Compositions and methods regarding engineered and non-engineered gamma delta t-cells for treatment of solid tumors
Patent Information
- Application Number
- ZA202102384
- Authority / Receiving Office
- ZA · ZA
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2018-10-01
- Filing Date
- 2021-04-12
- Publication Date
- 2026-08-26
- Estimated Expiration
- 2039-10-01
AI Technical Summary
Current adoptive cellular therapies for solid tumors face challenges in specificity, safety, and efficacy due to graft-versus-host effects and the inhibitory environment of solid tissues, particularly for gamma delta (γδ) T cells, where co-stimulation requirements are not well understood, leading to inefficiencies in tumor eradication and immune response.
Development of engineered γδ T cells expressing a chimeric antigen receptor (CAR) with a binding domain specific to tumor-associated antigens, including a CD8a hinge domain, transmembrane domain, costimulatory signaling regions, and a signaling domain, which are encoded in a nucleic acid sequence to enhance specificity and persistence, reducing graft-versus-host responses and improving tumor cell killing activity.
The engineered γδ T cells exhibit enhanced specificity and persistence, increased tumor cell killing activity, and reduced graft-versus-host responses, with prolonged cytotoxic activity and proliferation in response to tumor antigens, effectively targeting solid tumors with improved safety and efficacy.
Abstract
Description
COMPOSITIONS AND METHODS REGARDING ENGINEERED AND NON- ENGINEERED gd-T CELLS FOR TREATMENT OF SOLID TUMORSCROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application claims the benefit of priority to U.S. Provisional Application No.62 / 739,826, filed October 1 , 2018. the contents of which are hereby incorporated for any and all purposes,SEQUENCE LISTING[0001.1] T he instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on January 8, 2020, is named ADC-0006-PCT_SL.txt and is 48,406 bytes in size.BACKGROUND OF THE INVENTION
[0002] Adoptive cellular therapy has undergone near constant iteration for more than thirty (30) years, from early days focusing on basic lymphokine activation and / or tumor infiltration to more recent strategies engineering these immune cells to express genetically engineered antigen receptors, such as chimeric antigen receptors (CARs)s. While there have been some hints and indications of the curative potential of these approaches along the way, much still remains to be done. In particular, successful tumor eradication by CAR-T lymphocytes depends on CAR-T cell persistence and effector function, but an excess of either can trigger graft-versus-host effects in the patient. Moreover, solid tissues in particular present a problem due to the lack of available positive stimulation and the presence of an inhibitory environment. As such the art is testing myriad co-stimulation strategies in both T and NK cells, and in ab T cells in particular, with a view to balancing efficacy with safety. Notably, the practical translation of any of these various approaches to gd T cells is at best uncertain, given the current lack of understanding around the co-stimulation requirements of gd T cells as compared to ab T cells. See, e.g., Ribot et at., “Searching for“signal 2”: costimulation requirements of gd T cells”, Cell. Mol . Life Sci. (201 1 ) 68:2345-2355.[00031 Accordingly, improved strategies are still needed to improve the specificity or selectivity of the cells, to improve safety of the cells, for example by reducing or avoiding graft versus host (GVH) effects, to improve efficacy of the cells against solid tumor cells, for example, by avoiding suppression of effector functions, and to improve the activity and / or survival of the cells upon administration to subjects. Provided are methods, cells, compositions, kits, and systems that meet such needs.SUMMARY OF INVENTION[0004| Aspects of the invention include an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises a binding domain that specifically binds to a protein-peptide complex comprising a tumor associated antigen (TAA) peptide and an MHC protein, wherein the complex is expressed on a surface of a solid tumor cell, optionally wherein the binding domain binds the complex in an HLA restricted manner; a CD8a hinge domain; a CD8a transmembrane domain; a costimulatory signaling region selected from a 4- I BB costimulatory signaling region and a CD27 costimulator signaling region; and a€P3z signaling domain. Aspects of the invention further include a non-engine ered gd T cell described herein and an engineered gd T cell comprising a nucleic acid encoding a CAR construct described herein, wherein the gd T cell functionally expresses the nucleic acid encoded CAR on the surface of the g5 T cell.[0005J Aspects of the invention further include a plurality of gd T cells as described herein. Aspects of the invention further include a method of making the gd T cell or plurality of gd T cells described herein. Aspects of the invention further include a pharmaceutical composition comprising a pharmaceutically acceptable excipient and a gd T cell or plurality of gd T cells described herein. Aspects of the invention further include contacting a solid tumor cell with a tumor cell killing effective amount of a gd T cell as described herein or plurality of gd T cells described herein.[00061 In one aspect, the present invention provides an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprises (a) a binding domain that specifically binds to a protein-peptide complex comprising a tumor associated antigen (TAA) peptide and an MHC protein, wherein the complex is expressed on a surface of a solidtumor cel], optionally wherein the binding domain binds the complex in an HLA restricted manner; (b) a hinge domain, such as a CD8u hinge domain; (c) a transmembrane domain, such as a CD 8a transmembrane domain; (d) a costimulatory signaling region or combination of costimulatory signaling regions, optionally wherein the costimulatory signaling region(s) are selected from a 4- I BB (CD 137) costimulatory signaling region and a CD27 costimulatory signaling region; and (e) a signaling domain, such as a CD3C signaling domain. In some embodiments, the foregoing elements (a)-(e) are encoded on the sense strand of the isolated nucleic acid in 5’ to 3'order.
[0007] In some embodiments, the TAA comprises a contiguous region of TyrD. In some embodiments, the contiguous region of TyrD comprises at least, or at least about, 4 and no more than, or no more than about, 12 contiguous amino acids of TyrD, preferably, or preferably about, 7, 8, or 9 contiguous amino acids of TyrD. In some embodiments, the contiguous region of TyrD is TyrO^-m- In some embodiments, the binding domain that specifically binds the TAA peptide Ml It complex specifically binds HLA-A2 / TyrD369-377.100081 In some embodiments, the binding domain specifically binds to the epitope bound by, or competes with, an antibody comprising: a CDRH1 comprising TSGMGVS (SEQ ID NO: 33); a CDRH2 comprising HIYWDDDKRYNPSLKS (SEQ ID NO: 34); a CDRH3 comprising KDYGSSFYAMHY (SEQ ID NO: 35); a CDRL1 comprising KASQDIHNYIA (SEQ ID NO: 36); a CDRL1 comprising YTSTLQP (SEQ ID NO: 37); and a ( DR 1.2 comprising LQYDNLWT (SEQ ID NO: 38).
[0009] In another aspect, the binding domain specifically binds to a tumor associated antigen (TAA) expressed on a surface of a solid tumor cell, optionally wherein the antigen is a protein- peptide complex, wherein the protein is an MHC protein, wherein the binding domain binds the protein-peptide complex in an HLA restricted manner, and the encoded CAR of the isolated nucleic acid sequence comprises (b) a hinge domain, such as a CD8a hinge domain; (c) a transmembrane domain, such as a CD8« transmembrane domain; (d) a costimulatory signaling region or combination of costimulatory signaling regions, optionally wherein the costimulatory signaling region(s) are selected from a 4- IBB (CD 137) costimulatory signaling region and a CD27 costimulatory signaling region; and (e) a signaling domain, such as a OΌ3z signalingdomain. In some embodiments, the foregoing elements (a)-(e) are encoded on the sense strand of the isolated nucleic acid in 5’ to 3’ order.foot oi In some embodiments the binding domain specifically binds an epitope within GPC3 expressed on the surface of a solid tumor cell, ln some embodiments, the binding domain comprises the following complementarity determining regions (CDRs) binds the same GPC3 epitope as an antibody comprising the following CDRs, and / or competes for binding to an epitope of GPC3 with an antibody comprising the following CDRs: a CDRH I comprising a sequence of DYEMH (SEQ ID NO: 39) (or GYTFTDYEMH (SEQ ID NO: 40»; a CDRH2 comprising a sequence of ALDPKTGDTAYSQKT'KG (SEQ ID NO: 41); a CDRM3 comprising a sequence of FYSYTY (SEQ ID NO: 42); a CDRL l comprising a sequence of RSSQSLVHSNRNTYLH (SEQ ID NO: 43); a CDRL2 comprising a sequence of KVSNRFS (SEQ ID NO: 44); and / or a CDRL3 comprising a sequence of SQNTHVPPT (SEQ ID NO: 45).(0011 j In some embodiments of any one of the foregoing aspects or embodiments or any of the CAR encoding nucleic acids described herein, the encoded CAR comprises; a CD8a hinge domain comprising SEQ ID NO: I(PTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIY) or SEQ ID NO:2 (TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDTY); or a CD8a transmembrane domain comprising SEQ TO NO:3 (1WAPLAGTCGVLLLSLVITLYC); and / or a CD3 signaling domain. I sonic cases, the CD3 signaling domain comprises the sequence of SEQ ID NOD (RVKFSRSADA PA YQQGQNQL YNELTWLGRREEYDVLDKRRGRDPEMG GKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDCLYQGLSTATKDTYD ALHMQALPPR); or SEQ ID NO:5 (RV KFSRSADAPAY QQGQNQL YN ELNLGRREE YD VLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYD ALHMQALPPR),
[0012] In some embodiments, the CAR comprises a 4-lBB costimuiatory signaling region comprising SEQ ID NO:6 (KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL); or a CD27 costimuiatory signaling region comprising SEQ ID NO:7, (QRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP), or the isolated nucleic acid encodes the 4-l BB costimuiatory signaling region comprising SEQ ID NO:6 and the CD27 costimuiatory signaling region comprising SEQ ID NO:7.[0013J In some embodiments of any one of the foregoing, or as described herein, the isolated nucleic acid further encodes a secreted cytokine; or a secreted common gamma chain interleukin; or a secreted common gamma chain interleukin such as IL-15, preferably wherein the secreted common gamma chain interleukin such as IL- 15 comprises an interleukin polypeptide sequence operably linked to a secretion signal sequence {e.g., a secretion signal of SEQ ID NO: 12 or 26). In some embodiments, the isolated nucleic aci encodes a secreted IL-15, preferably wherein the FL-15 comprises the sequence of SEQ ID NO: 14, more preferably wherein the 1L-15 comprises the sequence of 14 operably linked to a secretion signal sequence of SEQ ID NO: 12, or wherein the IL-15 comprises the sequence of SEQ ID NO: 14 operably linked to a secretion signal sequence of SEQ ID NO: 26. In some cases, the secreted cytokine, common gamma chain interleukin, and / or IL-15 are encoded carboxy terminal to the binding region, hinge and transmembrane domains, signaling domain, and / or costimulation endodomain. In some cases, the secreted cytokine, common gamma chain interleukin, and / or IL-15 are encoded on the sense strand 3’ of the region encoding the binding region, hinge and transmembrane domains, signaling domain, and / or costimulation endodomain.
[0014] In some embodiments, the nucleic acid encodes a multi-cistronic linker region configured to facilitate translation of the CAR and the secreted cytokine, common gamma chain cytokine, or IL- 15 as separate polypeptides. In some embodiments, the multi-cistronic linker region encodes a self cleavage and / or a cleavage polypeptide sequence. In some cases, the self cleavage sequence is a P2A, F2A, T2A, or E2A self cleavage sequence. In some cases, the cleavage sequence is a furin cleavage sequence in some cases, the cleavage sequence (e.g., furin cleavage sequence) is amino terminal to a self cleavage sequence. In some embodiments, the multi-cistronic linker region encodes an internal ribosome entry site. In some embodiments, the nucleic acid encodes a multi-cistronic linker region amino terminal to the interleukin or cytokine or interleukin or cytokine secretion signal, preferably wherein the ulttcistronic linker region comprises a sequence of any one of SEQ ID NOs: 15-17, 25, or 27-30, or a combination thereof, or encodes an internal ribosome entry site, e.g., SEQ ID NO: 31 or 32.[00151 In some embodiments, the secretion signal comprises a sequence of SEQ ID NO: 12 or SEQ ID NO: 26, preferably SEQ ID NO: 12: and / or the s!L15 domain comprises a sequence of SEQ ID NO: 14; and / or the P2A cleavage sequence comprises a sequence of SEQ ID NO: 15 or SEQ ID NO:25; and / or the furin cleavage sequence comprises a sequence of SEQ ID NO: 16;and / or the CAR comprises, in amino to carboxy order, a sequence of SEQ ID NO: 17, SEQ ID NO: 12, and SEQ 1D NO: 14.
[0016] in some embodiments, the binding domain specifically binds to HLA-A2 / TyrD.½9.377and the nucleic acid encodes SEQ ID NO: 8, or SEQ ID NO: 18, In some embodiments, the binding domain specifically binds to GPC3 and the nucleic acid encodes SEQ ID NO: 20, or 22 In some embodiments, the nucleic acid comprises the sequence of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 21 , 23, or 24.
[0017] In another aspect, the present invention provides a polypeptide comprising a CAR binding domain, such as one of the polypeptides encoded by any one of the foregoing nucleic acids, or a polypeptide described herein.
[0018] In another aspect, the present invention provides an, e.g., gd, T cell comprising the foregoing polypeptide, or comprising a nucleic acid encoding a CAR described herein, wherein the cell functionally expresses the a binding domain of the polypeptide or nucleic acid encoded CAR on the surface of the cell. In some embodiments, the cell exhibits in vitro and / or in vivo cell killing activity against a solid tumor cell that exhibits ceil surface expression of the tumor associated antigen (TAA). In some embodiments, the solid tumor ceil killing activity of said cell is greater than an innate level of in vitro and / or in vivo solid tumor cell killing activity in a control cell that does not comprise a CAR construct. In some embodiments, the cell exhibits the increased solid tumor cell killing activity against HLA class I+soli tumor cells. In some embodiments the solid tumor cell killinu activity or increased solid tumor cell killine activity persists for, for about, for at least, or for at least about, 6 days to 180 days after first contact with the solid tumor cell.
