Integrin α7β1 antibodies and uses thereof

ZA202608600APending Publication Date: 2026-09-30MORPHIC THERAPEUTIC INC
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
ZA202608600
Authority / Receiving Office
ZA · ZA
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-07-03
Filing Date
2026-08-28
Publication Date
2026-09-30

AI Technical Summary

Technical Problem

Current treatments for muscular dystrophies, such as Duchenne Muscular Dystrophy (DMD), primarily focus on mitigating symptoms and improving quality of life, lacking effective approaches to address the underlying muscle membrane integrity issues.

Method used

Development of integrin α7β1 antibodies that stabilize the α7β1 integrin in extended conformations, enhancing muscle membrane adhesion to the extracellular matrix, thereby restoring muscle function and reducing fibrosis.

Benefits of technology

The antibodies improve locomotive ability and increase muscle force in patients with dystrophinopathies by stabilizing α7β1 integrin, effectively addressing the muscle integrity issues associated with DMD.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

NOT VISIBLE DUE TO STATUS OF PATENT
Need to check novelty before this filing date? Find Prior Art

Description

[0001] Attorney Docket No.: MTX-04225 INTEGRIN α7β1 ANTIBODIES AND USES THEREOF CROSS-REFERENCE TO RELATED APPLICATIONS [1] This application claims the benefit of priority to U.S. Provisional Application Nos. 63 / 667,476, filed July 3, 2024; and 63 / 566,145, filed March 15, 2024; the contents of each of which are hereby incorporated by reference in their entireties. BACKGROUND [2] Integrin α7β1 is a major laminin receptor in skeletal and cardiac muscle. It serves as a transmembrane linkage between basal lamina and muscle cell membrane to maintain functional integrity of muscle cells. Loss of function mutations of ITGA7 in humans results in congenital myopathies and adult-onset cardiomyopathy. In contrast, overexpression of ITGA7 in the skeletal muscle ameliorated the development of muscular dystrophy and overexpression of ITGA7 in the cardiomyocyte protects cardiomyocyte from ischemia / reperfusion injury. [3] Muscular dystrophies, such as Duchenne Muscular Dystrophy (DMD), are a category of genetically inherited degenerative disorders characterized by progressive deterioration of muscles and loss of muscle related functions throughout the body. Existing treatments for muscular dystrophy disorders, including dystrophinopathies, simply focus on mitigating the effects of the disease and improving quality of life, often through glucocorticoids, physical therapy or use of orthopedic devices. There is a need for new approaches to treat dystrophinopathies, including DMD. SUMMARY OF THE INVENTION [4] The present disclosure provides, among other things, integrin α7β1 antibodies and therapeutic uses of such antibodies in effectively treating diseases or disorders associated with muscle membrane integrity, such as Duchenne Muscular Dystrophy (DMD). As described herein, the present disclosure is based, in part, on identification of integrin α7β1 antibodies that are effective in stabilizing the α7β1 integrin in the extended-closed and extended-open conformations and therefore enhancing the binding to laminin ligands. As a result, the anti-α7β1 Attorney Docket No.: MTX-04225 antibodies of the present disclosure potently increase adhesion of muscle membranes (sarcolemma) to the extracellular matrix, restoring some or all of the sarcolemma damages due to the absence of functional dystrophin and ultimately improving locomotive ability, increasing muscle force, and reducing fibrosis in patients with dystrophinopathies. [5] In one aspect, the present disclosure provides an antibody or antigen-binding fragment thereof that binds to the calf-2 domain of α7β1 integrin but does not compete with the 20TFT antibody, wherein the antibody stabilizes the extended conformations of α7β1 integrin. [6] In one aspect, the present disclosure provides an antibody or antigen-binding fragment thereof that binds to α7β1 integrin and competes with a reference antibody for binding to α7β1, wherein the reference antibody comprises an HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2, HCDR1B), an HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16, HCDR2B), an HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32, HCDR3B), an LCDR1 of sequence SLRSYY (SEQ ID NO: 47, LCDR1B), an LCDR2 of sequence GKN (SEQ ID NO: 59, LCDR2B), and an LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70, LCDR3B). [7] In one aspect, the present disclosure provides an antibody or antigen-binding fragment thereof that binds to α7β1 integrin, wherein the antibody or antigen-binding fragment thereof comprises (a) a means for stabilizing the extended conformations of the α7β1 integrin and, optionally, (b) an Fc domain. In some embodiments, the antibody is not the 20TFT antibody. [8] In one aspect, the present disclosure provides an antibody or antigen-binding fragment thereof that binds to α7β1, wherein the antibody or antigen-binding fragment thereof binds to a region comprising positions 856-862, 867-889, 1011-1017, 897-905, or 1002-1010 of the amino acid sequence of integrin α7, and wherein the antibody or antigen-binding fragment thereof stabilizes the extended conformations of α7β1 integrin. [9] In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 856-862, 867-889, or 1011-1017 of the amino acid sequence of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 856-862 of the amino acid sequence of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 867-889 of the amino acid sequence of integrin α7. In some embodiments, the Attorney Docket No.: MTX-04225 antibody or antigen-binding fragment thereof binds to a region comprising positions 1011-1017 of the amino acid sequence of integrin α7.

[0010] In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising residues M856, A857, I858, P859, Q860, Q861, and L862 of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising residues V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, and T889 of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising residues F1011, D1102, R1103, A1104, A1105, V1106, and L1107 of integrin α7.

[0011] In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 897-905 or 1002-1010 of the amino acid sequence of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 897-905 of the amino acid sequence of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions 1002- 1010 of the amino acid sequence of integrin α7.

[0012] In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions L897, R898, T899, L900, G901, S902, A903, F904, and L905 of integrin α7. In some embodiments, the antibody or antigen-binding fragment thereof binds to a region comprising positions V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, and S1100 of integrin α7.

[0013] In one aspect, the present disclosure provides an antibody or antigen-binding fragment thereof that binds to the calf-1 domain of α7β1 integrin and stabilizes the extended conformations of α7β1 integrin.

[0014] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin and competes with a reference antibody for binding to α7β1 antibody, wherein the reference antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 of sequence KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75, LCDR3G). Attorney Docket No.: MTX-04225

[0015] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin and competes with a reference antibody for binding to α7β1 antibody, wherein the reference antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24, HCDR2J), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 of sequence QDINKF (SEQ ID NO: 53, LCDR1H), a LCDR2 of sequence YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77 LCDR3I).

[0016] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds to α7β1 integrin comprising (a) a means for binding to calf-1 domain of α7β1 integrin and (b) an Fc domain.

[0017] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody binds to a region comprising positions 771-778, 793-779, or 803-805 of integrin α7, wherein the antibody stabilizes the extended conformations of α7β1 integrin. In some embodiments, the region comprises amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and / or T805 according to human α7 amino acid numbering.

[0018] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2, HCDR1B), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16, HCDR2B), a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32, HCDR3B), a LCDR1 of sequence SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 of sequence GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70, LCDR3B).

