrations, confirming that the synergistic enhancement observed in Example 7 is maintained across the entire pathological BAC range. The highest fold increase (5.4-fold) was observed at the lowest ethanol concentration (10 mM), consistent with the greater relative benefit of acetaldehyde removal when ADH7 operates at lower fractional saturation and is more susceptible to product inhibition. These results demonstrate that the dual-enzyme composition provides synergistically enhanced ethanol metabolism at ethanol concentrations spanning mild intoxication (10 mM, -0.05% BAC) through life-threatening intoxication (80 mM, -0.37% BAC).Example 9: Synergistic Coupled Metabolism in Human Plasma

[0165] This example demonstrates that the synergistic enhancement of coupled sequential metabolism by the polypeptides of SEQ ID NO: 1 (ADH7) and SEQ ID NO: 2 (ALDH2) is maintained in a physiological matrix.

[0166] Human plasma (Innovative Research) was supplemented with 80 mM ethanol (corresponding to approximately 0.37% BAC; life-threatening intoxication severity) and 10 mM NAD+. The polypeptide of SEQ ID NO: 1 was added alone (ADH7 alone) or in combination with the polypeptide of SEQ ID NO: 2 (ALDH2) at an ALDH2:ADH7 subunit molar ratio of 2:1. The enzyme-to-plasma ratio was 1 :9 (v / v) to maintain the plasma matrix composition. NADH production was monitored by absorbance at 340 nm over 45 minutes at 25 degrees Celsius.

[0167] As shown in FIG. 14, the ADH7-alone condition exhibited an initial rate that declined markedly after approximately 15 minutes, consistent with accumulation of the acetaldehyde product in the absence of ALDH2-mediated clearance. In contrast, theDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEcoupled dual-enzyme system at 2:1 subunit molar ratio maintained a sustained linear rate of NADH production throughout the 45-minute observation period. The overall rate of NADH production by the dual-enzyme system was approximately 3.1 -fold greater than ADH7 alone, exceeding the theoretical 2-fold stoichiometric maximum and confirming synergistic enhancement in human plasma. The sustained linearity of the dual-enzyme progress curve further demonstrates that continuous acetaldehyde removal by ALDH2 prevents the product inhibition that limits ADH7 activity in the singleenzyme condition. These results establish that the synergistic coupled metabolism observed in buffered assay conditions (Examples 7 and 8) is preserved in the presence of plasma proteins, lipids, and endogenous metabolites, supporting the therapeutic utility of the dual-enzyme composition for in vivo administration.Example 10: Subcutaneous Tissue Spreading of Dehydrogenase Co-Formulation with Hyaluronidase Dispersant

[0168] This example demonstrates the effect of a soluble recombinant hyaluronidase dispersant on subcutaneous tissue spreading of a pharmaceutical composition comprising the active agents of SEQ ID NO: 1 (ADH7) and SEQ ID NO: 2 (ALDH2).

[0169] A soluble recombinant human PH20 hyaluronidase (rHuPH20) was obtained as a C-terminally truncated form lacking the GPI anchor attachment signal, having a molecular weight of approximately 60 kDa by SDS-PAGE.

[0170] The active agents SEQ ID NO: 1 (ADH7) and SEQ ID NO: 2 (ALDH2) at 5 mg / mL and NAD+ at 10 mM were co-formulated with rHuPH20 at concentrations of 0 (control), 313, 625, 1,250, 2,500, and 5,000 U / mL in a buffer comprising 20 mM histidine-HCI (pH 7.5), 130 mM NaCI, 5% (w / v) sucrose, and 0.01% (w / v) polysorbate 80. The co-formulated compositions were sterile-filtered and filled into glass vials.

[0171] The effect of rHuPH20 concentration on subcutaneous tissue spreading was evaluated using an ex vivo porcine skin spreading assay. Briefly, 1 mL of each coformulated composition (containing trypan blue dye as a tracer) was injected subcutaneously into excised full-thickness porcine skin samples. After a 10-minuteDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEincubation period, the skin was dissected and the diameter of dye spreading was measured.

[0172] As shown in FIG. 15, tissue spreading increased in a dose-dependent manner with increasing rHuPH20 concentration. The control composition (0 U / mL rHuPH20) produced a spread diameter of 6 mm. At 313 U / mL rHuPH20, the spread diameter increased to 8 mm; at 625 U / mL, to 11 mm; at 1 ,250 U / mL, to 13 mm; at 2,500 U / mL, to 15 mm; and at 5,000 U / mL, to 16 mm. The corresponding spreading areas, calculated as TT(d / 2)2, increased from approximately 28 mm2(control) to approximately 50 mm2(313 U / mL), 95 mm2(625 U / mL), 133 mm2(1,250 U / mL), 177 mm2(2,500 U / mL), and 201 mm2(5,000 U / mL), representing area increases of approximately 78%, 236%, 371%, 527%, and 611% relative to the control, respectively. At all rHuPH20 concentrations tested, the spreading area exceeded the control by substantially more than 20%. The dose-response curve exhibited a saturation trend above 2,500 U / mL, consistent with progressive depletion of the hyaluronan substrate in the subcutaneous extracellular matrix at higher hyaluronidase concentrations. These results confirm that co-formulation of the active agents with rHuPH20 at concentrations of at least about 313 U / mL substantially enhances subcutaneous tissue dispersion, and support the use of rHuPH20 at approximately 2,000 to 5,000 U / mL as a preferred dispersant concentration range consistent with approved rHuPH20-containing subcutaneous products (Bookbinder et al. 2006 [NPL9]).Example 11: Preparation of PEGylated Active Agent

[0173] Purified polypeptide (SEQ ID NO: 1 or SEQ ID NO: 2, 5 mg / mL in PBS pH 7.4) is reacted with methoxy-PEG-N-hydroxysuccinimide ester (mPEG-NHS, molecular weight 20 kDa, NOF Corporation or JenKem Technology) at a molar ratio of PEG:polypeptide of 3:1 to 10:1 at 4 degrees Celsius for 2 to 4 hours with gentle agitation. The PEGylation reaction targets free amino groups, primarily lysine side chains and the N-terminal alpha-amino group.

[0174] Unreacted PEG and unmodified polypeptide are removed by ion-exchange chromatography (e.g., HiTrap SP or Q column, Cytiva) followed by size-exclusionDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEchromatography. The PEGylated product is characterized by SDS-PAGE (demonstrating an increase in apparent molecular weight), MALDI-TOF mass spectrometry, and PEG-specific iodine assay. The number and site(s) of PEG attachment are determined by tryptic digestion followed by LC-MS / MS peptide mapping. The PEGylated polypeptide is expected to retain at least 30% to 80% of the dehydrogenase activity of the unmodified polypeptide while exhibiting an increased serum half-life when administered to rodents.Example 12: Preparation of Fc Fusion Active Agent

[0175] A fusion construct is designed comprising the nucleotide sequence encoding SEQ ID NO: 1 or SEQ ID NO: 2 fused in-frame to the coding sequence for the human Ig G1 Fc region (hinge-CH2-CH3) at either the N-terminus or C-terminus, separated by a flexible (Gly4Ser)3 linker. An aglycosylated variant is prepared by introducing an N297A mutation in the Fc region to eliminate N-linked glycosylation and reduce Fc-gamma receptor binding. The fusion construct is expressed in CHO cells as described in Example 2. The Fc fusion protein is purified from conditioned medium by Protein A affinity chromatography (MabSelectSuRe, Cytiva), followed by size-exclusion chromatography. The Fc fusion protein is expected to retain significant dehydrogenase activity and to exhibit an extended serum half-life relative to the unmodified polypeptide through FcRn-mediated recycling.Example 13: Construction and Expression of ADH7-ALDH2 Fusion Polypeptide

[0176] A synthetic gene encoding the fusion polypeptide is designed with the following architecture, from N-terminus to C-terminus: (a) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 1; (b) a flexible (Gly4Ser)3 linker (15 amino acids); and (c) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 2. The synthetic gene is codon-optimized for expression in CHO cells and cloned into the pcDNA3.4 vector with a human IgG kappa signal peptide.