[0019] In some embodiments, the cell proliferates in response to contact with a solid tumor cell that exhibits cell surface expression of the tumor associated antigen (TAA). in some embodiments, the cell exhibits increased proliferation in response to contact with a solid tumor cell that exhibits cell surface expression of the tumor associated antigen (TAA) as compared to a control cell that does not functionally express the nucleic acid encoded CAR on the surface of the cell. In some embodiments, the cell proliferates in a host organism that comprises the solid tumor ceil that exhibits cell surface expression of the tumor associated antigen (TAA) In some embodiments, the cell proliferation or increased cell proliferation persists for, for about, for atleast, or for at least about, 6 days to 180 days after first contact with the solid tumor cell. In some embodiments, the cell expresses one or more pro-inflammatory cytokines, optionally wherein the one or more pro-inflammatory cytokines comprises tumor necrosis factor alpha or interferon gamma, after contact with the solid tumor cell, preferably in an amount greater than a control cell that does not functionally express the nucleic acid encoded CAR on the surface of the cell.|0020] In some embodiments, the cell exhibits reduced, substantially reduced, essentially none, or no graft versus host response when introduced into an allogeneic host in comparison to a graft versus host response exhibited by an ab T cell administered to an allogeneic host. In some embodiments, the, e.g., gd, T cell exhibits reduced, substantially reduced, essentially no, or no graft versus host response when introduced into an allogeneic host in comparison to a graft versus host response exhibited by an b T cell administered to an allogeneic host. In some embodiments, the T cell is a g T cell In some embodiments, the T cell is a d T cell In some embodiments, the T cell is a y5 T cell. In some embodiments, the T cell is a 01, a 52, a 53, or a 64 T cell, preferably a 52 6 T cell, more preferably a 51 5 T cell. In some embodiments, the T cell is a 51, a 62, a 53, or a 54 gd T cell, preferably a 62 gd T cell, more preferably a 51 g6 T cell.10021] In another aspect, the present invention provides a plurality of of any one of the foregoing cells such as , e.g , gd, T cells, or a plurality of cells such as, e.g., gd. T cells as described herein. In some embodiments, the plurality comprises at least about 10®cells such as 10®, e.g., gd, T cells, preferably from about 1 0®cells, e.g., gd, T cells to about 101 1cells, e.g., gd. T cells. In some embodiments, the plurality comprises a composition that is at least 60%, 80%, or from about 60% or 80% to about 90% or 95% 51 , 52, 53, or 54 cells, such as, e.g., gd T cells, preferably 51 or 52 gd T cells, more preferably 52 gd T cells, most preferably 51 gd T cells.
[0022] In some embodiments, the present invention provides a method of making a cell, such as an, e.g., gd, T cell as described herein, or a plurality of cells, such as, e.g., gd, T cells as described herein, wherein the method comprises transfecting the celi(s) with a construct comprising an isolated nucleic acid sequence as described herein. In some cases, the method comprises, e.g., gamma, retroviral transduction. In some cases, the method comprises ex vivo expansion of the ce!l(s), wherein the ex vivo expansion is performed before transfection and / or after transfection of the isolated nucleic acid sequence. In some cases, the method comprises exvivo expansion of the cell(s), wherein the ex vivo expansion is performed before transfection and after transfection of the isolated nucleic acid sequence. In some cases, the method comprises ex vivo expansion of the cell(s), wherein the ex vivo expansion is performed after transfection of the isolated nucleic acid sequence. In some embodiments, the method comprises producing the from about I 08cells, such as, e.g., gd, T cells to about I 0ncells, such as, e.g., gd, T cells that functionally express a CAR described herein within about 30 days of transfection.
[0023] in another aspect, the present invention provides a pharmaceutical composition comprising a pharmaceutically acceptable excipient and a cell or plurality of cells as described herein, such as, e.g., gd, T edit ) described herein.I 0024 | In another aspect, the present invention provides a method of killing a solid tumor cell, the method comprising contacting the soli tumor cell with a tumor ceil killing effective amount of any one of the foregoing cells or plurality of ceils or pharmaceutical compositions, or a cell or plurality of cells or pharmaceutical composition as described herein. In some cases, the cell or plurality of cells are, e.g., gd, T cell; .·;).
[0025] In some embodiments, the method comprises introducing a therapeutically effective amount of the cells such as, e.g., gd, T cell(s) or the pharmaceutical composition into a host organism comprising the soli tumor cell in some embodiments, the method comprises introducing into a host organism comprising the solid tumor cell a therapeutically effective amount of the cells, such as, e.g., gd, T cell{s), or a pharmaceutical composition thereof and simultaneously or sequentially administering one or more methods to elevate common gamma chain cytokine(s).
[0026] In some embodiments, the administering one or more methods to elevate common gamma chain cytokine(s) comprises administering simultaneously with introducing the eell(s) or sequentially an amount of common gamma chain cytokme(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced cell(s), preferably wherein the method comprises administering 1L-2, more preferably wherein the method comprises administering lL-15. In some embodiments, the one or more methods to elevate common gamma chain cytokine(s) comprise administering an amount of common gamma chain cytokine(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced cell(s) before and / or after introducing the cell(s).[0027J In some embodiments, the one or more methods to elevate common gamma chain cytokine(s) composes lymphodeplction before introducing the gd T cell(s). In some embodiments, the one or more methods to elevate common gamma chain cytokine(s) comprises secretion of one or more common gamma chain cytokine(s) from the introduced cell(s). In some embodiments, the method reduces the in vivo tumor burden in the host organism, and / or increases the mean survival time of the host organism as compared to a control organism, wherein the control organism is not treated with the ceil(s) or the pharmaceutical composition. In some embodiments, the method is a method of treating cancer in a subject in need thereof.
[0028] In another aspect, the present invention provides a use of a tumor cell killing effective amount of any one of the foregoing cells or a cell as described herein {such as an, e.g., gd T cell); a plurality of such cells or a pharmaceutical composition containing such cells in the manufacture of a medicament for the treatment of a solid tumor cell cancer in a subject in need thereof. In another aspect, the present invention provides a method of treating cancer in a subject in need thereof, the method comprising administering a therapeutically effective amount of the cells, wherein the cancer comprises solid tumor cells that exhibit cell surface expression of T rD or GFC3.
[0029] In some embodiments the method comprises simultaneously with the administering of cells or sequentially, administering one or more methods to elevate common gamma chain cytokine(s). In some embodiments, the method comprises performing a plurality of administrations of the cells, wherein the interval between the plurality of administrations is at least about a week, preferably at least about 2, 3, 4, 5, 6, 7, 8, or 12 weeks, and / or no more than once every 6 or 12 months.
[0030] In yet another aspect, the present invention provides a pharmaceutical composition for use in any one of the foregoing methods or a method described herein.INCORPORATION BY REFERENCE100311 All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.BRIEF DESCRIPTION OF THE DRAWINGS[00321 Fig. 1 is a schematic illustration of an embodiment of a chimeric antigen receptor (CAR) containing one costimulatory signaling endodomain (left) or two costimulatory signaling endodomains (right). As used herein costimulatory signaling endodomains are also referred to as costimulation endodomains or costimulatory endodomains. Exemplary costimulatory signaling endodomains useful in exemplary CARs include, without limitation, CD28; CD 137 (4- I BB); CD278 (iCOS); CD27; GDI 34 (0X40); TLR2, and combinations thereof[00331 Fig. 2 illustrates in vitro cytotoxicity of engineered and non-engineered gd T cells described herein against 526 and WM266.1 -Luc melanoma cell lines.[00341 Fig. 3 illustrates in vivo therapeutic efficacy of gd T cells described herein in a subcutaneous WM266.4 cell NOD sci gamma (NSG) mouse mode:[00351 Fig. 4 illustrates a manufacturing process tor production of engineered b C AR- 1 cells and non-engineered gd C AR-T cells, e.g., for treatment of solid tumors.
[0036] Fig. 5 illustrates cytotoxic activity of V81 T cells transduced with control CAR constructs or constructs targeting the tyrosinase polypeptide.
[0037] Fig. 6 illustrates transduction efficiency of V51 cells with an anti-glypican 3 (GPC3) CAR construct, including soluble 1L- 15 (siLi 5) (SEQ ID NO: 14) and codon optimized (WO 2007 / 037780 A2) sil l 5.[0038J Fig. 7 illustrates cytotoxic activity of V 1 T cells either untransduced or transduced with anti-GPC3 CAR constructs against a panel of liver cancer cell line with different levels of GPC3 expression.DETAILED DESCRIPTIONDefinitions:J0039] For purposes of interpreting this specification, the following definitions will apply, and whenever appropriate, terms used in the singular will also include the plural and vice versa. In the event that any definition set forth conflicts with any document incorporated herein byreference, the definition set forth below shall control. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
[0040] “About” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or ±10%. more preferably ±5%, even more preferably ± 1%, and still more preferably ±0.1 % from the specified value, as such variations are appropriate to perform the disclosed methods.
[0041] The term“gd T-cells (gamma delta T-cells)” as used herein refers to a subset of T- cells that express a distinct T-cell receptor (TCR), namely yd'fCR, on their surface composed of one y-chain and one d-chain. The term“yd T-cells” specifically includes all subsets of yS T- cells, including, without limitation, V61 and Vd2, V53 gd T cells, as well as naive, effector memory, central memory, and terminally differentiated gd T-cells. As a further example, the term“gd T-cells” includes V54, V65, V67, and VS8 gd T cells, as well as Vy2, Vv3, Vy5, Vy8, Vy9, Vyl O, and Vyl 1 gd T cells. In some embodiments, the gd T-cells are V617 V62 , or V61 and V52 . Compositions and methods for making and using engineered and non-engineered gd T cells and / or sub-types thereof include, without limitation, those described in US 2016 / 0175358; WO 2017 / 197347; US 9499788; US 2018 / 0169147; US 9907820; US 2018 / 0125889 and US 2017 / 0196910, the contents of each of which are incorporate by reference for all purposes, including the said compositions and methods for making and using engineered and non- engineered gd T cells and / or sub-types thereof. The present application further contemplates T cells, or other engineered leukocytes or lymphocytes, that express one g-chain or one d-chain, optionally in combination with a second polypeptide to form a functional TCR. Such engineered leukocytes or lymphocytes, that express one g-chain or one d-chain may be used in the methods or present in the compositions described herein,
[0042] As used herein, the term“T lymphocyte” or“T cell” refers to an immune cell that expresses or has expressed CD3 (CD3+) and a T Cell Receptor (TCR+). T cells play a central role in cell-mediated immunity. A T cell that“has expressed CD3 and a TCR” has been engineered to eliminate CD3 and / or TCR cell surface expression.|0043] As used herein, the term“TCR” or“T cell receptor” refers to a dimeric heterologous cell surface signaling protein forming an alpha-beta or gamma-delta receptor or combinationsthereof. apTCRs recognize an antigen presented by an MHC molecule, whereas y5TCR can recognize an antigen independently of MHC presentation.
[0044] The term "MHC’ (major histocompatibility complex) refers to a subset of genes that encodes cell-surface antigen-presenting proteins in humans, these genes are referred to as human leukocyte antigen (HLA) genes. Herein, the abbreviations MHC or HLA are used interchangeably.
[0045] “Activation”, as used herein, refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions. The term“activated T cells” refers to, among other things, T cells that are undergoing cell division.
[0046] 1 he term“antibody,” as used herein, refers to an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immimoreactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. The antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab) , as well as single chain antibodies and humanized antibodies (Harlow et ah, 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY: Harlow et ah, 1989, In; Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et ah, 1988, Proc. Nath Acad. Sci. USA 85:5879-5883: Bird et ah, 1988, Science 242:423-426).
[0047] The term“antibody fragment” refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to. Fab, Fab', F(ab')2, and Fv fragments linear antibodies, scFv antibodies, and multispecific antibodies formed from antibody fragments.
[0048] An“antibody heavy chain,” as used herein, refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations.
[0049] An“antibody light chain,” as used herein, refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations k and l light chains refer to the two major antibody light chain isotypes.10050] By the term“synthetic antibody” as used herein, is meant an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage as described herein. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and wel l known in the. art.
[0051] T he term“antigen’ or“Ag” as used herein is- defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunoiogically-competent cells, or both. The skilled artisan will understand that any macromolecule, including proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA that comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an“antigen” as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full-length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skille artisan will understand that an antigen need not be encoded by a“gene” at all. It is readily apparent that an antigen can be generated, synthesized, or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.10052] T he term "epitope" includes any protein determinant, lipid or carbohydrate determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitopic determinants usually consist of active surface groupings of molecules such as amino acids, lipids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. An antibody is said to specifically bind an antigen when the equilibrium dissociation constant (Kn) is in a range of 106- 10i2IVl.|0053] The term "chimeric antigen receptors (CARs)," as used herein, may refer to artificial T-cell receptors, T-bodies, single-chain immunoreceptors, chimeric T-celi receptors, or chimericimmunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell. CARs may be employed to impart the specificity of a monoclonal antibody onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy in specific embodiments, CARs direct specificity of the cell to a tumor associated antigen, tor example. In some embodiments, CARs comprise an intracellular activation domain (allowing the T cell to activate upon engagement of targeting moiety with target ceil, such as a target tumor cell), a transmembrane domain, and an extracellular domain that may vary in length and comprises a disease- or disorder-associated, e.g., a tumor-antigen binding region. In particular aspects, CARs comprise fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies, fused to CD3-zeta a transmembrane domain and endodomain. The specificity of other CAR designs may be derived from ligands of receptors (e.g,, peptides) or from pattern-recognition receptors, such as Dectins. In certain cases, the spacing of the antigen-recognition domain can he modified to reduce activation-induced cell death. In certain cases, CARs comprise domains for additional co-stimulatory signaling, such as CD3C, FcR, CD27, CD28, CD137, DAP 10 / 12, and / or 0X40, 1COS, TLRs (e.g., TLR2) etc. In some cases, molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging (e,g., for positron emission tomography), gene products that conditionally ablate the T cells upon addition of a pro- drug, homing receptors, chemokines, chemokine receptors, cytokines, an cytokine receptors. Furthermore, one skilled in the art will understand that a costimuiatory domain need not be encoded solely by a full-length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response.10054] 1 he term“anti-tumor effect"as used herein, refers to a biological effect which can be manifested by a decrease in tumor volume, a decrease in the number of tumor ceils, a decrease in the number of metastases, an increase in life expectancy, or amelioration of various physiological symptoms associated with the cancerous condition. An“anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the invention in prevention of the occurrence of tumor in the first place.(00551 The term“auto-antigen” means, in accordance with the present invention, any self- antigen which is mistakenly recognized by the immune system as being foreign. Auto-antigens comprise, but are not limited to, cellular proteins, phosphoproteins, cellular surface proteins, cellular lipids, nucleic acids, glycoproteins, including cell surface receptors10056] As used herein, the term“autologous” is meant to refer to any material derived from an individual which is later to be re-introduced into the same individual.