[0019] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYTFTGYY (SEQ ID NO:1, HCDR1A), a HCDR2 of sequence INPNSGGT (SEQ ID NO: 15, HCDR2A), a HCDR3 of sequence AREGANWDYYYYGMDV (SEQ ID NO: 31, HCDR3A), a LCDR1 of sequence SSNIGSKT (SEQ ID NO: 46, LCDR1A), a LCDR2 of sequence SNN (SEQ ID NO: 58, LCDR2A), and a LCDR3 of sequence AAWDDSLNGPV (SEQ ID NO: 69, LCDR3A). Attorney Docket No.: MTX-04225

[0020] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSYS (SEQ ID NO:3, HCDR1C), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17, HCDR2C), a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33, HCDR3C), a LCDR1 of sequence SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 of sequence GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 of sequence NSRDSSGNHVV (SEQ ID NO: 71, LCDR3C).

[0021] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 of sequence ISDSGGIA (SEQ ID NO: 18, HCDR2D), a HCDR3 of sequence VRDGY (SEQ ID NO: 34, HCDR3D), a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48, LCDR1C), a LCDR2 of sequence TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72, LCDR3D).

[0022] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19, HCDR2E), a HCDR3 of sequence VKDGY (SEQ ID NO: 35, HCDR3E), a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48, LCDR1C), a LCDR2 of sequence TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72, LCDR3D).

[0023] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSRFW (SEQ ID NO: 5, HCDR1E), a HCDR2 of sequence TKQDGSEK (SEQ ID NO: 20, HCDR2F), a HCDR3 of sequence AREGSGAYWAFDI (SEQ ID NO: 36, HCDR3F), a LCDR1 of sequence QSLVHNDGNTY (SEQ ID NO: 49, LCDR1D), a LCDR2 of sequence KIS (SEQ ID NO: 49, LCDR1D), and a LCDR3 of sequence LQATQFPLT (SEQ ID NO: 73, LCDR3E).

[0024] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GGSISSYY (SEQ ID NO: 6, HCDR1F), a HCDR2 of sequence IYTRGST (SEQ ID NO: 21, HCDR2G), a HCDR3 of sequence ARVFGGNYRFDAFHI (SEQ ID NO: 37, HCDR3G), a LCDR1 of sequence SSNIGAGYD (SEQ ID NO: 50, LCDR1E), a LCDR2 of sequence GNN Attorney Docket No.: MTX-04225 (SEQ ID NO: 62, LCDR2E), and a LCDR3 of sequence QSYDSSLSGYV (SEQ ID NO: 74, LCDR3F).

[0025] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 of sequence KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75, LCDR3G).

[0026] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYTFTSYW (SEQ ID NO: 8, HCDR1H), a HCDR2 of sequence IYPSDSYT (SEQ ID NO: 23, HCDR2I), a HCDR3 of sequence TRRANYVGAMDY (SEQ ID NO: 39, HCDR3I), a LCDR1 of sequence SSVSY (SEQ ID NO: 52, LCDR1G), a LCDR2 of sequence ATS (SEQ ID NO: 64, LCDR2G), and a LCDR3 of sequence QQWSSNPLT (SEQ ID NO: 76, LCDR3H).

[0027] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24, HCDR2J), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 of sequence QDINKF (SEQ ID NO: 53, LCDR1H), a LCDR2 of sequence YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77, LCDR3I).

[0028] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25, HCDR2K), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 of sequence QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 of sequence YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77, LCDR3I).

[0029] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25, Attorney Docket No.: MTX-04225 HCDR2K), a HCDR3 of sequence ARDGYYGHFDV (SEQ ID NO: 41, HCDR3K), a LCDR1 of sequence QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 of sequence YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 of sequence LQYDNLRA (SEQ ID NO: 78, LCDR3J).

[0030] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 of sequence ISIGGSA (SEQ ID NO: 26, HCDR2L), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0031] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0032] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 of sequence YSS (SEQ ID NO: 67, LCDR2J), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0033] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 of sequence ARGGDYDPMDY (SEQ ID NO: 43, HCDR3M), a LCDR1 of sequence QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0034] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28, Attorney Docket No.: MTX-04225 HCDR2N), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0035] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 of sequence ISVGGSI (SEQ ID NO: 29, HCDR2O), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0036] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0037] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSNCA (SEQ ID NO: 12, HCDR1L), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 of sequence QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0038] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 of sequence TRGGDYDAMDY (SEQ ID NO: 44, HCDR3N), a LCDR1 of sequence QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 of sequence YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0039] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFSLSTSDMG (SEQ ID NO: 13, HCDR1M), a HCDR2 of sequence IYWDDDK (SEQ ID NO: Attorney Docket No.: MTX-04225 30, HCDR2P), a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 of sequence QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 of sequence RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 of sequence LHYDDFPLT (SEQ ID NO: 81, LCDR3M).

[0040] In one aspect, the present disclosure provides an antibody or antigen-binding fragment that binds to α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GFSLSTSDLG (SEQ ID NO: 14, HCDR1N), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30, HCDR2P), a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 of sequence QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 of sequence RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 of sequence LQYDDFPLT (SEQ ID NO: 82, LCDR3N).

[0041] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 27), and a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

[0042] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGREWYYDV (SEQ ID NO: 103); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

[0043] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGEEWYHDV (SEQ ID NO: 104); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence AQSTQLPYT (SEQ ID NO: 107).

[0044] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises a, HCDR1 of SEQ ID NO: Attorney Docket No.: MTX-04225 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0045] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0046] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0047] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0048] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0049] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0050] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.

[0051] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: Attorney Docket No.: MTX-04225 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107.

[0052] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0053] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0054] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.

[0055] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0056] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107.

[0057] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 128, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 129; Attorney Docket No.: MTX-04225 ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 131; iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 132, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 133; iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 134, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 135; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 136, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 137; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 138, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 139; or vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 140, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 141.

[0058] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 118, and a light chain comprising an amino acid sequence of SEQ ID NO: 119; a heavy chain comprising an amino acid sequence of SEQ ID NO: 120, and a light chain comprising an amino acid sequence of SEQ ID NO: 121; ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 199, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 200; iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 201, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 202; Attorney Docket No.: MTX-04225 iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 203, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 204; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 205, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 206; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 207, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 208; vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 209, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 210; viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 211, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 212; ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 213, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 214; x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 215, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 216; xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 217, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 218; xii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 219, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 220; xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 221, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 222; or Attorney Docket No.: MTX-04225 xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 223, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 224.

[0059] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 143; ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 144, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 145; iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 146, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 147; iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 148, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 149; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 150, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 151; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 152, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 153; vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 154, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 155; viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 156, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 157; Attorney Docket No.: MTX-04225 ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 158, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 159; x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 160, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 161; xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 162, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 163; xii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 164, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 165; xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 166, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 167; xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 170, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 171; xv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 172, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 173; or xvi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 186, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 187.

[0060] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 108, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 109; Attorney Docket No.: MTX-04225 ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 110, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 111.

[0061] In one aspect, the present disclosure provides an antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 112, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 114, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; iii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 115, and a light chain comprising an amino acid sequence of SEQ ID NO: 116; or iv) a heavy chain comprising an amino acid sequence of SEQ ID NO: 117, and a light chain comprising an amino acid sequence of SEQ ID NO: 116.