[0177] The fusion polypeptide is expressed in CHO-S cells by transient transfection and purified from the conditioned medium. The purified fusion polypeptide is assayed for both alcohol dehydrogenase activity (using ethanol as substrate) and aldehydeDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEdehydrogenase activity (using acetaldehyde as substrate). A coupled activity assay is also performed in which the fusion polypeptide is incubated with ethanol and excess NAD+ to measure the sequential conversion of ethanol to acetaldehyde to acetate, with intermediates and products quantified by gas chromatography or by coupled enzyme assays. The fusion polypeptide is expected to exhibit dual enzymatic activity.Example 14: Preparation of mRNA-Lipid Nanoparticle (LNP) Formulation

[0178] An mRNA encoding SEQ ID NO: 1 or SEQ ID NO: 2 is produced by in vitro transcription (IVT) from a linearized DNA template using T7 RNA polymerase. The IVT reaction includes N1-methylpseudouridine-5'-triphosphate as a complete replacement for UTP, to reduce innate immune activation and enhance translational efficiency. The mRNA includes a 5' cap (Cap1 structure), a 5' UTR optimized for translational efficiency, the coding sequence, a 3' UTR derived from the human beta-globin gene, and a poly(A) tail of approximately 100 to 120 nucleotides.

[0179] The purified mRNA is formulated into LNPs by microfluidic rapid mixing. An aqueous phase containing mRNA in 25 mM sodium acetate buffer (pH 4.0) is mixed with an organic phase (ethanol) containing four lipid components at a molar ratio of: ionizable cationic lipid (e.g., SM-102 or ALC-0315) : neutral helper lipid (e.g., DSPC or DOPE) : cholesterol : PEG-lipid (e.g., DMG-PEG2000 or ALC-0159) at 46:10:42.5:1.5 mol%, respectively. The resulting mRNA-LNPs are characterized for mean hydrodynamic diameter (target: 60 to 120 nm), polydispersity index (target: less than 0.2), mRNA encapsulation efficiency (target: greater than 90%), and stored at 2 to 8 degrees Celsius until use.Example 15: Preparation of Lyophilized Formulation and Dual-Chamber Pen Injector

[0180] The active agent polypeptide (20 mg / mL) is formulated in a lyophilization buffer comprising 25 mM histidine-HCI (pH 6.5), 8% (w / v) trehalose (as a lyoprotectant), 2% (w / v) mannitol (as a bulking agent), and 0.02% (w / v) polysorbate 80 (as a surfactant). Lyophilization is performed using a programmed cycle comprising: freezing to -45 degrees Celsius at 0.5 degrees / min; primary drying at -25 degrees Celsius underDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEvacuum (100 mTorr or less) for 24 to 48 hours; and secondary drying at 25 degrees Celsius for 8 to 12 hours. Residual moisture content is measured by Karl Fischer titration (target: less than 1.0%). The dual-chamber cartridge is assembled into a pen injector device for patient self-administration.Example 16: In Vivo Pharmacokinetic Study in Rodents

[0181] Male and female C57BL / 6 mice or Sprague-Dawley rats (8 to 10 weeks old, n = 6 per group) are administered a single dose of the following test articles via intravenous (tail vein) or subcutaneous injection: (a) unmodified polypeptide of SEQ ID NO: 1 (1 mg / kg); (b) PEGylated polypeptide of SEQ ID NO: 1 (1 mg / kg); (c) Fc fusion polypeptide of SEQ ID NO: 1 (1 mg / kg); and (d) vehicle control. Blood samples are collected at predose, 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, 12 h, 24 h, 48 h, 72 h, 96 h, and 168 h post-dose. Pharmacokinetic parameters (Cmax, Tmax, AUCO-infinity, t1 / 2, CL, Vd) are calculated by non-compartmental analysis. The PEGylated and Fc fusion forms are expected to exhibit significantly longer serum half-lives (e.g., 5- to 50-fold increase) relative to the unmodified polypeptide.Example 17: In Vivo Efficacy Study in Acute Alcohol Intoxication Rat Model (Single Agent ADH Pre-Challenge Preventive Administration)

[0182] This example describes an in vivo efficacy study evaluating a single ADH active agent in a rat model of acute ethanol intoxication.

[0183] Male Sprague-Dawley rats (8 to 10 weeks old, n = 8 per group) are randomly assigned to the following groups: Group 1: vehicle control (IV); Group 2: unmodified active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, IV) administered 15 minutes prior to ethanol challenge; Group 3: unmodified active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, IV) co-formulated with NAD+ (molar ratio 1:10) administered 15 minutes prior to ethanol challenge; and Group 4: PEGylated active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, IV) administered 15 minutes prior to ethanol challenge.

[0184] After test article administration, all rats receive an acute ethanol challenge by intraperitoneal injection of ethanol (3 g / kg body weight, 20% v / v in saline). BloodDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEsamples are collected via the tail vein at 0, 15, 30, 60, 120, 240, and 360 minutes postethanol challenge. Blood ethanol levels are measured by an enzymatic ethanol assay or GC. Blood acetaldehyde levels are measured by headspace GC-MS.

[0185] Primary endpoints include: (a) blood ethanol concentration-time profile and area under the curve (AUC); (b) time to return to a blood ethanol concentration below 10 mM (approximately 46 mg / dL); and (c) behavioral assessment including righting reflex latency and locomotor activity. Based on the published kinetic constants of human ADH7 (kcat = 1,510 min-1per subunit; Km for ethanol of 37 mM; subunit molecular weight = 40 kDa), at the test dose of 5 mg / kg in a 300 g rat (1.5 mg total enzyme; 37.5 nmol subunits), the administered ADH7 polypeptide is expected to provide a maximal catalytic capacity (Vmax) of approximately 157 mg ethanol per hour. At a blood ethanol concentration of 40 mM (approximately 184 mg / dL), corresponding to the expected peak BAC following a 3 g / kg ethanol challenge in rats, the ADH7 polypeptide is predicted to operate at approximately 52% of Vmax (approximately 81 mg ethanol per hour), providing additional clearance capacity comparable to the endogenous rat hepatic ethanol elimination rate of approximately 60 to 90 mg per hour for a 300 g rat (literature values of approximately 200 to 300 mg / kg / hr) — representing an approximately 1.9- to 2.1-fold increase in total ethanol clearance at 40 mM. Treatment groups are expected to demonstrate significantly accelerated ethanol clearance relative to vehicle control, with the time to return to a blood ethanol concentration below 10 mM reduced by approximately 44% to 52% at the 40 mM starting BAC. The NAD+-co-formulated group (Group 3) is expected to show the most pronounced effect due to cofactor supplementation ensuring immediate catalytic competence of the administered enzyme, whereas the group without exogenous NAD+ (Group 2) may exhibit attenuated activity due to dependence on the depleted endogenous extracellular NAD+ pool. The PEGylated form (Group 4) is expected to demonstrate sustained activity over a longer duration due to extended serum half-life. These rat-scale kinetic predictions translate to substantially greater absolute clearance augmentation in human subjects, where the same 5 mg / kg dose (350 mg total enzyme for a 70 kg subject) would provide a Vmax of approximately 36.5 g ethanol per hour and an additional clearance of approximately 19.0 g per hour at 40 mM blood ethanol concentration.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEExample 18: In Vivo Efficacy Study in Acute Alcohol Intoxication Rat Model (Single Agent ADH, Post-Challenge Therapeutic Administration)

[0186] This example describes an in vivo efficacy study evaluating therapeutic (postintoxication) administration of a single ADH active agent in a rat model of acute ethanol intoxication, complementing the pre-challenge preventive study.

[0187] Male Sprague-Dawley rats (8 to 10 weeks old, n = 8 per group) first receive an acute ethanol challenge by intraperitoneal injection of ethanol (3 g / kg body weight, 20% v / v in saline). At 30 minutes post-ethanol challenge, when blood alcohol concentration has reached approximately 30 to 40 mM (approximately 140 to 184 mg / dL), rats are randomly assigned to receive the following test articles: Group 1: vehicle control (IV); Group 2: unmodified active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, IV) coformulated with NAD+ (molar ratio 1:10); Group 3: unmodified active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, SC) co-formulated with NAD+ (molar ratio 1:10) and rHuPH20 dispersant (2,000 U / mL); and Group 4: PEGylated active agent polypeptide (SEQ ID NO: 1, 5 mg / kg, IV) co-formulated with NAD+ (molar ratio 1:10).