[0057] As used herein, the term“allogeneic” refers to material derived from an animal which is later introduced into a different animal of the same species.
[0058] The term“therapeutically effective amount” refers to the amount of a composition that will elicit a biological or medical response of a tissue, system, or subject that is being sought by the researcher, veterinarian, medical doctor or other clinician. The term“therapeutically effective amount” includes that amount of a composition that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the signs or symptoms of the disorder or disease (e.g., solid tumor) being treated. The therapeutically effective amount will vary depending on the composition, the disease and its severity and the age, weight, etc., of the subject to be treated.
[0059] To“treat” a disease as the term is use herein, means to reduce the frequency or severity of at least one sign or symptom of a disease or d isorder experienced by a subject.
[0060] Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and sequential administration in any order.
[0061] The term “pharmaceutically acceptable”, as used herein, refers to a material, including but not limited, to a salt, carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relativel nontoxic, i,e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
[0062] “Encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an inRNA, to serve as templates for synthesis of other polymers and macromoleeules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids an thebiological properties resulting therefrom. Thus, a gene encodes a protein if transcription an translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence an is usually provided in sequence listings, and the non-coding strand, use as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
[0063] “Isolated” means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not“isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
[0064] Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns.
[0065] T he terms“patient,”“subject,”“individual,” and the like are used interchangeably herein, and refer to any animal, amenable to the methods described herein. In certain non- limiting embodiments, the patient, subject or individual is a human.
[0066] By the term“specifically binds,” as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross-species reactivity does not itself alter the classification of an antibody as specific, in another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific. In some instances, the terms“specific binding” or“specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If anantibody is specific for epitope“A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled“A” and the antibody, will reduce the amount of labeled A bound to the antibody.10067] In some embodiments, specific binding can be characterized by an equilibrium dissociation constant of at least about l x 108M or less (e.g., a smaller o denotes a tighter binding). Methods for determining whether two molecules specifically bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. Moreover, multi-specific antibodies that bind to a first antigen and one or more additional antigens or a bispecific antibody that binds to two different regions of an antigen are nonetheless considered antibodies that“specifically bind / ' as used herein.
[0068] Solid tumors are tumors that comprise a tumor mass of at least about 10 or at least about 100 tumor cells. The solid tumor can be a soft tissue tumor, a primary solid tumor, or a metastatic lesion,
[0069] Examples of solid tumors include, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting liver, lung, breast, lymphoid, gastrointestinal (e.g., colon), genitourinary tract (e.g., renal, urothelial cells), prostate and pharynx. Adenocarcinomas include malignancies such as most colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus. In one embodiment, the cancer is a melanoma, e.g., an advanced stage melanoma. Metastatic lesions of the aforementioned cancers can also be treated or prevented using the methods and compositions of the invention. Examples of other cancers that can be treated include bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, spinal axis tumor, brainstem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, environmentally induced cancers including those induced by asbestos, and combinations of said cancers. In a preferred embodiment, the solid tumor cell expresses, or over-expresses, TyrD, or a fragment thereof. In some embodiments, the solid tumor cell expresses, or over-expresses an HLA:peptide complex containing a TyrD fragment. In some embodiments, the TyrD fragment is TyrD369-377- In some embodiments, the HLA is a class I TULA, such as HLA-A2. In some embodiments, the solid tumor cell expresses, or over-expresses HLA-A2 / Tyrl¾69-377.
[0070] In some embodiments, the solid tumor cell expresses, or over-expresses, glypican3 (GPC3). In some embodiments, the solid tumor cell expresses, or over-expresses an epitope of GPC3 that is specifically bound by an anti- GPC3 antibody, T cell Receptor, or chimeric antigen receptor described in U.S. 7,919,086; WO 2014 / 180306; WO 2018 / 019772; WO 2016 / 049459; WO 2003 / 000883; WO 2006 / 046751 ; WO 2007 / 047291; WO 2016 / 086813; WO 2016 / 047722; WO 2016 / 036973; Cancer Res. 2008;68:9832- 9838: Proc Natl Acad Sci U S A. 2013 Mar 19; 1 10( 12) : E 1083- 1 , the contents of each of which are incorporated by reference in the entirety and for all purposes and in particular for the binding domains, antibodies, antibody fragments, complementarity determining regions, polypeptides containing said complementarity determining regions, nucleic acids encoding for said complementarity determining regions, and epitope specificities and assays for determining epitope specificity described therein. In some embodiments, the solid tumor cell expresses, or over-expresses an epitope of glypican3 that is specifically bound by the anti-GPC3 antibody GC33. ln some embodiments, the solid tumor expresses, or over-expresses, an HLA:peptide complex containing a GPC3 fragment. In some embodiments, the HLA is a class I HLA, such as HLA-A2. in some embodiments, the solid tumor expresses, or overexpresses, an HLAipeptide complex containing a GPC3i44-152 peptide, In some embodiments, the solid tumor expresses, or overexpresses, an HLA:peptide complex containing a GPC3298-306peptide. See, Oncoimmimology. 2012 Nov 1 ; 1 (8): 1448-1450.[00711 “Expression cassette" refers to a nucleic acid comprising expression control sequences operatively linked to a nucleic acid encoding a transcript or polypeptide to be expressed. An expression cassette comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression cassettes can be a component of a vector such as a cosmid, a plasmid (e.g., naked orcontained in a liposome), or a virus (e.g., lentivirus, retrovirus, adenovirus, and adeno-associated virus). An expression cassette can be in a host cell, such as a gd T cell.
[0072] Ranges: throughout this disclosure, various aspects of the invention ca be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, I , 2, 2,7, 3, 4, 5, 5.3. and 6. This applies regardless of the breadth of the range.Chimeric Antigen Receptor Constructs:
[0073] Aspects of the invention include nucleic acids encoding CARs, and constructs and vectors containing such nucleic acids. In some cases, the nucleic acid is a, e.g., heterologous, component of an expression cassette. In some embodiments, the nucleic acid is a, e..g., heterologous component of a retroviral vector. In some embodiments, the nucleic acid is a, e.g., heterologous, component of an ab or gd T cell, and preferably a gd T cell. In some embodiments, the nucleic acid is a, e.g , heterologous, component of an g1T cell and / or a dtT cell. In some embodiments, the nucleic acid is a, e.g., heterologous, component of an a‘T cell and / or a b T ceil.[00741 Described herein are nucleic acids encoding a CAR binding domain that specifically binds to a tumor associated antigen (TAA) expressed on a surface of a solid tumor cell. An exemplary TAA is tyrosinase (TyrD) or a peptide fragment thereof. In some cases, the TAA is glypican3 or a peptide fragment thereof. In some cases, the TAA is a peptide bound to an 1 1 LA molecule, such as a class 1 HLA molecule. Tyrosinase peptides that bind to class I HLA molecules (also referred to herein interchangeably as HLA-restricted tyrosinase epitopes, HLA- restricted tyrosinase epitopes and MHC-restricted tyrosinase antigens) are derived from the tyrosinase enzyme (Genehank Accession No: NP 000363.1) and are typically 8-10 amino acidslong, bind to the heavy chain al-a2 groove via two or three anchor residues that interact with corresponding binding pockets in the HLA molecule.
[0075] Tyrosinase is a membrane-associated N-linked glycoprotein and it is the key enzyme in melanin synthesis. It is expressed in all healthy melanocytes and in nearly all melanoma tumor samples (H. Takeuchi, et ah, 2003; S. Reinke, et ah. 2005). Peptides derived from this enzyme are presented on MHC class 1 molecules and are recognized by autologous cytolytic T lymphocytes in melanoma patients [T. Wolfel, et ah, 1994; Brichard, et ah, 1993; Renkvist et al, Cancer immunology immunotherapy 2001 50:3-15; Novellino L, et al., March 2004 update. Cancer Immunol Immunotherapy. 54: 187-207, 2005]. Additional tumor tyrosinase HLA- restricted peptides derived from tumor associated antigens (TAA) can be found at the website of the lstituto Nazionale per io Studio e la Cura dei Tumori at www.istitutoturnori.mi.it .
[0076] Non-limiting examples of MHC class 1 restricted tyrosinase antigenic peptides are provided in W02008 / 120202, which is fully incorporated herein by reference in its entirety, e.g., in Table 139 of W02008 / 120202. According to some embodiments of the invention, the tyrosinase antigenic peptide is the TyrChc, .377 peptide. Binding domains that specifically bind T'yrD, an epitope within TyrD, including but not limited to those that bind in an HLA (e.g., class 1 HLA) restricted manner, include without limitation those described in WO 2016 / 199140; WO 2016 / 199141 : US 9688739; and in co-pendmg application PCT / TB2017 / 053539, the contents of each of which are incorporated by reference in the entirety and for all purposes including but not limited to compositions and methods for identifying, making, and using binding domains that specifically bind TyrD, or an epitope within TyrD, e.g., in an HLA-restricted or 1 1LA- independent manner.
[0077] GPC3 peptides that bind to class ! HLA molecules (also referred to herein interchangeably as HLA-restricted GPC3 epitopes, HLA-restricted GPC3 epitopes and JV1HC- restricted GPC3 antigens) are derived from the glypican3 protein (Genebank Accession No: NM_001164617.2) and are typically 8-10 amino acids long, bind to the heavy chain al-a2 groove via two or three anchor residues that interact With corresponding binding pockets in the HLA molecule.
[0078] As used herein, a binding domain, CAR, or CAR T cell, that specifically binds TyrD and / or specifically binds an epitope within TyrD includes, without limitation, binding domains.CARs, or CAR T cells that specifically bind a TyrD peptide fragment. The binding domains, CARs, or CAR T cells that specifically bind a TyrD peptide fragment can specifically bind the referenced TyrD peptide fragment in an HLA -restricted manner. Similarly, as used herein, a cell that expresses TyrD on the surface of the cel l includes cells that express, or over-express, a TyrD peptide fragment on the surface of the cell, such as in a peptide:HLA complex.(0079) As used herein, a binding domain, CAR, or CAR T cell, that specifically binds GPC3 and / or specifically binds an epitope within GPC3 includes, without limitation, binding domains, CARs, or CAR T cells that specifically bind a GPC3 peptide fragment. The binding domains, CARs, or CAR T ceils that specifically bind a GPC3 peptide fragment can specifically bind the referenced GPC3 peptide fragment in an HLA-restricted manner. Similarly, as used herein, a cell that expresses TyrD on the surface of the cell includes cells that express, or over-express, a GPC3 peptide fragment on the surface of the cell, such as in a peptideiHLA complex.(0080] ln some embodiments, the binding domain binds the antigen as expressed in a full- length functional polypeptide on the surface of a cell. In some embodiments, the binding domain binds the antigen as presented in an MHC:antigen complex in some embodiments, the binding domain binds the antigen in an HLA-restricted manner. Binding domains exhibiting specificity for MHCrantigen complexes are described, e.g., in WO / 2016 / 199140 and WO / 2016 / 19914110081] In some embodiments, the isolated nucleic acid encodes an anti-TyrD binding domain having a ( DR 1 1 1 comprising TSGMGVS (SEQ ID NO: 33), a CDRH2 comprising HIYWDDDKRYNPSLKS (SEQ ID NO: 34), a CDRH3 comprising KDYGSSFYAMHY (SEQ ID NO: 35), CDRLlcomprismg KASQDIHNY1A (SEQ ID NO: 36), a CDRL1 comprising YTSTLQP (SEQ ID NO: 37), and / or a CDRL2 comprising LQYDNLWT (SEQ ID NO: 38).10082] In some embodiments, the isolated nucleic acid encodes an anti-GPC3 binding domain having a CDRH 1 comprising DYEMH (SEQ ID NO: 39) (or GYTFTDYEMH (SEQ ID NO: 40)), a CDRH2 comprising ALDPKTGDTAYSQKFKG (SEQ ID NO: 41 ), a CDRH3 comprising FYSYTY (SEQ ID NO: 42), CDRLlcomprising RSSQSI VHSXRM YI 1 1 (SEQ ID NO: 43), a CDRL2 comprising KVSNRFS (SEQ ID NO: 44), and / or a CDRL3 comprising SQNTHVPPT (SEQ ID NO: 45).(0083] The present disclosure also contemplates anti-TyrD or anti-GPC3 binding domains that compete for binding with a sequence provided herein. One can determine whether an anti-TyrD binding domain binds to the same epitope as, or competes for binding with, a reference antibody or binding domain by using known methods. For example, to determine if a test antibody binds to the same epitope as a reference binding domain, the reference binding domain can be allowe to bind to TyrD under saturating conditions. Next, the ability of a test binding domain to bind to TyrD molecule can be assessed. If the test binding domain is able to bind to TyrD following saturation binding with the reference binding domain, it can be conclude that the test binding domain binds to a different epitope than the reference binding domain. On the other hand, if the test binding domain is not able to bind to TyrD following saturation binding with the reference binding domain, then the test binding domain may bind to the same epitope as the epitope bound by the reference binding domain.(0084J To determine if a binding domain competes for binding with a reference binding domain, the above-described binding methodology is performed in two orientations: In a first orientation, the reference binding domain is allowed to bind to TyrD under saturating conditions followed by assessment of binding of the test binding domain to the TyrD molecule. In a second orientation, the test binding domain is allow-ed to bind to a TyrD molecule under saturating conditions followed by assessment of binding of the reference binding domain to the TyrD molecule. If, in both orientations, only the first (saturating) binding domain is capable of binding to the TyrD molecule, then it is concluded that the test binding domain and the reference binding domain compete for binding to TyrD. As will be appreciated by a person of ordinary skill in the art, a binding domain that competes for binding with a reference binding domain may not necessarily bind to the identical epitope as the reference binding domain, but may sterically block binding of the reference binding domain by binding an overlapping or adjacent epitope. The methods described above to determine competition and epitope binding with an anti-TyrD binding domain can likewise be applied to an anti-TyrD binding domains.