[0062] In some embodiments, the antibody or antigen-binding fragment has an affinity (Kd) to α7β1 integrin or a fragment thereof of between about 0.1 to 30 nM. In some embodiments, the antibody or antigen-binding fragment has an affinity (Kd) to α7β1 integrin or a fragment thereof of between about 0.5 to 30 nM. In some embodiments, the α7β1 integrin or fragment thereof comprises α7β1 ectodomain, B1 ectodomain, a7 leg, calf-1 domain, calf-2 domain, or calf-1 and calf-2 domains. In some embodiments, the α7β1 integrin or fragment thereof comprises α7β1 ectodomain. In some embodiments, the α7β1 integrin or fragment thereof comprises B1 ectodomain. In some embodiments, the α7β1 integrin or fragment thereof comprises a7 leg. In some embodiments, the α7β1 integrin or fragment thereof comprises calf-1 domain. In some embodiments, the α7β1 integrin or fragment thereof comprises calf-2 domain. In some embodiments, the α7β1 integrin or fragment thereof comprises calf-1 and calf-2 domains.

[0063] In some embodiments, the α7β1 integrin comprises human α7β1 integrin. In some embodiments, the antibody or antigen-binding fragment has an affinity to a human α7β1 ectodomain of about 3 to 6 nM.

[0064] In some embodiments, the antibody or antigen-binding fragment activates α7β1 integrin with a maximal efficacy (Emax) of between 100% to 300% as compared to the 20TFT Attorney Docket No.: MTX-04225 antibody. In some embodiments, the antibody or antigen-binding fragment activates α7β1 integrin with a maximal efficacy (Emax) of between 100% to 300% as compared to the TS2 / 16 antibody.

[0065] In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 0.3 nM to 50 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of about 0.3 nM. In some embodiments, the antibody or antigen- binding fragment has an EC50 value of between 0.3 nM and 1 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 0.3 nM and 5 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 0.3 nM and 10 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 1 nM and 5 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 1 nM and 10 nM. In some embodiments, the antibody or antigen- binding fragment has an EC50 value of between 5 nM and 10 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 5 nM and 50 nM. In some embodiments, the antibody or antigen-binding fragment has an EC50 value of between 10 nM and 50 nM.

[0066] In some embodiments, the antibody or antigen-binding fragment comprises a Fab, a single chain Fv (scFv), a single domain antibody (sdAb), a VHH, one or more CDRs, a variable heavy chain (VH), a variable light chain (VL), a Fab-like bispecific antibody (bsFab), a single- domain antibody-linked Fab (s-Fab), an antibody, or a combination thereof. In some embodiments, the antibody or antigen-binding fragment comprises a Fab. In some embodiments, the antibody or antigen-binding fragment comprises a single chain Fv (scFv). In some embodiments, the antibody or antigen-binding fragment comprises a single domain antibody (sdAb). In some embodiments, the antibody or antigen-binding fragment comprises a VHH. In some embodiments, the antibody or antigen-binding fragment comprises one or more CDRs. In some embodiments, the antibody or antigen-binding fragment comprises a variable heavy chain (VH). In some embodiments, the antibody or antigen-binding fragment comprises a variable light chain (VL). In some embodiments, the antibody or antigen-binding fragment comprises a Fab- like bispecific antibody (bsFab). In some embodiments, the antibody or antigen-binding fragment comprises a single- domain antibody-linked Fab (s-Fab). In some embodiments, the antibody or antigen-binding fragment comprises an antibody. Attorney Docket No.: MTX-04225

[0067] In some embodiments, the antibody or antigen-binding fragment is a humanized antibody. In some embodiments, the antibody or antigen-binding fragment is a human antibody. In some embodiments, the antibody or antigen-binding fragment is a chimeric antibody.

[0068] In some embodiments, the antibody or antigen-binding fragment is derived from IgG. In some embodiments, the antibody or antigen-binding fragment is derived from IgG1, IgG2, IgG3, or IgG4. In some embodiments, the antibody or antigen-binding fragment is derived from IgG1. In some embodiments, the antibody or antigen-binding fragment is derived from IgG2. In some embodiments, the antibody or antigen-binding fragment is derived from IgG3. In some embodiments, the antibody or antigen-binding fragment is derived from IgG4.

[0069] In some embodiments, the antibody or antigen-binding fragment comprises a Fc region. In some embodiments, the Fc region contains one or more mutations.

[0070] In some embodiments, the present disclosure provides a method of treating a disease or disorder in a subject associated with an α7β1 integrin defect. In some embodiments, the method comprises administering to the subject an antibody or antigen-binding fragment of the instant disclosure.

[0071] In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises cardiomyopathy, congestive heart failure, muscular dystrophy, muscular atrophy and GLP-1 receptor, GIP / GLP-1 receptor agonism-induced lean muscle loss in obesity patients. In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises cardiomyopathy. In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises congestive heart failure. In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises muscular dystrophy. In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises muscular atrophy. In some embodiments, the disease or disorder associated with an α7β1 integrin defect comprises sarcopenia.

[0072] In some embodiments, the administration of the antibody or antigen-binding fragment to the subject results in amelioration of one or more symptoms of the muscular dystrophy. Attorney Docket No.: MTX-04225

[0073] In some embodiments, administration reduced one or more serum biomarkers of muscle fiber damage. In some embodiments, the one or more serum biomarkers comprises creatine kinase, LDH cytotox, and / or IL-6. In some embodiments, the serum biomarker comprises creatine kinase. In some embodiments, the serum biomarker comprises LDH cytotox. In some embodiments, the serum biomarker comprises IL-6.

[0074] In some embodiments, the administration reduces muscle damage, inflammation, fibrosis, necrosis, and / or atrophy. In some embodiments, the administration reduces muscle damage. In some embodiments, the administration reduces inflammation. In some embodiments, the administration reduces fibrosis. In some embodiments, the administration reduces necrosis. In some embodiments, the administration reduces atrophy.

[0075] In some embodiments, the administration of the antibody or antigen-binding fragment is to a muscle cell. In some embodiments, the muscle cell comprises a mutation in a dystrophin gene. In some embodiments, the muscle cell lacks dystrophin. In some embodiments, the muscle cell comprises a non-functional dystrophin.

[0076] In some embodiments, the muscular dystrophy comprises Duchenne muscular dystrophy, Becker muscular dystrophy, limb girdle muscular dystrophy, Fukuyama congenital muscular dystrophy (FCMD) or merosin deficient congenital muscular dystrophy type lA (MDC1A). In some embodiments, the muscular dystrophy comprises Duchenne muscular dystrophy. In some embodiments, the muscular dystrophy comprises Becker muscular dystrophy. In some embodiments, the muscular dystrophy comprises limb girdle muscular dystrophy. In some embodiments, the muscular dystrophy comprises Fukuyama congenital muscular dystrophy (FCMD). In some embodiments, the muscular dystrophy comprises merosin deficient congenital muscular dystrophy type lA (MDC1A).

[0077] In some embodiments, the muscle atrophy is due to aging, inactivity, denervation or other underlying diseases including chronic obstructive pulmonary disorder, cancer-associated cachexia, diabetes, renal failure, cardiac failure. In some embodiments, muscle atrophy is due to aging. In some embodiments, muscle atrophy is due to inactivity. In some embodiments, muscle atrophy is due to denervation. In some embodiments, muscle atrophy is due to other underlying diseases. Attorney Docket No.: MTX-04225

[0078] In some embodiments, the loss of lean muscle mass in obese patient who is treated with glucagon-like peptide 1 receptor agonist.