[0188] Blood samples are collected via the tail vein at 0 (pre-ethanol), 30 (pretreatment), 45, 60, 90, 120, 180, 240, and 360 minutes post-ethanol challenge. Blood ethanol levels are measured by enzymatic ethanol assay or gas chromatography. Blood acetaldehyde levels are measured by headspace GC-MS. Behavioral endpoints including righting reflex latency and locomotor activity are assessed at each time point.

[0189] Because ADH7 (SEQ ID NO: 1) exhibits a Michaelis constant (Km) for ethanol of approximately 37 mM, the enzyme operates at approximately 45 to 52% of maximal velocity atthe expected blood ethanol concentration of 30 to 40 mM at the time of therapeutic administration, providing an immediate and substantial catalytic contribution. Treatment groups are expected to demonstrate a statistically significant increase in the rate of ethanol clearance from the 30-minute post-challenge treatment time point, with Group 2 (IV with NAD+) expected to show the most rapid onset of ethanol clearance due to immediate systemic distribution. Group 3 (SC with hyaluronidase) is expected to demonstrate delayed onset (approximately 15 to 30 minutes post-injection) but sustained efficacy comparable to the IV group, validating the subcutaneous route as aDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEviable self-administration option in acute intoxication settings. Group 4 (PEGylated IV) is expected to demonstrate prolonged ethanol clearance activity relative to the unmodified polypeptide of Group 2, with measurable augmentation of clearance extending beyond 6 hours post-treatment. The time to return to a blood ethanol concentration below 10 mM (approximately 46 mg / dL) is expected to be reduced by at least 30% in all treatment groups relative to vehicle control, with the IV NAD+-co-formulated group (Group 2) expected to achieve at least a 40% reduction.Example 19: In Vivo Efficacy Study in Acute Alcohol Intoxication Rat Model (Dual Active Agent)

[0190] This example describes an in vivo efficacy study evaluating dual ADH and ALDH active agents in a rat model of acute ethanol intoxication.

[0191] Male Sprague-Dawley rats (8 to 10 weeks old, n = 8 per group) are randomly assigned to the following groups: Group 1: vehicle control (IV); Group 2: SEQ ID NO: 1 alone (5 mg / kg, IV) with NAD+ (molar ratio 1:10); Group 3: SEQ ID NO: 2 alone (5 mg / kg, IV) with NAD+ (molar ratio 1 :10); Group 4: SEQ ID NO: 1 + SEQ ID NO: 2 (5 mg / kg each, IV) with NAD+ (molar ratio 1:10); Group 5: fusion polypeptide (SEQ ID NO: 1-linker-SEQ ID NO: 2, 10 mg / kg, IV) with NAD+ (molar ratio 1 :10); and Group 6: SEQ ID NO: 1 + SEQ ID NO: 2 (5 mg / kg each, SC) co-formulated with NAD+ (molar ratio 1:10) and rHuPH20 dispersant (2,000 U / mL).

[0192] All rats receive an acute ethanol challenge. Blood ethanol and acetaldehyde concentrations are measured at multiple time points. The dual-agent groups (Groups 4 and 5) are expected to demonstrate superior clearance of both ethanol and acetaldehyde compared to single-agent groups (Groups 2 and 3), with the fusion polypeptide potentially showing more efficient sequential metabolism. The SC group (Group 6) with hyaluronidase dispersant is expected to demonstrate comparable efficacy to the IV dual-agent group, validating the subcutaneous delivery approach.Example 20: In Vivo Efficacy Study in ALDH2-Deficient Mouse ModelDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE

[0193] Aldh2 knockout (Aldh2- / -) mice or Aldh2 E487K knock-in homozygous (Aldh2-E487K+ / +) mice (8 to 12 weeks old, n = 8 to 10 per group) are used as a model of human ALDH2 deficiency. Wild-type C57BL / 6 mice serve as positive controls. Study groups include: Group 1 : WT mice + vehicle (IV); Group 2: Aldh2-deficient mice + vehicle (IV); Group 3: Aldh2-deficient mice + unmodified active agent polypeptide (SEQ ID NO: 2, 5 mg / kg, IV); Group 4: Aldh2-deficient mice + Fc fusion active agent (SEQ ID NO: 2, 5 mg / kg, IV); Group 5: Aldh2-deficient mice + fusion polypeptide (SEQ ID NO: 1 + linker + SEQ ID NO: 2, 5 mg / kg, IV); and Group 6: Aldh2-deficient mice + active agent co-formulated with NAD+ enhancer (molar ratio 1 :10) and rHuPH20 dispersant (5 mg / kg active agent, SC).

[0194] Thirty minutes after test article administration, all mice receive an acute ethanol challenge by intraperitoneal injection of ethanol (3 g / kg body weight, 20% v / v in saline). Blood samples are collected at 0, 15, 30, 60, 120, and 240 minutes. Treatment with the active agent compositions is expected to result in a statistically significant reduction in serum acetaldehyde levels (e.g., 20% or greater reduction in AUC relative to vehicle-treated Aldh2-deficient controls) and normalization of behavioral parameters toward wild-type levels.Example 21: Co-administration of Pharmaceutical Composition with FGF21 Analog

[0195] A pharmaceutical composition comprising the active agent polypeptides (SEQ ID NO: 1 and SEQ ID NO: 2 at a molar ratio of about 1:2) and NAD+ enhancer (10 mM) is prepared as described. A long-acting FGF21 analog (such as a glycoPEGylated FGF21 or an Fc-FGF21 fusion protein) is obtained or prepared by art-recognized methods.

[0196] The dehydrogenase pharmaceutical composition (at a dose of about 2 mg / kg body weight of active agent) and the FGF21 analog (at a dose of about 0.1 to about 5 mg / kg body weight) are co-administered subcutaneously to a subject with acute alcohol intoxication, alcohol use disorder, or ALDH2 deficiency. In one arm, the two agents are co-formulated in a single injectable composition. In a second arm, the two agents areDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEadministered as separate subcutaneous injections at the same visit. A control arm receives the dehydrogenase pharmaceutical composition alone without FGF21.

[0197] The combination of the dehydrogenase pharmaceutical composition with the FGF21 analog is expected to produce a combined therapeutic effect in subjects with acute alcohol intoxication, alcohol use disorder, or ALDH2 deficiency that exceeds the effect of either agent administered alone. Efficacy endpoints include blood alcohol and acetaldehyde clearance rates, hepatic transaminase levels (ALT, AST), hepatic lipid content, and, in subjects with alcohol use disorder, measures of alcohol preference and consumption over a defined observation period.Example 22: In Vivo Efficacy of mRNA-LNP Formulation

[0198] Aldh2-deficient mice (n = 8 per group) receive a single intramuscular injection of: (a) mRNA-LNP encoding SEQ ID NO: 2 (0.5 mg / kg mRNA); (b) mRNA-LNP encoding a non-translating control mRNA (0.5 mg / kg); or (c) PBS vehicle. At 24 hours, 72 hours, and 7 days post-administration, cohorts are challenged with intraperitoneal ethanol (3 g / kg). The mRNA-LNP encoding SEQ ID NO: 2 is expected to produce transient expression of functional ALDH2 polypeptide, resulting in reduced serum acetaldehyde levels at 24 and 72 hours post-administration, with activity returning to baseline by approximately 7 to 14 days, consistent with the transient nature of mRNA-mediated protein expression.Example 23: Allosteric Activator (ALDA-1) Enhancer Assay

[0199] This example describes an assay evaluating the allosteric activator ALDA-1 as an enhancer of the active agent polypeptide (SEQ ID NO: 2).