[0085] Two binding domains bind to the same or overlapping epitope if each competitively inhibits (blocks) binding of the other to the antigen. That is, a I -, 5-, 10-, 20- or 100-fold excess of one binding domain inhibits binding of the other by at least 50%, for example, 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et ah, Cancer Res. 1990 50: 1495-1502). A lternatively, two binding domains have the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one binding domain reduce or eliminate binding of the other. Two binding domains have overlapping epitopes ifsome amino acid mutations that reduce or eliminate binding of one binding domain reduce or eliminate binding of the other.[00861 Additional routine experimentation (e.g., peptide mutation and binding analyses) can then be carried out to confirm whether the observed lack of binding of the test binding domain is in fact due to binding to the same epitope as the reference binding domain or if steric blocking (or another phenomenon) is responsible for the lack of observed binding. Experiments of this sort can be performed using ELISA, RIA, surface plasmon resonance, flow cytometry or any other quantitative or qualitative binding assay available in the art.
[0087] I he present disclosure provides antibodies and CARs with“substantial identity” or “substantial similarity” to the sequences provided herein in the CDR or framework regions. The term "substantial identity" or "substantially identical," when referring to a nucleic acid or fragment thereof, indicates that, when optimally aligned with another nucleic acid (or the complementary strand of the other nucleic acid), there is nucleotide sequence identity in %, for example, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or 100% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as PASTA, BLAST or GAP, as discussed below. A nucleic acid molecule having substantial identity to a reference nucleic acid molecule may, in certain instances, encode a polypeptide having the same or substantially similar amino acid sequence as the polypeptide encoded by the reference nucleic acid molecule.[00881 As applied to polypeptides, the term "substantial similarity" or“substantially similar’ means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTF1T using default gap weights, share at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or 100% sequence identity. In some aspects, residue positions, which are not identical, differ by conservative amino acid substitutions. A "conservative amino acid substitution" is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g.,charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. Jn cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. See. e.g., Pearson (1994) Methods Mol Biol. 24: 307-331 , which is herein incorporated by reference. Examples of groups of amino acids that have side chains with similar chemical properties include 1 ) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartate and glutamate, and 7) sulfur-containing side chains: cysteine and methionine. Preferred conservative amino acids substitution groups are: valine- leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine. Alternatively, a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443 45, herein incorporated by reference. A "moderately conservative" replacement is any change having a lionnegative value in the PAM250 log-likelihood matrix.089] Sequence identity and / or similarity for polypeptides is typically measured using sequence analysis software. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For instance, GCG software contains programs such as GAP and BESTF1T which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a w ild type protein and a utein thereof. See, e.g., GCG Version 6.1. Polypeptide sequences also can be compared using FAST A with default or recommended parameters; a program in GCG Version 6.1. FASTA (e.g., FASTA2 and FASTA3) provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (Pearson (2000) supra). Sequences also can be compared using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62. Another preferred algorithm when comparing a sequence disclosed herein to a database containing a largenumber of sequences from different organisms is the computer program BLAST, especially BLASTP or TBLASTN, using default parameters. See, e.g.. Altschui et al. (1990) J. Mol. Biol. 215: 403-410 and (1997) Nucleic Acids Res. 25:3389-3402, each of which is herein incorporated by reference.10090 J Provided herein are anti-TyrD or anti-GPC3 CARs comprising variants of any of theHCVR, LCVR, and / or CDR amino acid sequences disclosed herein having one or more substitutions (e.g.. conservative substitutions). For example, the present disclosure includes anti- TyrD CARs having HCVR, LCVR, and / or CDR amino acid sequences with, e.g., 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 1 or fewer, 13 or fewer, 12 or fewer. 11 or fewer, 10 or fewer. 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 amino acid substitutions relative to any of the HCVR, LCVR, and / or CDR (e.g, l it DR 1. HCDR2, HCDR3, LCDR l , LCDR2, or LCDR3) amino acid sequences disclosed herein. For example, an anti-TyrD CAR can comprise 20, 19, 18, 17, 16, 15, 14 13, 12, 11 , 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions (e.g, conservative amino acid substitutions) relative to any of the HCVR, LCVR, and / or CDR (e.g, HCDR1 , 1 1CDR2. HCDR3, LCDRl , LCDR2, or 1 CDR ) amino acid sequences disclosed herein.IO091J Similarly, the present disclosure includes anti-GPC3 CARs having HCVR, LCVR, and / or CDR amino acid sequences with, e.g., 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer. 12 or fewer, 1 1 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer. 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 amino acid substitutions relative to any of the HCVR, LCVR, and / or CDR (e.g., l iCDR L HCDR2, F1CDR3, LCDRl , LCDR2, or LCDR3) amino acid sequences disclosed herein. For example, an anti-GPC3 CAR can comprise 20, 19, 18, 17, 16, 15, 14 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions (e.g., conservative amino acid substitutions) relative to any of the HCVR, LCVR, and / or CDR (e.g., HC DR 1. HCDR2, HCDR3, LCDRl , LCDR2, or LCDR3) amino acid sequences disclosed herein.[00921 E xemplary binding domains described herein typically comprise, in order from the amino to carhoxy terminus, a heavy chain region followed by a light chain region (VH-VL). Where a certain order of of VH and VL region in the binding domain is explicitly or implicitly described, the present disclosure is also understand to describe the alternate embodiment inwhich the order of VH and VL regions are reversed, e.g., in an scFV or a CAR comprising an scFv hindinir domain Thus descrmtum of n..VI4-VJ nrr ¾ i>ih :-i IΪRPΊ D!P Vi -VH aVL-VH order also describes the alternate VH-VL order, e. g.;in an scFV or a CAR comprising an scFv binding domain.
[0093] Generally, the CAR encoding nucleic acids described herein include an extracellular linker portion that encodes a peptide linker that links the binding domain to a transmembrane domain. Exemplary linker portions include, without limitation, a linker portion that encodes the CD8a hinge domain, e.g., SEQ ID NO; !(PTPAPTIASQFLSLRPEACRPAAGGAVHTRGLDFACDIY) or SEQ ID NO:2 (T1TPAPRP PTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD1Y). Typically, the region encoding the peptide linker {e.g., CD8a hinge domain) is 3’ of the region encoding the binding domain and 5’ of a region encoding a transinembrane domain.10094] T he CAR encoding nucleic acids described herein include a transmembrane domain. The transmembrane domain can link an extracellular antigen binding domain, e.g., and hinge, to one or more intracellular signaling components. For example, the transmembrane domain can link an antigen binding domain, e.g., and hinge, to a Oϋ3z signaling domain and optionally with one or two costimulation endodomains. Exemplary transinembrane domains include without limitation a CD8a trans embrane domain, e.g., SEQ ID NO:3 (IWAPLAGTCGVLLLSLVITLYC). Typically, the region encoding the transmembrane domain (e.g·., GD8i¾ transmcmbraiie domain) is 3 oi the region encoding the peptide linker (e.g., GD8oi hinge domain) and 5'of a region encoding one or more cytoplasmic domains.
[0095] In some embodiments, the isolated nucleic acid encodes a cytoplasmic region containing one or more cytoplasmic domains. The region encoding the cytoplasmic region is typically 3’ of the region encoding the transmembrane domain. The cytoplasmic domains are typically signaling domains that provide an activating signal for yS T cell proliferation, cytotoxic activity, and / or pro-inflammatory cytokine expression (e.g., TNF-a or IFNy). An exemplary cytoplasmic domain is a CD.Q signaling domain. In some embodiments, the (.Ί )3z signaling domain is or comprises SEQ ID NO:4 (RVKFSRSADAPAYQQGQNQLYNELNLGR REEYDYLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGriDGLYQGLSTATKDTYDALIIMQALPPR ). In some embodiments, the Oϋ z signaling domain is or comprises SEQ ID NO:5 (RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDK AEA YSEIGMKGERRRGKGH DGL YQGLS TATKDTYDALHMQALPPR). In some embodiments, the cytoplasmic region contains multiple (eg., 2, 3, 4, 5, or 6) signaling domains, such as multiple (eg., 2, 3, 4, 5, or 6) OΌ3z signaling domains, eg., each independently selected from SEQ ID NO: 4 and 5. In some embodiments the cytoplasmic region contains multiple (e.g, 2, 3, 4, 5, or 6) non- 0O3z signaling domains and a Oϋ3z signaling domain. In some embodiments, the cytoplasmic -region contains a non-€ϋ3z signaling domain and multiple (eg., 2, 3, 4, 5, or 6) CD3 signaling domains. Additional or alternative signaling domains include, without limitation.I0096J I he cytoplasmic region can contain one or more costimulation endodomains. A region encoding one or more costimulation endodomains can be 5’ or 3’ of a region encoding a signaling domain. In some embodiments, the region encoding one or more costimulation endodomains is 5’ of the region encoding a signaling domain. In some embodiments, a region encoding one or more costimulation endodomains is 5' of a signaling domain and an additional region encoding one or more costimu!ation endodomains is 3’ of the signaling domain. Exemplary costimulation endodomains include, without limitation, CD28; CD 137 (4-l BB): CD278 (ICOS); CD27; CD 134 (0X40); and TLR2 costimulation endodomains, and combinations thereof.
[0097] In some embodiments, additional signaling modalities can be included to increase proliferation, persistence, and / or cytotoxic activity of the gd-T cells described herein. For example, in some embodiments, the CAR construct can encode a soluble common gamma chain cytokine at the 3' end of the isolated nucleic acid. The common gamma chain cytokine encoding region can be linked to the 5 portion of the CAR construct via a T2A linker encoding-region, such that the common gamma chain cytokine is cleaved from the CAR polypeptide and secreted by the cell.
[0098] In some embodiments, the construct encodes at least one 4-l BB costimulation endodomain, and optionally a second costimulation endodomain selected from a 4- I BB, ICOS, CD28, and CD27 costimulation endodomain. In some embodiments, the construct encodes at least two 4-l BB costimulation endodomains, or two 4-1 BB costimulation endodomains incombination with one, two, three, or four, or more, costimulation endodomains selected from a 4-LBB, 1COS, CD28, and CD27. In some embodiments, the 4-1BB costimulation endodomain comprises SEQ ID NO: 6 (KRGRKKLLYIFKQPFMRPVQTT QEEDGCSCRFPEEEEGGCEL),
[0099] In some embodiments, the construct encodes one CD27 costimulation endodomain, and optionally a second costimulation endodomain selected from a 4- 1 BB. ICOS, CD28, and CD27 costimulation endodomain. In some embodiments, the construct encodes a CD27 costimulation endodomain, and a 4-1 BB costimulation endodomain. In some embodiments, the construct encodes two CD27 costimulation endodomains. In some embodiments, the CD27 costimulation endodomain comprises SEQ ID NO: 7(QRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIP1QED YRKPEPACSP).
[0100] In some embodiments, the construct encodes a secretion signal, e.g., SEQ ID NO: 12 (MALPVTALLLPLALLLHAARP) operably linked to facilitate secretion of a C -terminal polypeptide, such as a cytokine that supports the activation, cytotoxicity, and / or persistence of a T cell (e.g., CAR-T cell). In some embodiments, the secretion signal is a secretion signal of SEQ ID NO: 26 (MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVF!LGCFSAGLPKTEA). In some embodiments, the construct encodes a secretion signal, e.g., SFQ ID NO: 12 operably linked to facilitate secretion of a common gamma chain cytokine such as II - 15 or an active fragment thereof, e.g., SEQ ID NO: 14 (NWVNViSDLKKIEDLrQSMHlDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKEC EELEEKNIKEFLQSFVHIVQMFTNTS). Other IL-15 sequences, including codon optimized nucleic acid sequences encoding sILI 5, are disclosed in WO 2007 / 037780. Exemplary common gamma chain cytokines include LL-2 and IL-15. In some embodiments, the common gamma chain cytokine is selected from 11 ,-2. IL-7, and IL-15
[0101] In some embodiments, the construct encodes one or more multi-cistronic linker regions, e.g., between a signaling domain and / or costimulation endodomain and a secretion signal operably linked to facilitate secretion of a cytokine. A multi-cistronic linker region is a region of polypeptide sequence or RNA sequence that facilitates the production of multiple discrete polypeptides from a single transcription product. In some embodiments, the multi- cistronic linker region encodes a cleavage sequence. Suitable cleavage sequences include self-cleavage sequences such as a P2A, F2A, E2A, or T2A cleavage sequence and / or sequences that are cleaved by an endogenous protease, such as furin.