[0079] In some embodiments, the heart failure due to genetically inherited cardiomyopathies. In some embodiments, the heart failure due to ischemic heart disease.

[0080] In some embodiments, the present disclosure provides a pharmaceutical composition comprising the antibody or antigen-binding fragment and a pharmaceutically acceptable carrier. In some embodiments, the antibody or antigen-binding fragment is administered parenterally. In some embodiments, the antibody or antigen-binding fragment is administered orally.

[0081] In some embodiments, the antibody or antigen-binding fragment is administered intravenously. In some embodiments, the antibody or antigen-binding fragment is administered intradermally. In some embodiments, the antibody or antigen-binding fragment is administered transdermally. In some embodiments, the antibody or antigen-binding fragment is administered intraocularly. In some embodiments, the antibody or antigen-binding fragment is administered intranasally. In some embodiments, the antibody or antigen-binding fragment is administered intramuscularly. In some embodiments, the antibody or antigen-binding fragment is administered subcutaneously. In some embodiments, the antibody or antigen-binding fragment is administered transmucosally.

[0082] In some embodiments, the present disclosure provides a method of treating cardiomyopathy, congestive heart failure, or other cardiac muscle disorder, by administering to a subject the antibody or antigen-binding fragment.

[0083] In one aspect, the present disclosure provides, among other things, a method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising: an antibody means for facilitating the extended-open conformation of the α7β1 integrin; and one or more physiologically acceptable carriers, excipients or diluents.

[0084] In one aspect, the present disclosure provides, among other things, a method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a therapeutic agent to increase expression of α7, wherein the increase in expression of α7 results in Attorney Docket No.: MTX-04225 amelioration of one or more symptoms of the muscle atrophy. In some embodiments, the therapeutic agent comprises an antibody or antigen-binding fragment of the instant disclosure.

[0085] In one aspect, the present disclosure provides, among other things, a method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising an antibody or antigen-binding fragment of the instant disclosure, wherein the administration results in amelioration of one or more symptoms of the muscle atrophy.

[0086] In some embodiments, the subject has reduced muscle loss as compared to a control upon administration of the antibody or the binding fragment thereof.

[0087] In some embodiments, the subject has less than 40% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 35% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 30% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 28% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 27% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 26% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 25% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 24% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 23% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 22% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 21% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 20% muscle weight Attorney Docket No.: MTX-04225 change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 19% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 18% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 17% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 16% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 15% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 14% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 13% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 12% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 11% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 10% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 9% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 8% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 7% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 6% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 5% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 4% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 3% muscle weight Attorney Docket No.: MTX-04225 change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 2% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof. In some embodiments, the subject has less than 1% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof.

[0088] In some embodiments, the control is a baseline value prior to administration of the antibody or the binding fragment thereof.

[0089] In some embodiments, the control is historical data.

[0090] In some embodiments, the control is a comparable subject without the administration of the antibody or antigen binding fragment thereof.

[0091] In one aspect, the present disclosure provides, among other things, a method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising (a) an antibody means for stabilizing the extended conformations of the α7β1 integrin and (b) one or more physiologically acceptable carriers. In some embodiments, the antibody means for stabilizing the extended conformations of the α7β1 integrin comprises an antibody or antigen-binding fragment of the instant disclosure.

[0092] In one aspect, the present disclosure provides, among other things, a method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising (a) an antibody means for increasing α7 expression and (b) one or more physiologically acceptable carriers. In some embodiments, the antibody means for increasing α7 expression comprises an antibody or antigen-binding fragment of the instant disclosure. BRIEF DESCRIPTION OF DRAWINGS

[0093] Drawings are for illustration purposes only, not for limitation.

[0094] FIG. 1A shows α7β1 integrin domains used to generate antibodies of the present disclosure. FIGs. 1B-1D are series of exemplary graphs showing binding affinity of exemplary anti-α7β1 antibodies to different α7β1domains as determined by ELISA assays. In particular, Attorney Docket No.: MTX-04225 exemplary antibodies Ab2, Ab8, and RefAb1 were tested for binding to the α7β1 ecto domain, the leg domain, and the calf-1 domain.

[0095] FIG. 2 shows exemplary competitive ELISA assay results for binding of Ab2 and RefAb1 to the human α7β1 ecto domain.

[0096] FIG. 3 is a series of exemplary graphs illustrating the results of competitive ELISA assays to determine if exemplary human anti-α7β1 antibodies have overlapping epitopes with Ab2, Ab8, or RefAb1.

[0097] FIG. 4 shows the results of competitive ELISA assays to determine if exemplary mouse anti-α7β1 antibodies have overlapping epitopes with Ab8 or RefAb1.

[0098] FIG. 5A is an exemplary schematic showing a bent-closed conformation of integrin α7β1, which has a low binding affinity to laminin. FIG. 5B is an exemplary schematic showing the extended-closed conformation of integrin α7β1, which has a low binding affinity to laminin and how an exemplary anti-α7β1and antibody of the present disclosure could bind to integrin α7β1 to stabilize that conformation. FIG.5C is an exemplary schematic showing the extended-open conformation of integrin α7β, which has a high binding affinity to laminin and how an exemplary anti-α7β1and antibody of the present disclosure could bind to integrin α7β1 to stabilize that conformation.

[0099] FIG. 6 is an exemplary crystal structure of α7 leg and epitopes of different antibodies disclosed in the present disclosure. In particular, Ab8 binds to Calf-1, and Ab2 binds to a region in Calf-2 domain that is distinct from the epitope of RefAb1 (20TFT) antibody.

[0100] FIG. 7 is a series of electron microscopy images of exemplary anti-α7β1 antibodies binding to integrin α7β1, and their cartoon representations.

[0101] FIG. 8A is an exemplary crystal structure of the Ab2 heavy chain (orange) and light chain (yellow) in complex with α7 calf-1 (blue). FIG. 8B displays the biomolecular interactions within Ab2 Fab- α7 calf-1 complex. The calf-1 protein is blue and is shown with the Ab2 HCDR1 (pink), HCDR2 (orange), HCDR3 (green), and LCDR1 (yellow). FIG. 8C shows amino acid sequences of α7 protein, with epitope residues highlighted.

[0102] FIG. 9 is an exemplary figure depicting α7β1 structural model of α7 leg with epitope of Ab2 antibody possible epitope in spheres. The corresponding amino acid residues are Attorney Docket No.: MTX-04225 highlighted in SEQ ID NO: 180. Residues highlighted in magenta (MAIPQQL, SEQ ID NO: 181; VVRGERAMQSERDVGSKVKYEVT, SEQ ID NO: 182; FDRAAVL, SEQ ID NO:183) illustrates one possible epitope, and the residues highlighted in red (LRTLGSAFL, SEQ ID NO: 184; VVFSCPLYS, SEQ ID NO: 185) represents another possible epitope. The epitope residues are determined by hydrogen / deuterium exchange mass spectrometry.

[0103] FIG. 10 is an exemplary figure showing the effect of activating conditions (i.e., conditions that stabilize the open conformation of integrin α7β1) on the cell binding of exemplary anti-α7β1 antibodies of the present disclosure to human DMD myoblast cells.