[0200] Purified active agent polypeptide (SEQ ID NO: 2, 5 pg) is pre-incubated with ALDA-1 (N-(1,3-benzodioxol-5-ylmethyl)-2,6-dichlorobenzamide) at varying concentrations (0.1, 1, 5, 10, 25, 50, and 100 pM ) in 50 mM Tris buffer (pH 8.0) containing 5 mM NAD+ at 25 degrees Celsius for 10 minutes. Aldehyde dehydrogenase activity is then measured spectrophotometrically at 340 nm using 200 pM acetaldehyde as substrate. A dose-response curve is generated and the concentration of ALDA-1DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEproducing half-maximal activation (EC50) is determined by nonlinear regression. The ALDA-1 -treated enzyme is expected to exhibit increased Vmax and decreased Km for acetaldehyde relative to the untreated enzyme, consistent with the known mechanism of ALDA-1 as an allosteric activator that stabilizes the active site conformation.Example 24: Zinc Enhancer Assay

[0201] This example describes an assay evaluating zinc supplementation as an enhancer of the active agent polypeptide (SEQ ID NO: 1).

[0202] Purified active agent polypeptide (SEQ ID NO: 1, 5 pg) is assayed for alcohol dehydrogenase activity in the presence of varying concentrations ofZnCI2 (0, 1, 5, 10, 25, and 50 pM ) in 50 mM Tris buffer (pH 8.0) containing 10 mM NAD+ and 100 mM ethanol at 25 degrees Celsius. Separate experiments evaluate the protective effect of zinc supplementation on enzyme stability by incubating the enzyme with ZnCI2 (10 pM ) versus chelator (EDTA, 1 mM) at 37 degrees Celsius for up to 24 hours, followed by activity measurement. Zinc supplementation at physiological concentrations (1 to 50 pM ) is expected to stabilize both the catalytic and structural zinc sites, resulting in increased specific activity and enhanced thermal and temporal stability.Example 25: Flavone / CD38 Inhibitor Enhancer Assay

[0203] This example describes an assay evaluating flavone compounds as enhancers that preserve NAD+ cofactor availability.

[0204] The active agent polypeptide (SEQ ID NO: 1, 10 pg / mL) is co-formulated with NAD+ (5 mM) and varying concentrations (1, 10, 50, 100 pM ) of flavone compounds including quercetin, apigenin, chrysin, and kaempferol. Each formulation is incubated at 37 degrees Celsius in pooled human plasma (which contains endogenous CD38 NADase activity) for 0, 1, 2, 4, and 8 hours. At each time point, NAD+ concentration is measured by enzymatic cycling assay and ADH activity is measured by the spectrophotometric assay described in Example 1. Formulations containing flavone enhancers are expected to demonstrate slower NAD+ degradation and sustained ADHDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEactivity relative to formulations lacking flavone, consistent with CD38 inhibition preserving cofactor availability.Example 26: Peptide Enhancer (Lys-Pro-Cys) Assay

[0205] This example describes an assay evaluating a zinc-coordinating peptide enhancer.

[0206] The tripeptide Lys-Pro-Cys (KPC) is synthesized by standard Fmoc solid-phase peptide synthesis and purified by reverse-phase HPLC. The purified active agent polypeptide (SEQ ID NO: 1, 5 pg) is assayed for alcohol dehydrogenase activity in the presence of varying concentrations of KPC peptide (0, 1, 10, 50, 100, and 500 pM ) and ZnCI2 (10 pM ) in 50 mM Tris buffer (pH 8.0) containing 10 mM NAD+ and 100 mM ethanol at 25 degrees Celsius. The KPC peptide, by virtue of the cysteine thiolate and lysine amine groups coordinating the catalytic zinc ion, is expected to enhance enzymatic activity by stabilizing the active site zinc coordination geometry, particularly in formulations where zinc availability may be limiting.Example 27: TAT-Conjugated Active Agent for Intracellular Delivery

[0207] This example describes the preparation and evaluation of a TAT cell-penetrating peptide conjugated to the active agent polypeptide (SEQ ID NO: 2) for intracellular delivery.

[0208] A fusion construct encoding TAT (YGRKKRRQRRR) fused to the N-terminus of SEQ ID NO: 2 via a (Gly4Ser)2 flexible linker is expressed in CHO cells as described in Example 2 and purified by a combination of ion-exchange and size-exclusion chromatography. The TAT-ALDH2 conjugate is assessed for: (a) ALDH activity using the assay of Example 1 to confirm retention of enzymatic function; (b) cellular uptake by incubating HepG2 hepatocytes with fluorescently labeled (FITC) TAT-ALDH2 (1 pM ) and analyzing internalization by confocal microscopy and flow cytometry at 0.5, 1, 2, and 4 hours; and (c) intracellular ALDH activity by measuring acetaldehyde clearance from cell culture medium. The TAT-ALDH2 conjugate is expected to achieveDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEintracellular delivery within 30 minutes to 1 hour, with functional ALDH activity persisting for up to 48 hours, consistent with published reports of TAT-mediated protein delivery.Example 28: Formulation Stability Study

[0209] The following formulations are prepared and subjected to a stability protocol according to ICH guidelines (Q1A(R2)): (a) liquid formulation of unmodified active agent (10 mg / mL) in histidine-HCI buffer (pH 6.5) with trehalose and polysorbate 80; (b) liquid co-formulation of active agent (10 mg / mL) with rHuPH20 (2,000 U / mL); (c) liquid coformulation of active agent (10 mg / mL) with NAD+ enhancer (10 mM); and (d) lyophilized formulation of active agent (20 mg / mL before lyophilization).

[0210] Samples are stored at 2 to 8 degrees Celsius (intended storage), 25 degrees Celsius / 60% RH (accelerated), and 40 degrees Celsius / 75% RH (stressed). Stabilityindicating assays performed include: visual inspection, pH measurement, protein concentration by UV280, purity by SEC-HPLC, SDS-PAGE, charge variant analysis by clEF, dehydrogenase activity assay, sub-visible particulate matter, endotoxin by LAL assay, and for lyophilized formulation: residual moisture, cake appearance, and reconstitution time. The liquid formulations are expected to maintain at least 90% monomer content and at least 50% retention of dehydrogenase activity through at least 12 months at 2 to 8 degrees Celsius. The lyophilized formulation is expected to maintain at least 95% monomer content and at least 90% retention of activity through at least 24 months at 2 to 8 degrees Celsius. More broadly, all formulations (liquid and lyophilized) are expected to retain at least 50% of the initial dehydrogenase activity, as measured by the spectrophotometric assay described in Example 1, through at least 18 months of storage at 2 to 8 degrees Celsius, based on the stabilizing effects of trehalose as a lyoprotectant and glass-forming agent, polysorbate 80 as a surfactant preventing surface-induced aggregation, and histidine buffer maintaining the active agent within its pH stability window.Example 29: Immunogenicity Assessment of Active Agent Polypeptides

[0211] Naive C57BL / 6 mice (n = 10 per group) receive repeated subcutaneous doses of: (a) unmodified polypeptide of SEQ ID NO: 1 (5 mg / kg, weekly for 8 weeks); (b)DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEPEGylated polypeptide of SEQ ID NO: 1 (5 mg / kg, weekly for 8 weeks); (c) unmodified polypeptide of SEQ ID NO: 2 (5 mg / kg, weekly for 8 weeks); and (d) vehicle control. Serum samples are collected at weeks 0, 4, and 8 for detection of anti-drug antibodies (ADA) by bridging ELISA and for neutralizing antibody (NAb) assessment by a cellbased or enzymatic activity inhibition assay. Injection sites are evaluated histologically for local inflammatory responses. The human-sequence polypeptides, being foreign proteins in mice, are expected to elicit ADA; however, the PEGylated form is expected to demonstrate reduced immunogenicity relative to the unmodified polypeptide. These preclinical immunogenicity data inform the clinical development strategy, including the potential need for immune tolerance induction protocols or further protein engineering to reduce immunogenic epitopes.Example 30: Dose-Response Relationship for In Vivo Ethanol Clearance