[0102] In some embodiments, the cleavage sequence is a P2A cleavage sequence. In some embodiments, the cleavage sequence is a furin cleavage sequence, In some embodiments, the cleavage sequences are a P2A and a furin cleavage sequence. In some embo iments, the cleavage sequence is the P2A cleavage sequence of SEQ ID NO: 15 (SGSGATNFSLLKQAGDVEENPGP). In some embodiments, the cleavage sequence is a furin cleavage sequence of SEQ ID NO: 16 (RAKR). In some embodiments, the cleavage sequence is a P2A+furin cleavage sequence of SEQ ID NO: 17 (RAKRSGSGATNFSLLKQAGDVEENP GP). In some embodiments, the cleavage sequence is the P2A cleavage sequence of SEQ ID NO: 25 (GSGATNFSLLKQAGDVEENPGP).
[0103] ln some embodiments, the cleavage sequence is or comprises a P2A cleavage sequence of SEQ ID NO: 27 (ATNFSLLKQAGDVEENPGP). In some embodiments, the cleavage sequence is or comprises an F2A cleavage sequence of SEQ ID NO: 28 (VKQTLNNFDLLKLAGDVESNPGP). In some embodiments, the cleavage sequence is or comprises an E2A cleavage sequence of SEQ ID NO: 29 (QCTNYALLKLAGDVESNPGP). In some embodiments, the cleavage sequence is or comprises an T2A cleavage sequence of SEQ ID NO: 30 (EGRSLLTCGDVEETNPGP). In certain aspects, multiple self-cleavage sequences can be encoded carboxy terminal to a signaling and / or costimulatory domain and amino-terminal to an encoded secreted cytokine (e.g , common gamma chain cytokine such as IL-15), preferably wherein the multiple self cleavage sequences are independently selected from the group consisting of a P2A cleavage sequence, a T2A cleavage sequence, an E2A cleavage sequence, and an F2A cleavage sequence. In certain aspects, one or more self-cleavage sequences and one or more sequences cleaved by an endogenous protease are encoded in a construct described herein. In certain embodiments, a endogenous protease recognition site is encoded amino terminal to a self cleavage sequence.100104] In some embodiments, the multi-eistronic linker region encodes an internal ribosome entry site. An exemplary internal ribosome entry site is encoded by SEQ ID NO: 31 (CTAACGTTACTGGCCGAAGCCGCTTGGAATAAGGCCGGTGTGCGTTTGTCTATATGT TATTTTCCACCATATTGCCGTCTTTTGGCAATGTGAGGGCCCGGAAACCTGGCCCTGTWO 2020 / 072546 PCT / US2019 / 054144CTTCTTGACGAGCATTCCTAGGGGTCTTTCCCCTCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTGGAAGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCCACCXi3GCGACAGGTGCCTCTGCCGCCAAAAGCCACGTGTATAAGATACACCTGCAAAGGCGGCACAACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATGGCTCTCCTCAAGCGTATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTGTATGGGATCTGATCTGGGGCCTCGGTGCACATGCTTTACATGTGTTTAGTCGAGGTTAAAAAAACGTCTAGGCCCCCCGAACCACGGGGACGTGGTTTTCCTTTGAAAAACACGATGATA).
[0105] Another exemplary internal ribosome entry site is encoded by SEQ ID NO; 32(AGCAGGTTTCCCCAACTGACACAAAACGTGCAACTTGAAACTCCGCCTGGTCTTTCCAGGTCTAGAGGGGTAACACTTTGTACTGCGTTTGGCTCCACGCTCGATCCACTGGCGAGTGTTAGTAACAGCACTGTTGCTTCGTAGCGGAGCATGACGGCCGTGGGAACTCC TCCTT GGT A ACA AGG ACCCACGGGGCCA A A AGCCACGCCC ACACGGGCCCGTC AT GTGTGCAACCCCAGCACGGCGACTTTACTGCGAAACCCACTTTAAAGTGACATTGAAACTGGTACCCACACACTGGTGACAGGCTAAGGATGCCCTTCAGGTACCCCGAGGTAA CACGCGACACTCGGGAf C l GAG A AGGGG AC FGGGGCT 1 C GA I A A A AGCGC l CGG I ITAAAAAGCTTCTATGCCTGAATAGGTGACCGGAGGTCGGCACCTTTCCTTTGCAATTACTGACCAC).
[0106] Further suitable internal ribosome entry sites include, but are not limited to, those described in Nucleic Acids Res. 2010 Jan;38(Database issue):D131 -6. doi: 10.1093 / nar / gkp981. Epub 2009 Nov 16. those described at iresite.org, those described in WO 2018 / 215787, the sequence described in GenBank accession No KR019382.1 , and the IRES element disclosed in GenBank accession No. LT727339.1 , the contents of wh ich are incorporated by reference in the entirety and for all purposes and in particular for the internal ribosome entry sites and their use described therein.
[0107] Additional multi-cistronic linker regions, including cleavage self-cleavage, and IRES elements, are disclosed in US 2018 / 0360992 and U.S. 8,865,467.
[0108] In some embodiments, the isolated nucleic acid encodes SEQ ID(MSVPTQVLGLLLLWLTDARCDIQMTQSPSSLSASVGDRVTITCKASQDfHNYfAWYQQKPGKAPKLLIHYTSTLQPGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCLQYDNLWTFGQGTKVEH RGGGGSGGGGSGGGGQITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMGVSTATKDTYDA LHM Q A I PPR), a hD 1 1 -CD8-BBz polypeptide comprising an hD l i anti-TyrD binding domain (anti-TyrD g^jTT), a CD8a hinge and transmembrane region, a 4-1BB costimulation endodomain, and a 0O3z signaling domain.100109] In some embodiments, the isolated nucleic acid encoding a» / anliG'yij>w -;;m-CD8-CAGCAGCCTGCAGCCTGAAGATATTGCAACATATTACTGTCTACAGTATGATAATCTCTGGACGTTCGGTCAAGGCACCAAGGTGGAAATCAAACGGGGTGGAGGTGGATCTGG AGGAGG AGGATCCGGTG G AGGAGGTC AG ATC ACCTTG AAGG AGTCTG GTCCTACGCTGGTGAAACCCACACAGACCCTCACGCTGACCTGCACCTTCTCTGGGTTCTCACTCAGCACTAGTGGAATGGGTGTGTCCTGGATCCGTCAGCCCCCAGGAAAGGCCCTGGAGTGGCTTGCACACATTTATTGGGATGATGATAAGCGCTACAACCCATCTCTGAAGAGCAGGCTCACCATCACCAAGGACACCTCCAAAAACCAGGTGGTCCTTACAATGACCAACATGGACCCTGTGGACACAGCCACATATTACTGTGCACGAAAGGACTACGGTAGTAGCTTCTATGCTATGCACTACTGGGGTCAAGGAACCCTAGTCACCGTGTCGAGTACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGA FT ! CCAGAAGAAGAAGAAGGAGGA Ί GTGAAC I GAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGT ACAATG A ACTGCAGA A AG AT AAGATGGCGGAGGCCTACAGT GACATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACjOOI I O] In some embodiments, the isolated nucleic acid comprises a codon optimized sequence encoding a CD8a hinge region. Exemplarv codon optimize pD8a hinge region nucleic acid sequences include, without limitation, SEQ ID NO: 10(ACCACCACCCCTGCACCAAGGCCCCCGACTCCCGCGCCCACCATCGCGTCACA GCCTCTTAGCCTGCGACCGGAAGCATGCAGACCAGCTGCCGGGGGGGCCGTGCATA CGAGAGGTTTGGALTTC GCCTGC GATJ. In some embodiments, the CD8a hinge region is encoded by the fol lowing sequence SEQ ID NO: 1 1 (ACCACGACGCCAGCG CCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAC vi, / L PlGv JGvzPvJT I PGGPGGG L PGG VJ.PV)Gv vGI.GUGUGUίU1PUGvGUG / A\ fU ίT 1 P UG' LiGn4 G UPn L PvIPjGUGUUPG^T I P UGUΐ A CT I T 1 CCiCC EG IGA I ).foot til In some embodiments, the isolated nucleic acid encodes SEQ ID NO: 18(MSVPTQVLGLLLLWLTDARCDIQMTQSPSSLSASVGDRVTTTCKASQDIHNYIAWYQQKPGKAPKLLIHYTSTLQPGVPSRFSGSGSGTDFTFTiSSLQPEDlATYYCLQYDNLWTFGQGTKVEiKRGGGGSGGGGSGGGGQlTLKESGPTLVKPTQTLTLTCTFSGFSLSTSG GVSWIRQPPGKALEWLAHIYWDDDKRYNPSLKSRLTITKDTSKNQVVLTMTN DPVDTATYYCARKDYGSSFYAMHYWGQGTLVTVSSTTTPAPRPPTPAPT1ASQPLSLRPEACRPAAGGAVHTRGLDFACDIY1WAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVK FSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRRAKRSGSGATNFSLL QAGDVEENPGPMALPVTALLLPLA LLLHAARPNWVNVISDLKKIEDLLQS HIDATLYTESDVHPSCKVTAMKCFLLELQVISL ES GDA&¾DT¥ENfcHfcA¾{NSLSSNGNVTESGC ECEELEEKNrK EFLQSFV HIVQ PINTS *), hD l l-CD8-BBz-s!L15 gplypeptide comprising an anti-TyrD hD l l (ant i-Tyr D369-377) binding domain, a LU8u lunge and transmembrane region, a 4- I BB costimulation endodomain, aOI)3z signaling domain, a furin-P2A cleavage sequence, and a secretion signal operably linked to an 1L- 1 5 domain.[001121 In some embodiments, the isolated nucleic acid encodingpolypeptide comprises the sequence of SEQ ID NO: 19 (ATGTCCGTGCCTACCCAGG i GC 1 GGGCC T GC'l GC I GC1 G I GGC 1 GACCG ACGCCAGA 1 GCGACA 1 CCAGA 1 GACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCAAGGCGAGTCAGGACATTCACAACTATATAGCTTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTG ATCCACT AT ACATCCACTTTGCAACC AGGGGTCCC ATCA AGGTTCAGTGGAAGTGGATCTGGGACAGATTTTACTTTCACCATCAGCAGCCTGCAGCCTGAAGATATTGCAACATATTACTGTCTACAGTATGATAATCTCTGGACGTTCGGTCAAGGCACCAAGGTGGAAATCAAACGGGGTGGAGGTGGATCTGGAGGAGGAGGATCCGGTGGAGGAGGTCAGATCACCTTGAAGGAGTCTGGTCCTACGCTGGTGAAACCCACACAGACCCTCACGCTGACCTGCACCTTCTCTGGGTTCTCACTCAGCACTAGTGGAATGGGTGTGTCCTGGATCCGTCAGCCCCCAGGAAAGGCCCTGGAGTGGCTTGCACACATTTATTGGGATGATGATAAGCGCTACAACCCATCTCTGAAGAGCAGGCTCACCATCACCAAGGACACCTCCAAA AACCAGG TGGTCC I TACAA I GACCA ACA 1 GGACCC FG1GG ACACAGCCACATATTACTGTGCACGAAAGGACTACGGTAGTAGCTTCTATGCTATGCACTACTGGGGTCAAGGAACCCTAGTCACCGTGTCGAGTACCACCACCCCTGCACCAAGGCCCCCGACTCCCGCGCCCACCATCGCGTCACAGCCTCTTAGCCTGCGACCGGAAGCATGCAGACCAGCTGCCGGGGGGGCCGTGCATACGAGAGGTTTGGACTTCGCCTGCGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGA ACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCCGCGCGAAGCGATCAGGCAGCGGGGCGACAAATTTCAGCC n CTGAAACAAGCAGGCGACGTGGAAGAAAACCCCGGTCCAATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCAC :GCOGCCAGGCCGAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATTCAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAACAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTATTCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTAACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGAGTTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA).
[0113] Ln some embodiments, the isolated nucleic acid encodes SEQ ID NO: 20 (MSVPTQVLGLLLLWLTDARCQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHW VRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTAY ELSSLTSEDTAV YYCTRFYSYTYWGQGTLVTVSSGGGGSGGGGSGGGGDVV TQSPLSLPVTPGEPASIS CRSSQSLVHSNRNTYLHW YLQKPGQSPQLL!YKVSNRFSGVPDRFSGSGSGTDFTLKISRGGAVHTRGLDFACDlYi APLAGTCGVLLLSLVfTLYCKRGRKKLLYlFKQPF RPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALl iMQALPPR*), a polypeptide comprising a GC33 anti-GPC3 binding domain, a CDSa hinge and transmembrane region, a 4-1 BB costimulation endodomain, and a 0O3z signaling domain.