[0104] FIG. 11 is an exemplary figure showing the effect of activating conditions on the cell binding of exemplary mouse anti-α7β1 compared to RefAb1.

[0105] FIG. 12 is an exemplary bar graph showing the levels of creatine kinase (CKM), an indicator of muscle damage, after acute treadmill running in a mouse mdx model with and without application of an exemplary anti-α7β1 antibody.

[0106] FIG. 13 is an exemplary figure showing the dose response of CKM and LDH to application of exemplary anti-α7β1 antibody Ab8.

[0107] FIG. 14 displays the biological processes upregulated by application of an exemplary anti-α7β1 antibody.

[0108] FIG. 15 displays the biological processes downregulated by application of an exemplary anti-α7β1 antibody.

[0109] FIGs. 16A and 16B are series of exemplary graphs showing the increases in gene expression caused by application of exemplary anti-α7β1 antibodies.

[0110] FIG. 17 is an exemplary figure showing the running scores and total distance run for B10.mdx mice after administration of exemplary anti-α7β1 antibodies.

[0111] FIG. 18 is an exemplary figure showing the distance traveled, resting time, and horizontal beam break counts for MDX mice administered an exemplary anti-α7β1 antibody.

[0112] FIG. 19A is an exemplary figure showing the specific tetanus in the extensor digitorum longus of MDX mice treated with an exemplary α7β1 antibody and controls. FIG. Attorney Docket No.: MTX-04225 19B shows the specific tetanus in the diaphragm of MDX mice treated with an exemplary α7β1 antibody and controls.

[0113] FIG. 20 is an exemplary figure showing the results tracking bodyweight of MDX mice with or without administration of an exemplary anti-α7β1 antibody.

[0114] FIG. 21 is an exemplary figure showing the muscle fiber size from MDX mice with and without treatment with an exemplary anti-α7β1 antibody.

[0115] FIG. 22A is a series of exemplary graphs showing qPCR results tracking fibrosis markers in MDX mice after administration of an exemplary anti-α7β1 antibody. FIG. 22B provides exemplary collagen 1 / III immunohistochemistry images of mice treated with PBS or Ab8 and quantitative positive collagen I / III area. Lower collagen is sign of less scar tissue and fibrosis, a visible difference that can be seen in the histology images.

[0116] FIG. 23 is an exemplary schematic of a study design to assess attenuation of muscle atrophy by administration of an exemplary anti-α7β1 antibody.

[0117] FIG. 24 is a series of exemplary graphs showing the muscle weight of the gastrocnemius-soleus complex (Gastroc) after administration of an exemplary anti-α7β1 antibody to C57BL / 6j mice in VIM. Disuse atrophy caused by VIM results in a loss of muscle weight in the Gastroc both absolutely and relative to bodyweight.

[0118] FIG. 25 is a series of exemplary graphs showing expression of α7 after administration of an exemplary anti-α7β1 antibody to C57BL / 6j mice in VIM as compared to an ambulatory control. DEFINITIONS

[0119] In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.

[0120] “Alleviate” and “ameliorate” means a process by which the severity of a sign or symptom of a disorder is decreased. Importantly, a sign or symptom can be alleviated without Attorney Docket No.: MTX-04225 being eliminated. Therapeutically effective dosages are expected to decrease the severity of, and so alleviate and ameliorate, a sign or symptom of disease.

[0121] As used herein, the term “affinity” refers to the characteristics of a binding interaction between a binding moiety (e.g., integrin α7β1 antibody) and a target (e.g., α7β1) and that indicates the strength of the binding interaction. In some embodiments, the measure of affinity is expressed as a dissociation constant (KD).

[0122] As used herein, the term “antibody” refers to a polypeptide that includes at least one immunoglobulin variable region, e.g., an amino acid sequence that provides an immunoglobulin variable domain or immunoglobulin variable domain sequence. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. An antibody typically includes three complementarity determining regions (abbr. CDRs) in the light chain of the immunoglobulin and three complementarity determining regions (CDRs) in the heavy chain of the immunoglobulin. The three CDRs in the light chain of the immunoglobulin are called, from the N-terminal side, CDR1, CDR2 and CDR3, respectively. The three CDRs in the heavy chain of the immunoglobulin are also called, from the N-terminal side, CDR1, CDR2 and CDR3, respectively. A “CDR” may be identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and / or conformational definitions or any method of CDR determination well known in the art. The term “antibody” encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab, F(ab')2, Fd, Fv, and dAb fragments) as well as complete antibodies, e.g., intact immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof). The light chains of the immunoglobulin can be of types kappa or lambda.

[0123] As used herein, the term “M38 antibody” refers to a mouse anti-α7β1 antibody that binds to S977, W978, W979 and P980 on α7 integrin, as described in described in WO2022240833A1, which is hereby incorporated by reference. In the present application “M38” is used interchangeably with “RefAb2.”

[0124] As used herein, the term “20TFT antibody” refers to an anti-α7β1 antibody that binds to S977, W978, W979 and P980 on α7 integrin, as described in described in WO Attorney Docket No.: MTX-04225 2021 / 097338 A1, which is hereby incorporated by reference. 20TFT antibody is humanized antibody of M38. In the present application “20TFT” is used interchangeably with “RefAb1.”

[0125] As used herein, the term “EC50” refers to a half maximal effective concentration. The term EC50 refers to the concentration of a drug, antibody or toxicant which induces a response halfway between the baseline and maximum after a specified exposure time. More simply, EC50 can be defined as the concentration required to obtain a 50% of the desired effect.

[0126] As used herein, the term “Fab” refers to an antibody fragment comprising a portion of an intact antibody, comprising the antigen-binding or variable region thereof.

[0127] As used herein, the term “Fc region” refers to a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.

[0128] As used herein, the term “EC50” refers to the concentration needed to inhibit half of the maximum biological response of the ligand binding, and can be determined by cell- adhesion assay (CAA) or solid phase assay (SP).

[0129] As used herein, the term “identity” refers a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules as known in the art, comparing the sequences of these molecules. The relationship determined by doing. In the art, “identity” also means the degree of sequence relatedness between nucleic acid molecules or polypeptides, and in some cases more than one nucleotide sequence or more than one. It may be determined by a match between amino acid sequence strings. “Identity” means between a gap alignment (if any) addressed by a particular mathematical model or computer program (i.e., an “algorithm”) and a smaller sequence of two or more sequences. Measure the percent identity match. Attorney Docket No.: MTX-04225

[0130] As used herein, the term “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi- cellular organism.

[0131] As used herein, the term “in vivo” refers to events that occur within a multi- cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).

[0132] “Integrin activator” or “integrin α7β1 activator” refers to molecule that can bind to integrin α7β1 in a way that increases one or more activities associated with the integrin. For example, and without limitation, an integrin α7β1 activator may increase integrin α7β1 binding with laminin. In some embodiments, an integrin α7β1 activator is an anti- α7β1 antibody.