[0212] Male Sprague-Dawley rats (n = 6 per group) receive a single intravenous dose of the active agent polypeptide of SEQ ID NO: 1 co-formulated with NAD+ (molar ratio 1 :10) at doses of 0.5, 1, 2, 5, and 10 mg / kg, followed 15 minutes later by intraperitoneal ethanol challenge (3 g / kg). Blood ethanol concentrations are measured at 0, 30, 60, 120, 240, and 360 minutes post-ethanol challenge. A dose-dependent increase in the rate of ethanol clearance is expected, with the rate of clearance at each dose predicted by the Michaelis-Menten kinetic parameters of SEQ ID NO: 1. These data are expected to establish the minimum effective dose and the dose-response relationship described in paragraph

[0135] , supporting the claimed dosing range of about 0.5 mg / kg to about 10 mg / kg body weight.Example 31: Repeat-Dose Tolerability Study

[0213] Male and female Sprague-Dawley rats (n = 10 / sex / group) receive subcutaneous injections of the dual-enzyme pharmaceutical composition (SEQ ID NO: 1 and SEQ ID NO: 2 at a 2:1 ALDH2:ADH7 subunit molar ratio, 5 mg / kg total active agent) coformulated with NAD+ (10 mM) and rHuPH20 (2,000 U / mL), administered once weekly for 4 weeks. A recovery group (n = 5 / sex) is maintained for an additional 4-week washout period. Endpoints include clinical observations, body weight, food consumption, clinical chemistry, hematology, coagulation, gross necropsy, organ weights, andDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEhistopathology of major organs including liver, kidney, and injection sites. Anti-drug antibody titers are measured at weeks 0, 2, and 4. The pharmaceutical composition is expected to be well-tolerated at the tested dose, with injection-site reactions limited to mild, transient erythema consistent with the known safety profile of rHuPH20-containing subcutaneous formulations.Example 32: Phase 1 Clinical Study in Healthy Volunteers

[0214] A randomized, double-blind, placebo-controlled, single-ascending-dose Phase 1 study is conducted in healthy adult volunteers (n = 8 per dose cohort; 6 active, 2 placebo). Cohorts receive a single subcutaneous injection of the dual-enzyme pharmaceutical composition (SEQ ID NO: 1 and SEQ ID NO: 2 at a 2:1 ALDH2:ADH7 subunit molar ratio) co-formulated with NAD+ (10 mM) and rHuPH20 (2,000 U / mL) at doses of 0.5, 1 , 2, and 4 mg / kg body weight. Thirty minutes after dosing, subjects receive a standardized oral ethanol challenge (0.5 g / kg body weight). Safety, tolerability, pharmacokinetic parameters, blood ethanol clearance rate, blood acetaldehyde concentrations, and subjective intoxication scores are assessed over 12 hours. The pharmaceutical composition at doses of 2 to 4 mg / kg is expected to produce a statistically significant increase in ethanol clearance rate relative to placebo, with blood acetaldehyde concentrations maintained below 5 pM throughout the observation period.INDUSTRIAL APPLICABILITY

[0215] The pharmaceutical compositions, methods, nucleic acid molecules, expression vectors, host cells, and kits of the present invention are applicable in the pharmaceutical, biotechnology, and healthcare industries. The compositions are suitable for the manufacture of medicaments for treating or preventing pathological accumulation of alcohols and aldehydes, including in subjects with genetic dehydrogenase deficiencies (e.g., ALDH2*2 carriers, estimated 540 million individuals worldwide), subjects experiencing acute poisoning events (methanol, ethylene glycol, or ethanol toxicity), and subjects at risk for alcohol-related organ damage. The production methods are scalable using established biopharmaceutical manufacturing processes, including CHO cell, E.DEHYDROGENASE EMPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEcoli, and Pichia pastoris fermentation, chromatographic purification, and standard fillfinish operations.SEQUENCE LISTING

[0216] The following sequence listing forms part of this specification and is provided in compliance with WIPO Standard ST.26 in XML format.

[0217] SEQ ID NO: 1 corresponds to the amino acid sequence of the Class IV alcohol dehydrogenase (ADH7) polypeptide. The full sequence, organism source (Homo sapiens), and relevant feature annotations (catalytic residues, zinc-binding motifs, cofactor-binding domain) are provided in the accompanying sequence listing file.

[0218] SEQ ID NO: 2 corresponds to the amino acid sequence of the mitochondrial aldehyde dehydrogenase 2 (ALDH2) polypeptide (mature form, lacking the 17-amino acid mitochondrial targeting sequence). The full sequence, organism source (Homo sapiens), and relevant feature annotations (catalytic residues, cofactor-binding domain, oligomerization domain, position 487) are provided in the accompanying sequence listing file.SEQ ID NO: 1ADH7 GTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKF PVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGV LADGTTRFTCKGKPVHHFMNTSTFTEYTWDESSVAKIDDAAPPEKVCLIGCGFSTGY GAAVKTGKVKPGSTCWFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGAT ECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVWGVPPS AKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKIS EGFELLNSGQSIRTVLTFSEQ ID NO. 2ALDH2 SAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKED VDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVI SYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLM QAWKLGPALATGNWVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIADEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USESHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAH FALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRWGNPFDSKTEQGPQVDET QFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQIL KFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPF GGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS CITATION LISTPatent Literature[PL1] Mochly-Rosen D, Chen C-H. "Modulators of Aldehyde Dehydrogenase Activity and Methods of Use Thereof." U.S. Patent No. 9,370,506 B2, issued June 21 , 2016. [PL2] Talalay P, et al. " Methods and Compositions for Reducing Alcohol Toxicity." U.S. Patent Application Publication No. 2021 / 0401791, published December 30, 2021.[PL3] Wong S. "Enzyme Supplement Composition and Uses Thereof." U.S. Patent No.11,208,631 B1, issued December 28, 2021.[PL4] Katsnelson I. "Methods and Compositions for Treating Diseases." U.S. Patent No.10,016,489 B2, issued July 10, 2018. (Assigned to Nyzime, Inc.)[PL5] Yen RCK. "Detoxification Preparations with Reinforced Boosters to Treat Alcohol Intoxication." U.S. Patent Application Publication No. 2024 / 0123039, published April 18, 2024.[PL6] Stiles KM, Crystal RG. "Gene Therapy for the Treatment of Aldehyde Dehydrogenase Deficiency." International Publication No. WO 2018 / 022783 A1, published February 1, 2018; U.S. Patent Application Publication No. 2019 / 0160187. [PL7] Yang, et al. "Oral Delivery of Enzymes by Nanocapsules for Targeted Metabolism of Alcohol or Toxic Metabolites." U.S. Patent Application Publication No. 2022 / 0133859, published May 5, 2022.[PL8] Whitmire DR. "Method for Rapid Enzymatic Alcohol Removal." U.S. Patent No. 5,759,539, issued June 2, 1998. (Assigned to University of Georgia Research Foundation, Inc.)DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USENon-Patent Literature[NPL1] Farres J, Moreno A, Crosas B, et al. "Alcohol Dehydrogenase of Class IV (Sigma Sigma-ADH) from Human Stomach: cDNA Sequence and Structure / Function Relationships." European Journal of Biochemistry, 232(3):817-825, 1994.[NPL2] Yokoyama H, et al. "Molecular Cloning of a cDNA for sigma-ADH and its Comparison with Deduced Amino Acid Sequences of Other Human Alcohol Dehydrogenases." Biochemical and Biophysical Research Communications, 208(3):1022-1027, 1995.[NPL3] Edenberg HJ. "The Genetics of Alcohol Metabolism: Role of Alcohol Dehydrogenase and Aldehyde Dehydrogenase Variants." Alcohol Research & Health, 30(1):5-13, 2007.[NPL4] Camacho-Pereira J, et al. "CD38 Dictates Age-Related NAD Decline and Mitochondrial Dysfunction through an SIRT3-Dependent Mechanism." Cell Metabolism, 23(6):1127-1139, 2016.[NPL5] Chen C-H, et al. "Targeting Aldehyde Dehydrogenase 2: New Therapeutic Opportunities." Physiological Reviews, 94(1):1-34, 2014.[NPL6] Brooks PJ, et al. "The Alcohol Flushing Response: An Unrecognized Risk Factor for Esophageal Cancer from Alcohol Consumption." PLoS Medicine, 6(3):e50, 2009. [NPL7] Langevin F, et al. "Fancd2 Counteracts the Toxic Effects of Naturally Produced Aldehydes in Mice." Nature, 475(7354):53-58, 2011.[NPL8] Klyosov AA, “Kinetics and Specificity of Human Liver Aldehyde Dehydrogenases toward Aliphatic, Aromatic, and Fused Polycyclic Aldehydes." Biochemistry, 35(14):4457-4467, 1996. DOI: 10.1021 / bi9521102”[NPL9] Bookbinder, L.H. et aL, J. Controlled Release 114:230-241 (2006); Kang, D.W. et aL, PLoS ONE 16(7):e0254765 (2021); Connor, R.J. et aL, J. Pharmacol. Toxicol. Methods 106:106936 (2020).