[0114] In some embodiments, the isolated nucleic acid encoding an GC33-CD8-BBz polypeptide comprises the sequence of SEQ ID NO; 21 (ATGTCCGTGCCTACCCAGG TGCTGGGCCTGCTGCTGCTGTGGCTGACCGACGCCAGATGCCAAGTGCAGCTGGTCC AGAGCGGCGCCGAGGTGAAAAAGCCTGGCGCCAGCGTGAAGGTGTCCTGCAAGGCC TCTGGCTACACCTTCACCGACTACGAGATGCACTGGGTGCGGCAGGCCCCTGGACA GGGCCTGGAATGGATGGGCGCTCTGGACCCCAAGACCGGCGACACCGCTTATAGCC AGAAGTTCAAGGGCAGAGTGACCCTGACAGCTGATAAGAGCACAAGCACCGCCTAC ATGGAACTGAGCAGCCTGACCAGCGAGGACACCGCCGTGTACTACTGCACCAGATT CTACAGCTACACCTACTGGGGCCAGGGGACCCTGGTGACAGTGTCTAGCGGTGGAG GTGGATCTGGAGGAGGAGGATCCGGTGGAGGAGGTGATGTGGTGATGACCCAGAGC CCTCTGAGCCTGCCTGTGACCCCTGGAGAGCCTGCCAGCATCAGCTGCAGAAGCAGCCAATCTCTGGTGCACAGCAACCGGAACACATACCTGCACTGGTACCTGCAGAAACCTGGCCAGAGCCCCCAGCTGCTGATCTACAAGGTGTCCAACAGATTCAGCGGCGTGCCTGATAGATTCAGCGGATCTGGCAGCGGCACCGACTTCACCCTGAAGATCTCTAGAGTGGAAGCCGAGGACGTGGGCGTGTACTACTGCAGCCAGAACACCCACGTGCCCCCCACCTTCGGCCAGGGCACAAAGCTGGAAATCAAGACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTT AT GAG ACC AGTAC A AACT ACTC A AGAGGAAGAT GGCTGT AGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA).01 15J In some embodiments, the isolated nucleic acid encodes SEQ ID NO: 22(MSVPTQVLGLLLLWLTDARCQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTAYMELSSLTSEDTAVYYCTRFYSYTYWGQGTI VTVSSGGGGSGGGGSGGGGDVVK TQSPLSLPVTPGEPASISCRSSQSLVHSMRNTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQNTHVPPTFGQGTKLEIKTTTPAPRPPTPAPTiASQPLSLRPEACRPAAGGAVl-lTRGLDFACDlYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYlFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKLSTATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPMALPVTALLLPLAELLH AARPNWVNVISDLKKIEDL1QSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKMKEFLQSFVH1VQMFINTS*), a polypeptide comprising a GC33 anti-GPC3 binding domain, a CD8ry, hinge and transmembraneregion, a 4-1 BB costimulation endodomain. a OT)3z signaling domain, a furin and P2A cleavage region, and a secretion signal operably linked to an IL-15 domain.
[0116] In some embodiments, the isolated nucleic acid encoding a GC33-CD8-BBz-$ILl 5 polypeptide comprises the sequence of SEQ ID NO: 23(ATGTCCGTGCCTACCCAGGTGCTGGGCCTGCTGCTGCTGTGGCTGACCGACGCCAG ATGCCAAGTGCAGCTGGTCCAGAGCGGCGCCGAGGTGAAAAAGCCTGGCGCCAGCGTGAAGGTGTCCTGCAAGGCCTCTGGCTACACCTTCACCGACTACGAGATGCACTGGGTGCGGCAGGCCCCTGGACAGGGCCTGGAATGGATGGGCGCTCTGGACCCCAAGACCGGCGACACCGCTTATAGCCAGAAGTTCAAGGGCAGAGTGACCCTGACAGCTGATAAGAGCACAAGCACCGCCTACATGGAACTGAGCAGCCTGACCAGCGAGGACACCGCCGTGTACTACTGCACCAGATTCTACAGCTACACCTACTGGGGCCAGGGGACCCTGGTGACAGTGTCTAGCGGTGGAGGTGGATCTGGAGGAGGAGGATCCGGTGGAGGAGGTGATGTGGTGATGACCCAGAGCCCTCTGAGCCTGCCTGTGACCCCTGGAGAGCCTGCCAGCATCAGCTGCAGAAGCAGCCAATCTCTGGTGCACAGCAACCGGAACACATACCTGCACTGGTACCTGCAGAAACCTGGCCAGAGCCCCCAGCTGCTGATCTACAAGGTGTCCAACAGATTCAGCGGCGTGCCTGATAGATTCAGCGGATCTGGCAGCGGCACCGACTTCACCCTGAAGATCTCTAGAGTGGAAGCCGAGGACGTGGGCGTGTACTACTGCAGCCAGAACACCCACGTGCCCCCCACCTTCGGCCAGGGCACAAAGCTGGAAATCAAGACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCT GTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGA AAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACA GCCACCAAGGACACCT ACG ACGCCCTTCAC ATGC AGGCCCTGCCCCCTCGCGGT AGCGGGGCT ACG A ACTT CT GCG I’TCTTAAACAAGCGGGAGACGTGGAAGAAAATCGCGGACCTATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCGAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATTCAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAACAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTATTCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTAACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGAGTTTTGTACATATTGTCCAAATGTTCATCA A C ACTTC ITG A) .
[0117] In some embodiments, the isolated nucleic acid encoding a GC33-CD8-BBz-slL15 polypeptide comprises the sequence of SEQ ID NO: 24(ATGTCCGTGCCTACCCAGGTGCTGGGCCTGCTGCTGCTGTGGCTGACCGACGCCAG ATGCCAAGTGCAGCTGGTCCAGAGCGGCGCCGAGGTGAAAAAGCCTGGCGCCAGCG TGAAGGTGTCCTGCAAGGCCTCTGGCTACACCTTCACCGACTACGAGATGCACTGGG TGCGGCAGGCCCCTGGACAGGGCCTGGAATGGATGGGCGCTCTGGACCCCAAGACC GGCGACACCGCTTATAGCCAGAAGTTCAAGGGCAGAGTGACCCTGACAGCTGATAA GAGCACAAGCACCGCC FAC A TGGAACTGAGCAGCC I GAC7CAUCGAGU ACACCGCCGTGTACTACTGCACCAGATTCTACAGCTACACCTACTGGGGCCAGGGGACCCTGGTGACAGTGTCTAGCGGTGGAGGTGGATCTGGAGGAGGAGGATCCGGTGGAGGAGGTGATGTGGTGATGACCCAGAGCCCTCTGAGCCTGCCTGTGACCCCTGGAGAGCCTGCCAGCATCAGCTGCAGAAGCAGCCAATCTCTGGTGCACAGCAACCGGAACACATACCTGCACTGGTACCTGCAGAAACCTGGCCAGAGCCCCCAGCTGCTGATCTACAAGGTGTCCAACAGATTCAGCGGCGTGCCTGATAGATTCAGCGGATCTGGCAGCGGCACCGACTTCACCCTGAAGATCTCTAGAGTGGAAGCCGAGGACGTGGGCGTGTACTACTGCAGCCAGAACACCCACGTGCCCCCCACCTTCGGCCAGGGCACAAAGCTGGAAATCAAGACCACGACGCCAGCGGCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGGCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCICCTGTCACTGGTTATCACCCTTTACTGCAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGGTAGCGGGGCTACGAACTTCTCCCTTCTTAAACAAGCGGGAGACGTGGAAGAAAATCCCGGACCTATGGCC1TACCAGTGACCGCCITGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCGAACTGGGTGAATGTGATCAGCGATCTGAAGAAGATCGAGGATCTGATCCAGTCCATGCACATCGATGCCACCCTGTATACCGAGAGCGATGTGCACCCCAGCTGCAAGGTGACCGCCATGAAGTGCTTTCTGCTGGAGCTGCAGGTGATCTCCCTGGAGTCCGGAGATGCCAGCATCCACGATACCGTGGAGAATCTGATCATCCTGGCCAACAACAGCCTGTGCTCCAATGGCAATGTGACCGAGTCGGGATGCAAGGAGTGCGAGGAGCTGGAGGAGAAGAATATCAAGGAGTTTCTGCAGAGCTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA).
[0018] In some embodiments, the isolated nucleic acid is a linear nucleic acid. In some embodiments, the isolated nucleic acid is a vector, such as a plasmid vector, an adenoviral vector, an adeno-associated viral vector, a viral vector, a retroviral vector (e.g, a gamma retroviral vector), or a lentiviral vector. In some embodiments, the isolated nucleic acid, or an, e.g., contiguous, portion thereof containing the binding domain transmembrane domain and one or more signaling and / or costimulation endodomains is integrated into the genome of a host cell, such as a host gd T cell In an exemplary embodiment, the isolated nucleic acid is retroviral vector.gd T Cells:
[0119] Aspects of the invention include gd T cells that functionally express an isolated nucleic acid described herein, and thereby expresses a CAR on the surface of the yd T cell.
[0120] Aspects of the invention can additionally or alternatively include gd T cells having in vitro or in vivo cytotoxic activity against a solid tumor cell that exhibits cell surface expression of the tumor associated antigen (TAA). In some cases, the cytotoxic activity is innate activity ln some cases, the cytotoxicity is at least in part, significantly (> about 25%), or entirely, due tothe presence of a CAR construct having a binding domain that specifically binds the TAA expressed on the surface of the solid tumor cell ln some cases, the gd T cells exhibit solid tumor cell killing activity of said gd T cell is greater than an innate level of in vitro and / or in vivo solid tumor cell killing activity in a control gd T cell. In some cases, the control gd T ceil does not comprise a CAR construct. In some cases, the control gd T cell comprises a CAR construct lacking a binding domain described herein, a hinge region described herein, a transmembrane domain described herein, a signaling domain described herein, and / or a costimulation endodomain described herein,
[90121] In some cases, the cytotoxicity is at least in part, significantly (> about 25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds TyrD or an epitope within TyrD, such as TyrDj^) -177. In some cases, the cytotoxicity is at least in part, significantly (> about 25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds TyrD or an epitope within TyrD, such as TyrD¼9.377 in an 11 LA restricted (e.g., class 1 LILA -restricted) manner. In some cases, the cytotoxicity is at least in part, significantly (> about 25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds HLA-A2 / TyrD3«-377.In some cases, the gd T cells functionally express a CAR encoded by an isolated nucleic acid described herein that specifically binds TyrD or a peptide fragment thereof.
[0122] In some embodiments, gd T cells described herein can exhibit HLA-restricted (e.g , HLA class 1 restricted) cytotoxicity. In other embodiments, most (>50%), substantially all (>90%), or all of the cytotoxic activity is not HLA-restricted (e.g., HLA class I restricted). HLA-restricted cytotoxic activity can be assessed by comparing in vitro cytotoxicity against an HLA (e.g., HLA class I) (null) tumor cell line versus in vitro cytotoxicity against an HLA+ (e.g., HLA class G) tumor cell line. In some e bodiments, the HLA-restricted cytotoxic activity is at least in part, significantly (>25%), or entirely, provided by the use of a T cell Receptor-like binding domain. T cell receptor like binding domains are binding domains that specifically recognize the antigen when presented on the surface of a cell in complex with an MHC molecule. T ceil Receptor-like binding domains are further described, e.g., in WO 2016 / 199141 ,
[0123] gd T cells described herein can exhibit robust and / or persistent solid tumor cell killing activity. In some cases, the solid tumor cell killing activity can persist for at least about 6 days to120 days, or for at least about 6 days to 180 days, from first contact with a solid tumor cell. In some cases, the solid tumor cell killing activity of a gd T cell described herein, or a progeny thereof, can persist for at least about 6 days to 120 days, or for at least about 6 days to 180 days, from first contact with a solid tumor cell, or from administration of the gd T cell described herein. This persistent solid tumor cell killing activity can be exhibited in vitro , in vivo , or both in vitro and in vivo.100124] Aspects of the invention can additionally or alternatively include gd T cells that proliferate in response to contact with cells that exhibit cell surface expression, or overexpression, of the tumor associated antigen (TAA). The cells that exhibit cell surface expression of the tumor associated antigen (TAA) can be normal cells, such as nonnal endothelial cells. The cells that exhibit cell surface expression, or overexpression, of the tumor associated antigen (TAA) can be solid tumor cells. In some cases, the proliferation is an innate activity. In some cases, the proliferation is at least in part, significantly (> about 20% or > about25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds the TAA expressed on the surface of the cell In some cases, the gd T cells exhibit a greater level of in vitro and / or in vivo proliferation as compared to a control gd T cell. In some cases the control gd T cell does not comprise a CAR construct. In some cases, the control gd T cell comprises a CAR construct lacking a binding domain described herein, a hinge region described herein, a transmembrane domain described herein, a signaling domain describe herein, and / or a costimulation endodomain described herein.
[0125] In some cases, the proliferation is at least in part, significantly (> about 20 or > about25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds TyrD or an epitope within TyrD. In some cases, gd T cells exhibiting proliferation in response to contact with a ceil that exhibits cell surface expression of TyrD functionally express a TyrD-specifie CAR encoded by an isolated nucleic acid described herein.