[0133] As used herein, the term “treat,” “treatment,” or “treating” refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of reduce severity of and / or reduce incidence of one or more symptoms of features of a particular disease, disorder, and / or condition. Treatment may be administered to a subject who does not exhibit signs of a disease and / or exhibits only early signs of the disease for the purpose of decreasing the risk of developing pathology associated with the disease. DETAILED DESCRIPTION

[0134] The present disclosure provides, among other things, integrin α7β1 antibodies and therapeutic uses of such antibodies in effectively treating diseases or disorders associated with loss of dystrophin, such as Duchenne Muscular Dystrophy (DMD). As described herein, the present disclosure is based, in part, on identification of integrin α7β1 antibodies that are effective in stabilizing the α7β1 integrin in an extended-closed or extended-open conformation. As a result, the anti-α7β1 antibodies of the present disclosure effectively increase adhesion of muscle fibers to the extracellular matrix, restoring some or all the muscle adhesion lost by the absence of functional dystrophin and ultimately improving locomotive ability, increasing muscle force, and reducing fibrosis in patients with dystrophinopathies. Attorney Docket No.: MTX-04225 Integrin α7β1

[0135] The dystrophin-glycoprotein complex maintains the integrity of skeletal muscle by associating laminin in the extracellular matrix with the actin cytoskeleton. Several human muscular dystrophies arise from defects in the components of this complex. The α7β1 integrin also binds laminin and links the extracellular matrix with the cytoskeleton. The α7β1 integrin complex clearly plays a role in the development of striated muscle and smooth muscle. α7β1 integrin promotes the adhesion and motility of myoblasts, and it is likely important in the recruitment of myogenic precursors during muscle differentiation.

[0136] Dystrophin-associated protein complex (DAPC) and α7β1 integrin maintains sarcolemma integrity. Repeated contraction and relaxation of sarcomere requires efficient handling of mechanical stress by sarcolemma. Disruption of DAPC or α7β1 linkage results in compromised association of cell membrane with ECM, leading to membrane damage due to excess load of force. Additionally, loss of function mutation (LOF) of dystrophin causes Duchenne muscular dystrophy (DMD) while LOF mutation of ITGA7 (gene encoding α7β1 integrin) leads to congenital muscular dystrophy. Structure and Confirmation of Integrin α7β1

[0137] Integrin structure and conformation are key to each part of its functionality, from adhesion to signaling. α7β1 integrins can adopt a range of conformation structures from (FIG. 5A) bent closed conformation and extended closed conformation, that are inactive with a low affinity for laminin (FIG.5B), and extended open conformation (FIG.5C) that is active with a high affinity for laminin. α7 subunit has β-propeller, thigh, calf-1, and calf-2 domains as shown in FIG. 5C.

[0138] The present disclosure provides, among other things, antibodies that bind to an α7β1 integrin in an extended-open or in an extended-closed conformation, enhancing α7β1 integrin binding to laminin. In some embodiments, anti-α7β1 integrin antibody binds to an α7β1 integrin in an extended-closed conformation. In some embodiments, anti-α7β1 integrin antibody binds to an α7β1 integrin in an extended-open conformation. In some embodiments, anti-α7β1 integrin antibody maintains an α7β1 integrin in an extended-closed conformation. In some embodiments, anti-α7β1 integrin antibody maintains an α7β1 integrin in an extended-open conformation. Attorney Docket No.: MTX-04225

[0139] Human integrin α7 ectodomain can be present in X1 or X2 isoform.

[0140] In some embodiments, a human integrin α7 ectodomain has the following amino acid sequence (signal peptide underlined):

[0141] MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPG SLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDI DQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFV LSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWK GTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDPDQ LVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVIL RKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY VYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYH GSSLGVVAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPI LHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDR RLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVV TLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVR ARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHE AQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTS GISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQ SERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGP GQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITL DCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSS IKNLMLRDASTVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGF FKRAKHPEATVPQYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGH PELGPDGHPGPGTA (SEQ ID NO: 122, a7)

[0142] In some embodiments, a human integrin α7 ectodomain has the following amino acid sequence:

[0143] FNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPG QQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ Attorney Docket No.: MTX-04225 QGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDL ALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERL TSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLC GSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEA VGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPN CAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEP KHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYSLQTPRLRRQAPGQG LPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDV DGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRA LDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQ ELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQ GQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDS RDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSF DRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYL DPMAVVAE (SEQ ID NO: 123, ITGA7 X2 ectodomain)

[0144] In some embodiments, a human integrin α7 ectodomain has the following amino acid sequence:

[0145] FNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPG QQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ QGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQD PRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVML SGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGIS PLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVL EGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSID LEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSR NLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYSLQTPRLRRQ APGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQP LPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHY Attorney Docket No.: MTX-04225 SGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLL ATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEV TVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILH LDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSC PLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPV MVYLDPMAVVAE (SEQ ID NO: 124, ITGA7 X1 ectodomain)

[0146] Human α7 leg has the following amino acid sequence: QGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTN LPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELG NPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAI PQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANG KWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPS MSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEY SAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYLDPMAVVAE (SEQ ID NO: 125, a7leg)

[0147] Calf-1 domain of human α7 has the following amino acid sequence: QSNLQLVRARFCTRVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQ ADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQ VTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIE (SEQ ID NO: 126, calf1)

[0148] Calf-2 domain of human α7 has the following amino acid sequence: LPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNI MWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQ QEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRL WNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYLDPMAVVAE (SEQ ID NO: 127, calf2) Attorney Docket No.: MTX-04225 Integrin a7β1 Antibodies

[0149] The present disclosure provides, among other things, an antibody or antigen binding fragment thereof that binds α7β1 integrin in an extended-open or an extended-closed conformation, thereby maintaining high affinity of α7β1 integrin to laminin. Furthermore, the anti-α7β1 integrin antibodies of the present disclosure are effective in promoting muscle cell adhesion to the laminin.

[0150] In some embodiments, an anti-α7β1 integrin antibody activates the α7β1 integrin. In some embodiments, an anti-α7β1 integrin antibody stabilizes an active conformation of α7β1 integrin. In some embodiments an anti-α7β1 integrin antibody increases expression of ITGA7 and / or activity of α7β1 integrin. In some embodiments an anti-α7β1 integrin antibody increases activity of α7β1 integrin.

[0151] α7β1 integrin contains multiple domains as shown in FIG.1A and FIG.5C. In some embodiments, an anti-α7β1 integrin antibody binds to the leg of α7. In some embodiments, an anti-α7β1 integrin antibody binds to the laminin binding domain. In some embodiments, an anti-α7β1 integrin antibody binds to the calf-1 and / or calf-2 domains of α7β1 integrin. In some embodiments, an anti-α7β1 integrin antibody binds to the calf-1 domain of α7β1 integrin. In some embodiments, an anti-α7β1 integrin antibody binds to the calf-2 domain of α7β1 integrin. Epitope

[0152] The present disclosure is based, in part, on the identification of a new epitope of α7 integrin. The anti-α7β1 antibodies that bind to the epitope described herein are able to effectively stabilize the extended conformation of the α7β1 integrin such that the α7β1 integrin binds laminin with high affinity and remains in the active form. Therefore, the agonistic anti- α7β1 integrin antibodies of the present disclosure are effective in treating diseases associated with dystrophin such as Duchenne muscular dystrophy (DMD).