Claims

1.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEPCT CLAIMSClaim 1. A pharmaceutical composition comprising:(a) an active agent comprising one or more of:(i) an isolated polypeptide comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 1;(ii) an isolated polypeptide comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 2;(iii) an isolated fragment of SEQ ID NO: 1 or SEQ ID NO: 2 comprising at least 90% of the full-length amino acid sequence of the respective SEQ ID NO; and (iv) a modified form of any one of (i) through (iii), wherein the modified form comprises at least one modification selected from the group consisting of:(1) a chemical modification comprising covalent attachment of a half-life extension moiety or a tissue-targeting moiety; and(2) a post-translational modification selected from the group consisting of glycosylation, phosphorylation, and acetylation; and(b) a pharmaceutically acceptable carrier, excipient, diluent, or buffer; wherein said active agent exhibits dehydrogenase activity towards an alcohol, an aldehyde, or both.Claim 2. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 85% sequence identity to SEQ ID NO: 1.Claim 3. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 85% sequence identity to SEQ ID NO: 2.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEClaim 4. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 90% sequence identity to SEQ ID NO: 1.Claim 5. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 90% sequence identity to SEQ ID NO: 2.Claim 6. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 95% sequence identity to SEQ ID NO: 1.Claim 7. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide having at least 95% sequence identity to SEQ ID NO: 2.Claim 8. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 1.Claim 9. The pharmaceutical composition of claim 1, wherein the active agent comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 2.Claim 10. The pharmaceutical composition of claim 1, wherein the active agent is an isolated polypeptide comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2, wherein each amino acid difference relative to SEQ ID NO: 1 or SEQ ID NO: 2 is a conservative substitution in which the substituted amino acid is replaced by an amino acid within the same physicochemical class selected from the group consisting of nonpolar aliphatic residues, aromatic residues, polar uncharged residues, positively charged residues, and negatively charged residues, and wherein said polypeptide exhibits dehydrogenase activity towards alcohols, aldehydes, or both.Claim 11. The pharmaceutical composition of claim 1, wherein the active agent comprises both (a) a polypeptide comprising an amino acid sequence having at least 90%DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEsequence identity to SEQ ID NO: 1 and (b) a polypeptide comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 2, and wherein the molar ratio of said polypeptide of (a) to said polypeptide of (b) is from about 1 :20 to about 20:1.Claim 12. The pharmaceutical composition of claim 11 , wherein the molar ratio of said polypeptide of (a) to said polypeptide of (b) is from about 1 :5 to about 5:1.Claim 13. The pharmaceutical composition of claim 11 , wherein the molar ratio of said polypeptide of (a) to said polypeptide of (b) is from about 1 :8 to about 1:1.Claim 14. The pharmaceutical composition of claim 11, wherein the weight-to-weight ratio of said polypeptide of (a) to said polypeptide of (b) is from about 1:10 to about 10:1.Claim 15. The pharmaceutical composition of claim 1, wherein the active agent comprises a half-life extension moiety selected from the group consisting of:(a) a polyethylene glycol (PEG) moiety conjugated to a lysine residue, cysteine residue, or N-terminus of the isolated polypeptide or modified form thereof as defined in element (a) of claim 1;(b) a human lgG1, lgG2, or lgG4 immunoglobulin Fc region, or an aglycosylated variant thereof, fused to the N-terminus or C-terminus of the isolated polypeptide or modified form thereof as defined in element (a) of claim 1;(c) a human serum albumin or an albumin-binding domain fused to the isolated polypeptide or modified form thereof as defined in element (a) of claim 1 ; and (d) a fatty acid acyl moiety conjugated to the isolated polypeptide or modified form thereof as defined in element (a) of claim 1.Claim 16. The pharmaceutical composition of claim 1, wherein the active agent comprises a tissue-targeting moiety selected from the group consisting of:(a) a cell-penetrating peptide (CPP) that facilitates intracellular delivery of the active agent;(b) a receptor-binding ligand that specifically binds a cell-surface receptor;(c) an antibody fragment specific for a tissue-specific antigen; andDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(d) a tissue-specific homing peptide identified by phage or yeast display.Claim 17. The pharmaceutical composition of claim 16, wherein:(a) the cell-penetrating peptide is selected from the group consisting of a TAT peptide, a polyarginine peptide, and a penetratin peptide;(b) the receptor-binding ligand is a ligand for a receptor selected from the group consisting of a transferrin receptor, an insulin receptor, and an asialoglycoprotein receptor (ASGPR);(c) the antibody fragment is a single-chain variable fragment (scFv), a Fab fragment, or a camelid-derived single-domain antibody (VHH); and(d) the tissue-specific homing peptide comprises an RGD motif, an NGR motif, or a brain-homing sequence.Claim 18. The pharmaceutical composition of claim 16 or claim 17, wherein the tissuetargeting moiety is conjugated to the active agent via a linker, and wherein the linker is:(a) a non-cleavable peptide linker; or(b) a cleavable linker that is susceptible to cleavage by a tissue-specific protease or a change in endosomal pH.Claim 19. The pharmaceutical composition of claim 1, wherein the active agent comprises a post-translational modification or a modification to a post-translational modification site selected from the group consisting of N-linked glycosylation at one or more consensus sequon positions (Asn-X-Ser / Thr), O-linked glycosylation at one or more serine or threonine residues, phosphorylation at one or more serine, threonine, or tyrosine residues, and acetylation at the N-terminus or at one or more lysine residues. Claim 20. The pharmaceutical composition of claim 1, wherein the active agent is a fusion polypeptide comprising, from N-terminus to C-terminus:(a) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 1 and exhibiting dehydrogenase activity towards alcohols;(b) a peptide linker selected from the group consisting of a flexible glycine-serine linker comprising (Gly4Ser)n, wherein n is 1 to 5, a rigid alpha-helical linker, andDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEa protease-cleavable linker comprising a Factor Xa, thrombin, orTEV protease recognition sequence; and(c) an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 2 and exhibiting dehydrogenase activity towards aldehydes;wherein said fusion polypeptide exhibits dehydrogenase activity towards both alcohols and aldehydes.Claim 21. The pharmaceutical composition of any one of claims 1 to 20, further comprising an enhancer that increases the dehydrogenase activity of the active agent towards alcohols, aldehydes, or both relative to a control composition lacking said enhancer.Claim 22. The pharmaceutical composition of claim 21, wherein the enhancer is selected from the group consisting of a pharmaceutically acceptable organic electron acceptor, a pharmaceutically acceptable allosteric activator or chaperone, a pharmaceutically acceptable NADase inhibitor, a pharmaceutically acceptable divalent metallic cation, a pharmaceutically acceptable mitochondrial electron transport chain modulator, and a combination thereof.Claim 23. The pharmaceutical composition of claim 21, wherein the enhancer is betanicotinamide adenine dinucleotide (NAD+), or a pharmaceutically acceptable salt, prodrug, analog, or derivative thereof.Claim 24. The pharmaceutical composition of claim 23, wherein the NAD+enhancer is present at a molar ratio of from about 0.05:1 to about 10,000:1 relative to the active agent.Claim 25. The pharmaceutical composition of claim 23, wherein the NAD+enhancer is present at a concentration of from about 0.01 mM to about 80 mM.Claim 26. The pharmaceutical composition of claim 25, wherein the active agent comprises a polypeptide having at least 90% sequence identity to SEQ ID NO: 2 and does not comprise a polypeptide having at least 90% sequence identity to SEQ ID NO:DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE1, and wherein the NAD+enhancer is present at a concentration of from about 0.01 mM to about 20 M.Claim 27. The pharmaceutical composition of claim 25, wherein the active