[0126] gd T cells described herein can exhibit robust and / or persistent proliferation in a host organism that comprises the cell that exhibits cell surface expression, or overexpression, of the tumor associated antigen (TAA). In some cases, the proliferation can persist for at least about 6 days to 120 days, or for at least about 6 days to 180 days, from first contact with a cell that exhibits ceil surface expression, or overexpression, of the tumor associated antigen (TAA) orfrom a date of administration of the gd T cell to the host organism. In some cases, the proliferation of a gd T cell described herein, or a progeny thereof in the host organism that comprises the cell that exhibits cell surface expression, or overexpression, of the tumor associated antigen (TAA) can persist for at least about 6 days to 120 days, or for at least about 6 days to 180 days, from first contact with the cell or from the date of first administration of the gd T cell to the host organism. In some cases, the proliferation in the host organism is at least in part, significantly (> about 20% or > about 25%), or entirely, due to the presence of a CAR construct having a binding domain that specifically binds TyrD or an epitope within TyrD, In some cases, gd T cells exhibiting proliferation in the host organism comprising a cell that exhibits cell surface expression of TyrD functionally express a TyrD specific CAR encoded by an isolated nucleic acid described herein.1001271 In some embodiments, the gd T cells described herein express, or persistently express pro-inflammatory cytokines such as tumor necrosis factor alpha or interferon gamma after contact with the cell that expresses or over expresses TyrD or a peptide fragment thereof on the surface of the cell. In some embodiments, the gd T cells described herein, or progeny thereof, express, or persistently express, pro-inflammatory cytokines such as tumor necrosis factor alpha or interferon gamma after contact with the cell that expresses or over expresses TyrD or a peptide fragment thereof on the surface of the cell, e.g., in a host organism comprising the cell that expresses or over expresses TyrD or a peptide fragment thereof on the surface of the cell.100128] In some embodiments, the gd T cell, or a pharmaceutical composition containing the gd T cell, exhibits essentially no, or no graft versus best response when introduced into an allogeneic host. In some embodiments, the gd T cell, or a pharmaceutical composition containing the gd T cell, exhibits a clinically acceptable level of graft versus host response when introduced into an allogeneic host. In some embodiments, a clinically acceptable level is an amount of graft versus host response that does not require cessation of a gd T cell treatment to achieve a therapeutically effective treatment. In some embodiments, a clinically acceptable level of graft versus host response (GvIID) is an acute response that is less severe than Grade C according to an applicable IBM l R grading scale. The severity of acute graft versus host response is determined by an assessment of the degree of involvement of the skin, liver, and gastrointestinal tract. The stages of individual organ involvement are combined to produce an overall grade, which has prognostic significance. Grade 1(A) GvHD is characterized as milddisease, grade 11(B) GvHD as moderate, grade Mh C ) as severe, and grade IV(D) life-threatening. The IBMTR grading system defines the severity of acute GvHD as follows (Rowlings et al., Br J Haematol 1997; 97:855):• Grade A - Stage 1 skin involvement alone (maculopapular rash over <25 percent of the body) with no liver or gastrointestinal involvement• Grade B - Stage 2 skin involvement; Stage 1 to 2 gut or liver involvement• Grade C - Stage 3 involvement of any organ system (generalized erythroderma; bilirubin 6.1 to 15.0 mg / dL; diarrhea 1 500 to 2000 mL / day)• Grade D - Stage 4 involvement of any organ system (generalized erythroderma with bullous formation; bilirubin > 15 mg / dL; diarrhea >2000 mL / day OR pain OR ileus)See also, Schoemans et at.. Bone Marrow Transplantation volume 53, pages 1401— 1415 (2018), e.g., at Tables 1 and 2, which discloses criteria for assessing and grading acute GvHD.(00129] In some embodiments, the gd T cell, or a pharmaceutical composition containing the gd T cell, exhibits reduced or substantially reduced graft versus host response when introduced into an allogeneic host as compared to a graft versus host response exhibited by control <x( T cells, or a control pharmaceutical composition comprising the control afl T cells, administered to an allogeneic host. In some cases, the control ab T cell is an allogeneic n on-engineered control ab T cell. In some cases, the control o T cell does not comprise a CAR or does not comprise the .same CAR as a reference gd T cell.
[0130] The gd T cells described herein ca be 61 , 62, 63, or 64 gd T cells, or combinations thereof. In some cases, the gd T cells are mostly (>50%), substantially (>90%), essentially all, or entirely 62 gd T cells. In some cases, the gd T cells are mostly (>50%), substantially (>90%), essentially all, or entirely dΐ gd T cells.
[0131] gd T cells can be obtained from an allogeneic or an autologous donor. The gd T cells can be, partially or entirely purified, or not purified, and expanded ex vivo. Methods and compositions for ex vivo expansion include, without limitation, those described in WO 2017 / 197347 The expansion may be performed before or after, or before an after, a CAR construct is introduced into the gd T cell(s).
[0132] gd T cells described herein can be stored, e.g., cry op reserved, for use in adoptive cell transfer.Methods of Inhibiting or Killing Tumor Cells100133] One or multiple non-enguieered, gd T-cell populations, engineered, gd T- cell populations, and / or admixtures thereof, having cytotoxic activity against a solid tumor cell can be administered to a subject in any order or simultaneously. If simultaneously, the multiple non- engineered, gd T-cell population, engineered, gd T-cell population, and / or admixtures thereof, of the invention can be provided in a single, unified form, such as an intravenous injection, or in multiple forms, for example, as multiple intravenous infusions, s.c, injections or pills. The non- engineered, gd T-cell population, engineered, gd T-cell population, and / or admixtures thereof, of the invention can he packed together or separately, in a single package or in a plurality of packages. One or all of the non-engineered gd T-cell population, engineered gd T-cell population, and / or admixtures thereof, of the invention can be given in multiple doses. If not simultaneous, the timing between the multiple doses may vary to as much as about a week, a month, two months, three months, four months, five months, six months, or about a year. In some cases, a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and / or admixtures thereof, of the invention can proliferate within a subject’s body, in vivo, after administration to a subject. One or more non-engineered gd T-cell populations, one or more engineered gd T-cell populations, and / or admixtures thereof, can be frozen to provide cells for multiple treatments with the same cell preparation. One or moie non-cnginccred yd 1 -cell populations, one or more engineered gd T-ccll populations, and / or admixtures thereof, of the disclosure, and pharmaceutical compositions comprising the same, can be packaged as a kit. A kit may include instructions (e.g., w ritten instructions) on the use of the non-engineered gd T-cell population, the engineered gd T-cell population, and / or admixtures thereof, and compositions comprising the same.
[0134] tn some cases, a method of treating a solid cancer comprises administering to a subject a therapeutical ly-effective amount of a non-engineered yS T-cell population, an engineered gd T-cell population, and / or admixtures thereof, wherein the administration treats the solid cancer. In some embodiments the therapeutical ly-effective amount of the non-engineered,gd T-cell population, the engineered gd T-cell population, and / or admixtures thereof, is administered for at least about 10 seconds, 30 seconds, 1 minute, 10 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, d hours, 12 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, d days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, or 1 year. In some embodiments the therapeutically-effective amount of the non-engineered gd T- cell population, the engineered gd T-cell population, and / or admixtures thereof, is administered for at least one week. In some embodiments the therapeutically-effective amount of the non- engineered gd T-cell population, the engineered gd T-cell population, and / or admixtures thereof, is administered for at least two weeks.100135] A non- engineered gd T-cell population, an engineered gd T-cell population, and / or admixtures thereof, describe herein can be administered before, during, or after the occurrence of a disease or condition, and the timing of administering a pharmaceutical composition containing the gd T-cell population can vary. For example, the gd T-cell population can be used as a prophylactic and can be administered continuously to subjects with a propensity to conditions or diseases in order to lessen a likelihood of the occurrence of the disease or condition. The initial administration can be via any route practical, such as by any route described herein using any formulation described herein. In some examples, the administration of a gd T-cell population of the disclosure is an intravenous administration. One or multiple dosages of the gd T-cell population can be administered as soon as is practicable after the onset of a solid cancer and for a length of time necessary for the treatment of the immune disease, such as, for example, from about 24 hours to about 48 hours, from about 48 hours to about 1 week, fro about 1 week to about 2 weeks, fro about 2 weeks to about 1 month, from about 1 month to about 3 months. In some embodiments, one or multiple dosages of the gd T-eell population can be administered years after onset of the cancer and before or after other treatments.
[0136] In some embodiments, the gd T-cell population is administered simultaneously or sequentially with one or more methods to elevate common gamma chain cytokine(s). As used herein,“one or more methods to elevate common gamma chain cytokine(s): refers to a method, or combination of methods, that alters the physiological state of a subject, such that at least one common gamma chain cytokine level is elevated in the subject. In some embodiments, the method elevates the level of one or more common gamma chain cytokine(s) selected from the group consisting of lL-2, 1L-7, and 1L-15, preferably wherein the method elevates the level ofiL- 15 in the subject. In some embodiments, the method comprises lymphodepletion, In some embodiments, the method comprises administering one or more common gamma chain cytokine(s) to the subject. In some cases, IL-2, 11.-7. and / or IL-15, preferably IL-15, are administered. In some embodiments, the method comprises secreting common gamma chain cytokme(s) from an administered, e.g., gd T, cell In some cases, IL-2, IL-7, and / or IL-15, preferably IL-15, are secreted.|00137] In some embodiments, the administering one or more methods to elevate common gamma chain cytokine(s) comprises lymphodepletion before introducing the gd T cell(s) In some embodiments, the administering one or more methods to elevate common gamma chain cytokine(s) comprises administering simultaneously with introducing the gd T cell(s) or sequentially an amount of common gamma chain cytokine(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced gd T cell(s), preferably wherein the method comprises administering IL-2 or one or more mimetics thereof, more preferably wherein the method comprises administering IL- 15 or one or more mimetics thereof. The amount of administered common gamma chain cytokine(s) can be an amount effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced gd T cell(s) before and / or after introducing the gd T cell(s). Exemplary amounts of IL-15 include, without limitation between 0.01 - 10 pg / kg / dose every 24 hours. Exemplary amounts of IL-2 include, without limitation, between about 3x 10” and about 22x106units every 8 - 48 hours. For example, the dosing regimen for 1L2 in RCC is 600,000 International Units / kg (0.037 mg / kg) IV q8hr infused over 15 minutes for a maximum 14 doses.
[0138] In some embodiments, the administering one or more methods to elevate common gamma chain cytokmc(s) comprises lymphodepletion before administering the gd T cell(s) and administering simultaneously with introducing the gd T cel l(s) or sequentially an amount of common gamma chain cytokine(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced gd T cell(s)EXAMPLES
[0139] Example 1
[0140] Human PBMCs at Ix l OVmL in a modified culture media were activated on pre- coatcd with anti-V61 antibody Dl-08 or Dl-35 for 5 days in the presence of IL-2 (100 U / mL) m 24- well plates (Costar). On day 5, cell cultures were transduced with g-retroviral constructs encoding an anti-TyrD chimeric antigen receptor (SEQ ID NO:8) in the presence of retronectin. On day 6 cells were returned to the modified culture media and further expanded with feeding and IL-2 replacement as needed. On days 17, 18 or 19, cells were harvested, and remaining ab T cells were depleted using AutoMACS® kit (Miltenyi Biotec). Purity of gd cell population and transduction efficiency was assessed by FACS. In parallel, untransduced cell cultures were expanded in the same manner, without adding the retroviral supernatant. As shown in Fig, 2, untransduced expanded V61 cells elicited some degree of cytotoxicity against 526 and WM266.l-Luc melanoma cell line that are known to express Tyrosinase and present the Tyr369- 377 peptide. This cytotoxicity was augmented by introduction of an anti-TyrD CAR. Cytotoxicity was determined by total luminescence measurement in 96-well plates, by adding luminescent substrate D-Lueiferin (Perkin Elmer) after 18 hr co-incubation at inidcated E / T ratios1001411 Example 2(001421 WM266.4-LUC cells (4x106per animal) were subcutaneously implanted into NSG mice (Jackson Labs). When tumors reached 100-200 mm3size, animals were treated with b l O6anti-TyrD CAR+ V8L cells. Animals were dosed concomitantly with IL-2 (60,000 I ! dose) 3 times a week throughout the study. The results are illustrated in Fig. 3. As shown in Fig. 3, the animals administered the anti-TyrD CAR+ V81 cells exhibited robust control of tumor burden.
[0143] Example 3
[0144] Tyr CAR constructs were introduced into V61 T cells as described above and cells were expanded and tested in cytotoxicity assay against \V M266.4- Luc cells. Control, non-TyrD targeting CAR constructs were used as control. The results are illustrated in Fig, 5 and show the increased cytotoxicity afforded by the anti-TyrD CAR constructs.
[0145] Example 4
[0146] Human PBMCs at 1 x 106 / ml. in growth media w¾re activated in a 24 -we II plate (Costar) pre-coated with anti-V61 antibody Dl-08 or Dl -35 for 5 days in the presence of IL-2(100 U / mL). On day 5, cell cultures were transduced with g-retroviral constructs encoding anti- GPC3 chimeric antigen receptor (SEQ 1D NO: 20 (GC33 CAR) or SEQ ID NO: 22 (GC33 CAR + slLI 5 and GC33 CAR + CO si LI 5) in the presence of retronectin. GC33 CAR is encoded by the nucleic acid sequence of SEQ ID NO:21 ; GC33 CAR + sIL15 is encode by the nucleic acid sequence SEQ ID NO: 23; GC33 CAR + CO sILl 5 includes a codon optimized sILl 5 encoding region and is encoded by the nucleic acid sequence of SEQ ID NO: 24 On day 6 cells were returned to growth media and further expanded with feeding and JL-2 replacement as needed. On days 17, 18 or 19, cells were harvested, and remaining ab T cells were depleted using AutoMACS® kit (Miltenyi Biotec). Purity of yd cell population and transduction efficiency was assessed by FACS (Fig. 6). Briefly. CAR-T cells were stained by incubating cells with 1 pg / mL of soluble recombinant biotinylated GPC3 (R&D Systems). Detection of binding was performed using streptavidin-PE at the manufacturer-suggested dilution of 1 :500.1001471 In parallel, untransduced cell cultures were expanded in the same manner, without adding the retroviral supernatant. Expanded cells were tested in the in vitro cytotoxicity assay on GPC3 positive (HepG2, Hep3B, PLC / PRF / 5). As shown in Fig. 7, untransduced expanded V51 cells elicit some degree of cytotoxicity against liver cancer cell lines that are known to express GPC3. This cytotoxicity is potentiated by introduction of GPC3 CAR, with or without slL I 5 cytokine engineered to he expressed in tandem. Cytotoxicity was determined by total luminescence measurement in 96-well plates, by adding luminescent substrate D-Luciferin (Perkin Elmer) after 18 h co-incubation at indicated E / T ratios.I00148] The preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles and aspects of the invention as well as specific examples thereof, areintended to encompass both structural and functional equivalents thereof- Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary aspects shown and described herein. Rather, the scope and spirit of present invention is embodied by the appended claims.
Claims
Claims:
1. An isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprisesa. a binding domain that specifically binds to a protein-peptide complex comprising a tumor associated antigen (TAA) peptide and an MHC protein, wherein the complex is expressed on a surface of a solid tumor cell, optionally wherein the binding domain binds the complex in an HLA restricted manner; b. a CD8a hinge domain;c. a CDS a transmembi aiie domain,d. a costimulatory signaling region selected from a 4- I BB costimulatory signaling region and a CD27 costimulatory signaling region; ane. a OB3z signaling domain.