[0153] In some embodiments, an anti-α7β1 integrin antibody binds to calf-2 domain of α7β1 integrin. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 856-862, 867-889, 1011-1017, 897-905 or 1002-1010 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 856- 862 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region Attorney Docket No.: MTX-04225 comprising positions 867-889 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 1011-1017 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 897-905 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 1002-1010 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids M856, A857, I858, P859, Q860, Q861, L862, V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, T889, L897, R898, T899, L900, G901, S902, A903, F904, L905, V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, S1010, F1011, D1012, R1013, A1014, A1015, V1016, and / or L1017. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids M856, A857, I858, P859, Q860, Q861, and / or L862. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids V867, V868, R869, G870, E871, R872, A873, M874, Q875, S876, E877, R878, D879, V880, G881, S882, K883, V884, K885, Y886, E887, V888, and / or T889. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids L897, R898, T899, L900, G901, S902, A903, F904, and / or L905. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids V1002, V1003, F1004, S1005, C1006, P1007, L1008, Y1009, S1010. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids F1011, D1012, R1013, A1014, A1015, V1016, and / or L1017.

[0154] In some embodiments, an anti-α7β1 integrin antibody binds to calf-2 domain of α7β1 integrin, but does not compete with the 20TFT antibody. In some embodiments, an anti- α7β1 integrin antibody binds to calf-2 domain of α7β1 integrin, but does not bind to an epitope comprising amino acids S977, W978, W979, and P980.

[0155] In some embodiments, an anti-α7β1 integrin antibody binds to calf-1 domain of α7β1 integrin. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 771-778 or 793-805 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 771-778 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to a region comprising positions 793-805 of integrin α7. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, Attorney Docket No.: MTX-04225 N796, P797, M798, K799, R800, G801, A802, Q803, V804, and / or T805. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and / or T805. In some embodiments, an anti-α7β1 integrin antibody binds to an epitope comprising amino acids R771, A772, L773, D774, A776, E777, K778, E793, N796, K799, Q803, and T805. Human Anti-α7β1 Integrin Antibodies

[0156] In some embodiments, the integrin α7β1 antibody or antigen binding fragment comprises at least one, two, or three complementary determining regions (CDRs) from a heavy chain variable region having an amino acid sequence as set forth in Table A, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In some embodiments, integrin α7β1 antibody or antigen binding fragment thereof comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table A , or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In an embodiment, the integrin α7β1 antibody or antigen binding fragment thereof comprises at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table A , or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions).

[0157] In some embodiments, the antibody or antigen-binding fragment thereof is an anti-human α7β1 antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table A. Unless indicated otherwise, the CDR sequences shown in the present application are in the IMGT numbering scheme. Table A. Exemplary CDRs of human anti-α7β1antibodies. Attorney Docket No.: MTX-04225

[0158] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), and an HCDR3 of SEQ ID NO: 31 (HCDR3A). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 46 (LCDR1A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69, LCDR3A. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), an HCDR3 of SEQ ID NO: 31 (HCDR3A), an LCDR1 of SEQ ID NO: 46 (LCDR1A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69 (LCDR3A).

[0159] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 1 (HCDR1A), an HCDR2 of SEQ ID NO: 15 (HCDR2A), an HCDR3 of SEQ ID NO: 31 (HCDR3A), an LCDR1 of SEQ ID NO: 46 (LCDR1A), an LCDR2 of SEQ ID NO: 58 (LCDR2A), and an LCDR3 of SEQ ID NO: 69 (LCDR3A). Attorney Docket No.: MTX-04225

[0160] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), and an HCDR3 of SEQ ID NO: 32(HCDR3B). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), an HCDR3 of SEQ ID NO: 32 (HCDR3B), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B).

[0161] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: HCDR1B, an HCDR2 of SEQ ID NO: 16 (HCDR2B), an HCDR3 of SEQ ID NO: 32 (HCDR3B), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 70 (LCDR3B).

[0162] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), and an HCDR3 of SEQ ID NO: 33 (HCDR3C). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), an HCDR3 of SEQ ID NO: 33 (HCDR3C), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C).

[0163] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 3 (HCDR1C), an HCDR2 of SEQ ID NO: 17 (HCDR2C), an HCDR3 of SEQ ID NO: 33 (HCDR3C), an LCDR1 of SEQ ID NO: 47 (LCDR1B), an LCDR2 of SEQ ID NO: 59 (LCDR2B), and an LCDR3 of SEQ ID NO: 71 (LCDR3C).

[0164] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), Attorney Docket No.: MTX-04225 and an HCDR3 of SEQ ID NO: 34 (HCDR3D). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), an HCDR3 of SEQ ID NO: 34 (HCDR3D), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).

[0165] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 18 (HCDR2D), an HCDR3 of SEQ ID NO: 34 (HCDR3D), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).

[0166] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), and an HCDR3 of SEQ ID NO: 35 (HCDR3E). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), an HCDR3 of SEQ ID NO: 35 (HCDR3E), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).

[0167] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 4 (HCDR1D), an HCDR2 of SEQ ID NO: 19 (HCDR2E), an HCDR3 of SEQ ID NO: 35 (HCDR3E), an LCDR1 of SEQ ID NO: 48 (LCDR1C), an LCDR2 of SEQ ID NO: 60 (LCDR2C), and an LCDR3 of SEQ ID NO: 72 (LCDR3D).

[0168] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), and an HCDR3 of SEQ ID NO: 36 (HCDR3F). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of Attorney Docket No.: MTX-04225 SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), an HCDR3 of SEQ ID NO: 36 (HCDR3F), an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E).

[0169] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 5 (HCDR1E), an HCDR2 of SEQ ID NO: 20 (HCDR2F), an HCDR3 of SEQ ID NO: 36 (HCDR3F), an LCDR1 of SEQ ID NO: 49 (LCDR1D), an LCDR2 of SEQ ID NO: 61 (LCDR2D), and an LCDR3 of SEQ ID NO: 73 (LCDR3E).

[0170] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F). In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G), an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F).

[0171] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 6 (HCDR1F), an HCDR2 of SEQ ID NO: 21 (HCDR2G), and an HCDR3 of SEQ ID NO: 37 (HCDR3G), an LCDR1 of SEQ ID NO: 50 (LCDR1E), an LCDR2 of SEQ ID NO: 62 (LCDR2E), and an LCDR3 of SEQ ID NO: 74 (LCDR3F).

[0172] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table A. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table A. Attorney Docket No.: MTX-04225 In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table A. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table A.

[0173] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYTFTGYY (SEQ ID NO: 1, HCDR1A), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from INPNSGGT (SEQ ID NO: 15, HCDR2A), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AREGANWDYYYYGMDV (SEQ ID NO: 31 HCDR3A), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SSNIGSKT (SEQ ID NO: 46, LCDR1A), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SNN (SEQ ID NO: 58, LCDR2A), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AAWDDSLNGPV (SEQ ID NO: 69, LCDR3A).

[0174] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYT (SEQ ID NO: 2, HCDR1B), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISIVGNYI (SEQ ID NO: 16, HCDR2B), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARRKWEHDAFDI (SEQ ID NO: 32, HCDR3B), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TSRDNSGNHVV (SEQ ID NO: 70, LCDR3B).