agent comprises a polypeptide having at least 90% sequence identity to SEQ ID NO: 1 , and wherein the NAD+enhancer is present at a concentration of from about 0.1 mM to about 80 mM.Claim 28. The pharmaceutical composition of claim 25, wherein the active agent comprises both a polypeptide having at least 90% sequence identity to SEQ ID NO: 1 and a polypeptide having at least 90% sequence identity to SEQ ID NO: 2, and wherein the NAD+enhancer is present at a concentration of from about 0.1 mM to about 80 mM.Claim 29. The pharmaceutical composition of claim 21, wherein the enhancer is a zinc ion (Zn2+) provided as a pharmaceutically acceptable zinc salt, including zinc gluconate, zinc acetate, zinc sulfate, and zinc chloride.Claim 30. The pharmaceutical composition of claim 21, wherein the enhancer is an N-benzylbenzamide compound or a pharmaceutically acceptable salt or prodrug thereof, including N-(1,3-benzodioxol-5-ylmethyl)-2,6-dichlorobenzamide.Claim 31. The pharmaceutical composition of claim 21, wherein the enhancer is a flavone or a pharmaceutically acceptable salt, prodrug, analog, or derivative thereof, excluding isoflavones and any flavonoid compound exhibiting net inhibition of dehydrogenase activity at the concentration used.Claim 32. The pharmaceutical composition of claim 21, wherein the enhancer is a peptide of from 3 to 20 amino acids that increases dehydrogenase activity towards an alcohol, an aldehyde, or both relative to a control lacking said peptide, wherein said peptide optionally coordinates a zinc ion at the active site of the active agent, and wherein said peptide optionally has the sequence Lys-Pro-Cys or a conservative variant thereof retaining zinc-coordinating capacity.Claim 33. The pharmaceutical composition of any one of claims 1 to 32, further comprising a dispersant that is a soluble recombinant or isolated hyaluronidase that:(a) is of EC class 3.2.1.35;DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(b) is not membrane-bound under physiological conditions;(c) exhibits hyaluronidase activity at a pH of from 6.8 to 7.4; and(d) when co-formulated with the active agent of claim 1, increases subcutaneous tissue spreading of the active agent by at least 20% relative to the active agent formulated without said dispersant;and wherein said dispersant is not the sole active pharmaceutical ingredient of said composition.Claim 34. The pharmaceutical composition of claim 33, wherein the active agent and the dispersant are present in a molar ratio of from 1:1 to 1:100, and wherein the active agent and the dispersant interact cooperatively to increase the rate of alcohol or aldehyde clearance relative to the additive effect of each component administered separately.Claim 35. The pharmaceutical composition of claim 33, wherein said hyaluronidase exhibits hyaluronidase activity over a pH range of from 6.5 to 8.5.Claim 36. The pharmaceutical composition of claim 33, wherein the dispersant is a soluble recombinant hyaluronidase comprising:(a) a catalytic ( / a)8TIM barrel domain comprising a conserved DXXD catalytic tetrad motif;(b) an EGF-like domain C-terminal to the TIM barrel domain; and(c) a C-terminus truncated such that the polypeptide lacks a functional glycosylphosphatidylinositol (GPI) anchor attachment signal sequence; wherein said dispersant is expressed by a recombinant mammalian host cell and has a molecular weight of from 50 kDa to 80 kDa as determined by SDS-PAGE under reducing conditions.Claim 37. The pharmaceutical composition of claim 33, wherein the dispersant is a soluble hyaluronidase comprising an amino acid sequence having at least 90% sequence identity to a sequence selected from the group consisting of:DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(a) residues 36 to 482 of a human hyaluronidase precursor; and(b) residues 30 to 447 of a bovine hyaluronidase precursor;wherein said polypeptide exhibits hyaluronidase activity at a pH of from 6.8 to 7.4.Claim 38. The pharmaceutical composition of any one of claims 1 to 37, formulated as a sterile aqueous liquid formulation or a lyophilized formulation for reconstitution prior to administration.Claim 39. The pharmaceutical composition of claim 38, wherein said composition is formulated as a sterile aqueous liquid at a pH of from 6.0 to 8.0 and further comprises one or more stabilizers selected from the group consisting of trehalose, sucrose, mannitol, sorbitol, and polysorbate 80.Claim 40. The pharmaceutical composition of claim 38, wherein said composition retains at least 50% of the dehydrogenase activity of the active agent after storage at 2 to 8 degrees Celsius for at least 12 months.Claim 41. The pharmaceutical composition of claim 38, contained in a delivery device selected from the group consisting of a prefilled syringe, an autoinjector, a pen injector comprising a single-chamber cartridge, a pen injector comprising a dual-chamber cartridge having a first chamber containing a lyophilized form of said composition and a second chamber containing a pharmaceutically acceptable diluent, a vial, and an intravenous infusion bag containing a liquid formulation thereof.Claim 42. The pharmaceutical composition of any one of claims 1 to 41 , further comprising, or co-packaged with, fibroblast growth factor 21 (FGF21), an FGF21 analog, or an FGF21 fusion protein.Claim 43. A method of treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject in need thereof, comprising administering to said subject a therapeutically effective amount of the pharmaceutical composition of any one of claims 1 to 42.Claim 44. The method of claim 43, wherein the pathological accumulation of alcohols, aldehydes, or both is associated with a condition selected from the group consisting ofDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEethanol toxicity, methanol toxicity, formaldehyde toxicity, ethylene glycol poisoning, fetal alcohol spectrum disorder, genetic alcohol or aldehyde dehydrogenase deficiencies, Fanconi anemia, bone marrow failure syndromes, alcohol use disorder, cardiovascular disease, Alzheimer’s disease, liver cancer, and gastroesophageal cancer.Claim 45. The method of claim 43, wherein the subject has a genetic aldehyde dehydrogenase 2 (ALDH2) deficiency or dysfunction.Claim 46. The method of claim 43, wherein the subject is a human.Claim 47. The method of claim 43, wherein said administering is parenteral administration selected from the group consisting of intravenous, intramuscular, subcutaneous, intradermal, and intraperitoneal administration.Claim 48. The method of claim 43, wherein the therapeutically effective amount of the active agent is from about 0.5 mg / kg to about 10 mg / kg body weight of the subject.Claim 49. The method of claim 48, wherein the therapeutically effective amount of the active agent is from about 1 mg / kg to about 5 mg / kg body weight of the subject.Claim 50. The method of claim 43, wherein administering the pharmaceutical composition results in a reduction in the level of alcohols, aldehydes, or both in a biological sample obtained from said subject relative to a pre-administration baseline level.Claim 51. The method of claim 43, wherein administering the pharmaceutical composition results in at least a 1.2-fold increase in the rate of systemic ethanol clearance in the subject relative to the endogenous ethanol elimination rate of the subject prior to administration.Claim 52. The method of claim 51, wherein administering the pharmaceutical composition results in at least a 2-fold increase in the rate of systemic ethanol clearance.Claim 53. The method of claim 43, wherein administering the pharmaceutical composition results in at least a 20% reduction in blood acetaldehyde concentration in the subject relative to a pre-administration baseline level.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEClaim 54. The method of claim 50, wherein the biological sample is selected from the group consisting of exhaled breath gas, exhaled breath condensate, plasma, serum, cerebrospinal fluid, urine, and tissue biopsy.Claim 55. The method of claim 43, wherein said pharmaceutical composition is as defined in any one of claims 21 to 37.Claim 56. The method of claim 43, wherein the pharmaceutical composition is administered using a delivery device selected from the group consisting of:(a) a pen injector comprising a single-chamber cartridge containing a liquid formulation of the pharmaceutical composition;(b) a pen injector comprising a dual-chamber cartridge, a first chamber containing a lyophilized form of the pharmaceutical composition and a second chamber containing a pharmaceutically acceptable diluent for reconstitution prior to administration;(c) a prefilled syringe containing a liquid formulation of the pharmaceutical composition;(d) an autoinjector containing a liquid formulation of the pharmaceutical composition;(e) a vial containing a liquid formulation of the pharmaceutical composition suitable for parenteral administration;(f) a vial containing a lyophilized form of the pharmaceutical composition for reconstitution prior to parenteral administration; and(g) an intravenous bag containing a solution of the pharmaceutical composition.Claim 57. The method of claim 43, wherein the subject has a blood alcohol concentration of at least 10 mM at the time of administration.Claim 58. The method of claim 57, wherein the subject has a blood alcohol concentration of at least 40 mM at the time of administration.Claim 59. The method of claim 43, wherein said pharmaceutical composition is administered to said subject prior to anticipated exposure to an alcohol.