2. The isolated nucleic acid sequence of claim 1. wherein the (a)-(e) are in 5:to 3’ order.
3. The isolated nucleic acid sequence of claim 1 r 2, wherein the TA A comprises a contiguous region of TyrD.
4. The isolated nucleic acid sequence of claim 3, wherein the contiguous region of TyrD comprises at least, or at least about, 4 and no more than, or no more than about, 12 contiguous amino acids of TyrD, preferably, or preferably about, 7, 8, or 9 contiguous amino acids of TyrD.
5. The isolated nucleic acid sequence of claim 4, wherein the contiguous region of TyrD is Tyri )¾ -. ?.
6. The isolated nucleic acid sequence of any one of claims 1 to 5, wherein the binding domain that specifically binds the TAA peptide MHC complex specifically binds HLA- A2 / Ί yrD369-377.
7. The isolated nucleic acid sequence of any one of claims 1 to 6, wherein the binding domain specifically binds to the epitope bound by, or competes with, an antibody comprising:a. a CDRH I comprising TSGMGVS (SEQ ID NO: 33);b. a CDRH2 comprising HIYWDDD RYNPSLKS (SEQ ID NO: 34);c. a CDRH 3 comprising KDYGSSFYAMHY (SEQ ID NO: 35);d. a CDRL 1 comprising KASQD1H Y1 A (SEQ ID NO: 36);e. a CDRL1 comprising YTSTLQP (SEQ ID NO: 37); andf. a CDRL2 comprising LQYDNLWT (SEQ ID NO: 38).
8. An isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR), wherein the CAR comprisesa. a binding domain that specifically binds to a tumor associated antigen (TAA) expressed on a surface of a solid tumor cell, optionally wherein the antigen is a protein-peptide complex, wherein the protein is an MHC protein, wherein the binding domain binds the protein-peptide complex in an I II \ restricted manner;b. a CD8a hinge domain;c. a CD8a transmembrane domain;d. a costimulatory signaling region selected from a 4- IBB costimulatorysignaling region and a CD27 costimulatory signaling region: ande. a OΌ3z signaling domain.
9. The isolated nucleic acid sequence of claim 8. wherein the binding domain specifically binds an epitope within GPC3 expressed on the surface of a solid tumor cell.
10. The isolated nucleic acid sequence of claim 9, wherein the binding domain comprises the following complementarity determining regions (CDRs) binds the same GPC3 epitope as an antibody comprising the following CDRs, and / or competes for binding to an epitope of GPC3 with an antibody comprising the following CDRs:a. a CDRH 1 comprising a sequence of DYEMH (SEQ ID NO: 39) (or GYTFTDYEMH (SEQ ID NO: 40)):b. a CDRH2 comprising a sequence of A LDPKTGDTA Y SQKFKG (SEQ ID NO: 41 );c. a CDRH 3 comprising a sequence of FYSYTY (SEQ ID NO: 42);d. a CDRL I comprising a sequence of RSSQSLVI ISNRNTYLH(SEQ ID NO: 43);e. a CDRL2 comprising a sequence of KVSNRFS (SEQ ID NO: 44); and / or af. CDRL3 comprising a sequence of SQNTHVPPT (SEQ ID NO:45).1 1. The isolated nucleic acid sequence of any one of claims I to 10, wherein the CAR comprises:a. a CD8a hinge domain comprising SEQ ID NO: 1(PTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIY) or SEQ iD NO:2(TTTPAPRPPTPAPTiASQPLSLRPBACRPAAGGAVUTRGLDFACDiY); h. a CD8a transmembrane domain comprising SEQ ID NOD(fWAPLAGTCGVLLLSLVITLYC); and / orc. a OB3z signaling domain comprising:(i) SEQ ID NO:4(RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR); or(ii) SEQ ID NOD(RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL DKRRGRDPE GGKPRRKNPQEGLYNELQKDKMAE AY SE I GMKGERRRGKGl IDG L Y QGLSTATKDT YDAL HMQALPPR)12. The isolated nucleic acid sequence of claim I L wherein the CA R comprises: a. a 4-1 BB costimulatory signaling region comprising SEQ ID OD (KRGRKKLLYiFKQPFMRPVQYTQEEDGCSCRFPEEEEGGCEL); or b. a CD27 costimulatory signaling region comprising SEQ ID NO:7.(QRRK YRSNKG ESP VE P A EPCH Y SCP REEEG STIPIQED Y RKPEP A C S P),wherein the isolated nucleic acid encodes the 4-1 BB costimulatory signaling region comprising SEQ ID NO:6 and the CD27 costimulatorv signaling region comprising SEQ ID NO:7.
13. The isolated nucleic acid sequence of any one of claims 1 to 12, wherein the nucleic acid further encodes:a. a secreted cytokine orb. a secreted common gamma chain interleukin; orc. a secreted IL-15, preferably wherein the IL-15 comprises thesequence of SEQ ID NO: 14, more preferably wherein the II - 15 comprises the sequence of SEQ ID NO: 14 operab!y linked to a secretion signal sequence of SEQ ID NO: 12, or wherein the IL-15 comprises the sequence of SEQ ID NO: 14 operably linked to a secretion signal sequence of SEQ ID NO: 26; ord. a secreted common gamma chain interleukin, preferably IL- 15, and a multi-cistronic linker region amino terminal to the interleukin or interleukin secretion signal, preferably wherein the multicistronic linker region comprises a sequence of any one of SEQ I D NOs: 15- 17, 25, or 27-30, or a combination thereof, or encodes an internal ribosome entry site, e.g., SEQ ID NO: 31 or 32.
14. The isolated nucleic acid sequence of claim 13, wherein:a. the secretion signal comprises a sequence of SEQ ID NO: 12 or SI 0 ID NO:
26. preferably SEQ ID \0: I 2: and / orb. the sILl 5 domain comprises a sequence of SEQ I D NO: 14: and / or c. the P2A cleavage sequence comprises a sequence of SEQ ID NO:15 or SEQ ID NO:25; and / ord. the furin cleavage sequence comprises a sequence of SE1Q ID NO:16; and / ore. the CAR comprises, in amino to carboxy order, a sequence of SEQ ID NO: 17, SEQ ID NO: 12, and SEQ ID NO: 14.
15. The isolated nucleic aci sequence of any one of claims i to 14, wherein:a. the binding domain specifically binds to HLA-A2 / TyrD369.377 and the nucleic acid encodes SEQ ID NO: 8, or SEQ ID NO: 1 : b. the binding domain specifically binds to1encodes SEQ ID NO: 20, or 22.
16. The isolated nucleic acid sequence of claim 15, wherein the nucleic acid comprises the sequence of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 21 , 23, or 24.
17. A polypeptide comprising a chimeric antigen receptor comprising an amino acid sequence encoded by any one of the preceding isolated nucleic acids of claims 1 to 16.
18. A v6 T cell comprising a polypeptide according to claim 17 or comprising a nucleic acid encoding a CAR construct according to any one of claims 1 to 16, wherein the gd T cell functionally expresses the a binding domain of the polypeptide or nucleic acid encoded CAR on the surface of the gd T cell.
19. The gd T cell of claim 18, wherein the gd T cell exhibits in vitro and / or in vivo cell killing activity against a solid tumor cell that exhibits cel) surface expression of the tumor associated antigen (TAA).
20. The gd T cell of claim 19, wherein the solid tumor cell killing activity of said gd T cel! is greater than an innate level of in vitro and / or in vivo solid tumor ceil killing activity in a control gd T cell that does not comprise a CAR construct.21 . The g6 T ceil of claim 20, wherein the gd T cell exhibits the increased solid tumor cell killing activity against 111. A class I+solid tumor cells.
22. The gd T cel l of any one of claims 19 to 21 , wherein the solid tumor cel l killing activity or increased solid tumor cell killing activity persists for, lor about, for at least, or for at least about, 6 days to 1 0 days after first contact with the solid tumor ceil.
23. T he gd T ceil of any one of claims 18 to 22, wherein the gd T cell proliferates in response to contact with a solid tumor cell that exhibits cell surface expression of the tumor associated antigen (TAA).
24. The gd T cell of any one of claims 18 to 22, wherein the gd T cell exhibits increased proliferation in response to contact with a soli tumor cell that exhibits cell surfaceexpression of the tumor associated antigen (TAA) as compared to a control gd T cell that does not functionally express the nucleic acid encoded CAR on the surface of the gd T cell.25, The gd T cell of any one of claims 18 to 24, wherein the gd T cell prol iferates in a host organism that comprises the solid tumor cell that exhibits cell surface expression of the tumor associated antigen (TAA).
26. The gd T cell of any one of claims 18 to 25, wherein the gd T cell proliferation or increased gd T cell proliferation persists for, for about, for at least, or for at least about, 6 days to 180 days after first contact with the solid tumor cell.
27. The gd T cell of any one of claims 18 to 26, wherein the gd T cell expresses pro- inflammatory cytokines comprising tumor necrosis factor alpha or interferon gamma after contact with the solid tumor cell.28 The gd T cell of any one of claims 1 to 27, wherein the gd T cell exhibits reduced, substantially reduced, essentially none, or no graft versus host response when introduced into an allogeneic host in comparison to a graft versus host response exhibite by an ab T eeLl administered to an allogeneic host29. The y6 T cell of any one of claims 18 to 28, wherein the gd T cell is a 61 , a d2, a 63, or a 64 gd T cell, preferably a 62 v6 T cell, more preferably a 61 g6 T cell.
30. A plurality of gd T cells accor ding to any one of claims 1 8 to 29.
31. The plurality of gd T cells of claim 30, wherein the plurality comprises at least about 10sgd T cells, preferably from about 10sgd T cells to about I0Ugd T cells.
32. The plurality oίgd T cells of claim 30 or 31, wherein the plurality comprises a composition that is at least 60%, 80%, or from about 60%, or 80% to about 90%, or 95%, 61, 62, 63, or 64 gd T cells, preferably 61 or 62 gd T cells, more preferably 62 gd T cells, most preferably 61 gd T cells.
33. L method of making the gd T cell of any one of claims 18 to 29 or a plurality of gd T cells of any one of claims 30 to 32, wherein the method comprises transfecting gd T cell(s) with a construct comprising an isolated nucleic acid sequence according to any one of claims 3 to16.34 The method of claim 33, wherein the method comprises retroviral transduction, preferably gammaretroviral transduction.35 The method of claim 33 or 34, wherein the method comprises ex vivo expansion of the gd T cell(s), wherein the ex vivo expansion is performed before transfection and / or after transfection of the isolated nucleic acid sequence.
36. A pharmaceutical composition comprising a pharmaceutically acceptable excipient a d a gd T cell of any one of claims 18 to 29 or a plurality of gd T cells of any one of claims 30 to 32.
37. A method of killing a solid tumor cell, the method comprising contacting the solid tumor cell with a tumor cell killing effective amount of a gd T cell of any one of claims 18 to 2d; a plurality of gd T cells of any one of claims 30 to 32: or a pharmaceutical composition of claim 36.
38. The method of claim 37, wherein the method comprises introducing a therapeutically effective amount of the gd T cell(s) or the pharmaceutical composition into a host organism comprising the solid tumor ceil.
39. The method of clai 38, wherein the method comprises introducing into a host organism comprising the sol id tumor cel l a therapeutically effective amoun t of the gd T cell( s) or the pharmaceutical composition and simultaneously or sequentially administering one or more methods to elevate common gamma chain cytokine(s).
40. The method of claim 39, wherein the administering one or more methods to elevate common gamma chain cytokine(s) comprises administering simultaneously with i ntroducing the gd T cel!(s) or sequential ly an amount of common gamma chain cytokine(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced gd T cell(s), preferably wherein the method comprises administering IL-2, more preferably wherein the method comprises administering 1L-15.41 The method of claim 40, wherein the one or more methods to elevate common gamma chain cytokine(s) comprise administering an amount of common gamma chain cytokine(s) effective to increase proliferation, cytotoxic activity, persistence, or the combination thereof of the introduced gd T cell(s) before and / or after introducing the gd T celi(s).
42. The method of any one of claims 39 to 41 , wherein the one or more methods to elevate common gamma chain cytokine(s) comprises lymphodepletion before introducing the gd T cell(s).
43. The method of any one of claims 39 to 41 , wherein the one or more methods to elevate common gamma chain cytokine(s) comprises secretion of one or more common gamma chain cytokine(s) from the introduced yd T cell(s)44 The method of any one of claims 38 to 43, wherein the method reduces the in vivo tumor burden in the host organism, and / or increases the mean survival time of the host organism as compared to a control organism, wherein the control organism is not treated with the gd T cell(s) or the pharmaceutical composition.
45. The method of any one of claims 37 to 44, wherein the method is a method of treating cancer in a subject in need thereof. ό Use of tumor cell killing effective amount of a y 0 1 cell of any one of claims 18 to 29; a plurality of gd T cells of any one of claims 30 to 32; or a pharmaceutical composition of claim 36 in the manufacture of a medicament for the treatment of a solid tumor cell cancer in a subject in need thereof.
47. A method of treating cancer in a subject in need thereof, the method comprising administering a therapeutically effective amount of gd T cells, wherein the cancer comprises solid tumor cells that exhibit cell surface expression of TyrD or GPC3.
48. The method of claim 47, wherein the method comprises simultaneously with the administering of gd T cel ls or sequential ly, administering one or more methods to elevate common gamma chain cytokine(s).
49. The method of claim 47 or 48, wherein the method comprises performing a plural ity of administrations of the gd T cel ls, wherein the interval between the plurality of administrations is at least about a week, preferably at least about 2, 3, 4, 5, 6, 7, 8, or 12 weeks, and / or no more than once every 6 or 12 months.
50. A pharmaceutical composition for use in any one of the methods of claims 47 to 49.