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEClaim 60. The method of claim 43, wherein said pharmaceutical composition is administered to said subject at regular intervals.Claim 61. The method of claim 60, wherein the subject has a genetic aldehyde dehydrogenase 2 (ALDH2) deficiency or dysfunction, Fanconi anemia, or alcohol use disorder.Claim 62. The method of claim 43, further comprising administering to said subject a therapeutically effective amount of a second therapeutic agent, distinct from the active agent, that reduces the biosynthesis or enhances the degradation of alcohols, aldehydes, or both in said subject.Claim 63. The method of claim 62, wherein the second therapeutic agent is selected from the group consisting of:(a) an activator or positive allosteric modulator of dehydrogenase activity towards alcohols, aldehydes, or both, wherein said activator or modulator acts on the active agent, on an endogenous dehydrogenase of said subject, or on both;(b) an enzyme that exhibits dehydrogenase activity towards alcohols, aldehydes, or both, wherein said enzyme is distinct from the active agent;(c) a peptide of from 3 to 20 amino acids that increases dehydrogenase activity towards an alcohol, an aldehyde, or both relative to a control lacking said peptide, wherein said peptide optionally coordinates a zinc ion at the active site of the active agent or an endogenous dehydrogenase of said subject, and wherein said peptide optionally has the sequence Lys-Pro-Cys or a conservative variant thereof retaining zinc-coordinating capacity; and(d) a combination of any two or more of (a) through (c).Claim 64. The method of claim 62, wherein the active agent and the second therapeutic agent are administered simultaneously, sequentially, or separately.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEClaim 65. The method of claim 62, wherein the active agent and the second therapeutic agent are present in a single pharmaceutical composition comprising a pharmaceutically acceptable carrier, excipient, diluent, or buffer.Claim 66. The method of claim 43, further comprising administering to said subject fibroblast growth factor 21 (FGF21), an FGF21 analog, or an FGF21 fusion protein.Claim 67. Use of the pharmaceutical composition of any one of claims 1 to 42 in the manufacture of a medicament for treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject in need thereof.Claim 68. The pharmaceutical composition of any one of claims 1 to 42 for use in treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject in need thereof.Claim 69. The pharmaceutical composition for use of claim 68, wherein the subject has a genetic aldehyde dehydrogenase 2 (ALDH2) deficiency or dysfunction.Claim 70. The pharmaceutical composition for use of claim 68, wherein the pathological accumulation is associated with ethanol toxicity, methanol toxicity, formaldehyde toxicity, or ethylene glycol poisoning.Claim 71. An isolated nucleic acid molecule encoding an isolated polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO: 2, and a polypeptide having at least 80% sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2 and exhibiting dehydrogenase activity towards an alcohol, an aldehyde, or both, wherein said nucleic acid molecule is a complementary DNA (cDNA) molecule or comprises a codon-optimized nucleotide sequence that does not occur in nature.Claim 72. An mRNA molecule encoding an isolated polypeptide as defined in claim 71, formulated in a lipid nanoparticle comprising:(a) an ionizable cationic lipid;(b) a neutral helper lipid;(c) a structural lipid comprising cholesterol; andDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(d) a PEG-lipid;wherein the lipid nanoparticle has a mean hydrodynamic diameter of about 50 nm to about 200 nm, and is formulated for intramuscular or subcutaneous administration.Claim 73. The mRNA molecule of claim 72, wherein the ionizable cationic lipid, the neutral helper lipid, the structural lipid, and the PEG-lipid are present in a molar ratio of about 40-50 : 10-15 : 35-45 : 1-3, respectively, and wherein the mRNA comprises one or more modified nucleosides selected from the group consisting of N1-methylpseudouridine, pseudouridine, 5-methylcytidine, and 2-thiouridine.Claim 74. The mRNA molecule of claim 72 or claim 73, for use in treating or preventing pathological accumulation of alcohols, aldehydes, or both in a subject in need thereof.Claim 75. An expression vector comprising the nucleic acid molecule of claim 71 , wherein said nucleic acid molecule is operably linked to at least one promoter functional in a host cell.Claim 76. The expression vector of claim 75, wherein said expression vector is selected from the group consisting of a plasmid, an adeno-associated virus (AAV) vector, a lentiviral vector, an adenoviral vector, and a baculovirus vector.Claim 77. The expression vector of claim 75, wherein the promoter is selected from the group consisting of a cytomegalovirus (CMV) promoter, an elongation factor 1 -alpha (EF1a) promoter, a phosphoglycerate kinase (PGK) promoter, an alcohol oxidase 1 (AOX1) promoter, and a glyceraldehyde-3-phosphate dehydrogenase (GAPDH) promoter.Claim 78. The expression vector of claim 75 or claim 76, further comprising a signal peptide sequence operably linked to the N-terminus of the polypeptide, wherein the signal peptide directs secretion of the polypeptide from the host cell.Claim 79. A recombinant host cell comprising the expression vector of claim 75, claim 76, or claim 78, wherein said host cell is selected from the group consisting of a mammalian cell, a bacterial cell, a yeast cell, and an insect cell.DEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USEClaim 80. The recombinant host cell of claim 79, wherein said host cell is selected from the group consisting of:(a) Komagataella phaffii (syn. Pichia pastoris);(b) Escherichia coli;(c) Spodoptera frugiperda Sf9 or Sf21 cells;(d) Chinese hamster ovary (CHO) cells;(e) human embryonic kidney 293 (HEK293) cells; and(f) baby hamster kidney (BHK) cells.Claim 81. A method of producing an isolated polypeptide that is an active agent of any one of claims 1 to 14, comprising:(a) culturing the recombinant host cell of claim 79 or claim 80 under conditions permitting expression of said polypeptide; and(b) recovering said polypeptide from the host cell or the culture medium.Claim 82. The method of claim 81, wherein said polypeptide is expressed in a mammalian host cell and said method further comprises selecting or enriching for a polypeptide having an N-glycosylation pattern selected from the group consisting of a high-mannose glycoform, a complex-type glycoform, a hybrid-type glycoform, and a sialylated glycoform.Claim 83. A kit comprising:(a) the pharmaceutical composition of any one of claims 1 to 42; and(b) instructions for use directing administration of said pharmaceutical composition to a subject for treating or preventing pathological accumulation of alcohols, aldehydes, or both.Claim 84. The kit of claim 83, further comprising:(a) a second therapeutic agent, as defined in claim 63, that reduces the biosynthesis or enhances the degradation of alcohols, aldehydes, or both; andDEHYDROGENASE REPLACEMENT ENZYME COMPOSITIONSAND METHODS OF USE(b) instructions for co-administering said pharmaceutical composition and said second therapeutic agent;wherein said second therapeutic agent is provided in a separate container.Claim 85. The kit of claim 83 or claim 84, wherein:(a) the pharmaceutical composition is provided as a lyophilized composition in a first container and the kit further comprises a pharmaceutically acceptable diluent in a second container for reconstitution of said lyophilized composition prior to administration; and(b) the first container and the second container are chambers of a dual-chamber cartridge configured for use with a pen injector, said dual-chamber cartridge comprising a first chamber containing said lyophilized composition and a second chamber containing said diluent, and the kit further comprises a pen injector configured to receive said dual-chamber cartridge.

Images