[0175] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino Attorney Docket No.: MTX-04225 acids different from GFTFSSYS (SEQ ID NO: 3, HCDR1C), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISTSSSYI (SEQ ID NO: 17, HCDR2C), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARRAWESDAFAI (SEQ ID NO: 33, HCDR3C), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SLRSYY (SEQ ID NO: 47, LCDR1B), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GKN (SEQ ID NO: 59, LCDR2B), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from NSRDSSGNHVV (SEQ ID NO: 71, LCDR3C).

[0176] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ISDSGGIA (SEQ ID NO: 18, HCDR2D), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRDGY (SEQ ID NO: 34, HCDR3D), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLLDSDD (SEQ ID NO: 48, LCDR1C), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from MQRIEFPLT (SEQ ID NO: 72, LCDR3D).

[0177] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSYA (SEQ ID NO: 4, HCDR1D), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IHYSGGTT (SEQ ID NO: 19, HCDR2E), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VKDGY (SEQ ID NO: 35, HCDR3E), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLLDSDDGYTY (SEQ ID NO: 48, LCDR1C), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TLS (SEQ ID NO: 60, LCDR2C), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from MQRIEFPLT (SEQ ID NO: 72, LCDR3D). Attorney Docket No.: MTX-04225

[0178] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSRFW (SEQ ID NO: 5, HCDR1E), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from TKQDGSEK (SEQ ID NO: 20, HCDR2F), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AREGSGAYWAFDI (SEQ ID NO: 36, HCDR3F), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHNDGNTY (SEQ ID NO: 49, LCDR1D), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KIS (SEQ ID NO: 61, LCDR2D), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQATQFPLT (SEQ ID NO: 73, LCDR3E).

[0179] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GGSISSYY (SEQ ID NO: 6, HCDR1F), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IYTRGST (SEQ ID NO: 21, HCDR2G), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARVFGGNYRFDAFHI (SEQ ID NO: 37, HCDR3G), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SSNIGAGYD (SEQ ID NO: 50, LCDR1E), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from GNN (SEQ ID NO: 62, LCDR2E), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QSYDSSLSGYV (SEQ ID NO: 74, LCDR3F). Table B. Exemplary VH and VL Sequences of Human anti-α7β1 Integrin Antibodies. Attorney Docket No.: MTX-04225

[0180] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin Attorney Docket No.: MTX-04225 α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 128 (VH1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 128 (VH1).

[0181] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 130 (VH2). In some Attorney Docket No.: MTX-04225 embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 130 (VH2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 130 (VH2).

[0182] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: Attorney Docket No.: MTX-04225 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 132 (VH3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 132 (VH3).

[0183] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% Attorney Docket No.: MTX-04225 identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 134 (VH4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 134 (VH4).

[0184] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 98% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 136 (VH5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 136 (VH5).

[0185] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising Attorney Docket No.: MTX-04225 an amino acid sequence at least 99% identical to SEQ ID NO: 138 (VH6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 138 (VH6).

[0186] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 140 (VH7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 140 (VH7). In some Attorney Docket No.: MTX-04225 embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 140 (VH7).

[0187] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 129 (VL1). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 129 (VL1). Attorney Docket No.: MTX-04225

[0188] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 131 (VL2). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 131 (VL2).

[0189] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% Attorney Docket No.: MTX-04225 identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 133 (VL3). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 133 (VL3).

[0190] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 83% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 135 (VL4). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 135 (VL4).

[0191] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising Attorney Docket No.: MTX-04225 an amino acid sequence at least 85% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 137 (VL5). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 137 (VL5).

[0192] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region Attorney Docket No.: MTX-04225 comprising an amino acid sequence at least 87% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 139 (VL6). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 139 (VL6).

[0193] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a Attorney Docket No.: MTX-04225 variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 141 (VL7). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 141 (VL7).

[0194] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 128 (VH1) and a light variable region comprising an amino acid sequence of SEQ ID NO: 129 (VL1).

[0195] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 130 (VH2) and a light variable region comprising an amino acid sequence of SEQ ID NO: VL2.

[0196] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 132 (VH3) and a light variable region comprising an amino acid sequence of SEQ ID NO: 133 (VL3). Attorney Docket No.: MTX-04225

[0197] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 134 (VH4) and a light variable region comprising an amino acid sequence of SEQ ID NO: 135 (VL4).

[0198] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 136 (VH5) and a light variable region comprising an amino acid sequence of SEQ ID NO: 137 (VL5).

[0199] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 138 (VH6) and a light variable region comprising an amino acid sequence of SEQ ID NO: 139 (VL6).

[0200] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 140 (VH7) and a light variable region comprising an amino acid sequence of SEQ ID NO: 141 (VL7). Table H. Exemplary Heavy Chain and Light Chain Sequences of Human anti-α7β1 Integrin Antibodies. Attorney Docket No.: MTX-04225

[0201] In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 118. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence identical to SEQ ID NO: 118. Attorney Docket No.: MTX-04225

[0202] In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 120. In some embodiments, the integrin α7β1 antibody comprises a heavy chain comprising an amino acid sequence identical to SEQ ID NO: 120.

[0203] In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 Attorney Docket No.: MTX-04225 antibody comprises a light chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 98% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 119. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence identical to SEQ ID NO: 119.

[0204] In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 80% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 83% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 85% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 87% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 92% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 93% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 94% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 95% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 97% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 98% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence at least 99% identical to SEQ ID NO: 121. In some embodiments, the integrin α7β1 antibody comprises a light chain comprising an amino acid sequence identical to SEQ ID NO: 121.

[0205] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 118 and a light chain comprising an amino acid sequence of SEQ ID NO: 119.

[0206] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 120 and a light chain comprising an amino acid sequence of SEQ ID NO: 121. Anti-Mouse α7β1 Antibodies

[0207] In some embodiments, the antibody or antigen-binding fragment thereof is an anti-mouse α7β1 antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table C. Table C. Exemplary CDRs of mouse anti-α7β1antibodies. Attorney Docket No.: MTX-04225

[0208] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 7 (HCDR1G), an HCDR2 of SEQ ID NO: 22 (HCDR2H), and an HCDR3 of SEQ ID NO: 38 (HCDR3H). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 51 (LCDR1F), an LCDR2 of SEQ ID NO: 63 (LCDR2F), and an LCDR3 of SEQ ID NO: 75 (LCDR3G).

[0209] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 7 (HCDR1G), an HCDR2 of SEQ ID NO: 22 (HCDR2H), an HCDR3 of SEQ ID NO: 38 Attorney Docket No.: MTX-04225 (HCDR3H), an LCDR1 of SEQ ID NO: 51 (LCDR1F), an LCDR2 of SEQ ID NO: 63 (LCDR2F), and an LCDR3 of SEQ ID NO: 75 (LCDR3G).

[0210] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 8 (HCDR1H), an HCDR2 of SEQ ID NO: 23 (HCDR2I), and an HCDR3 of SEQ ID NO: 39 (HCDR3I). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 52 (LCDR1G), an LCDR2 of SEQ ID NO: 64 (LCDR2G), and an LCDR3 of SEQ ID NO: 76 (LCDR3H).

[0211] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 8 (HCDR1H), an HCDR2 of SEQ ID NO: 23 (HCDR2I), an HCDR3 of SEQ ID NO: 39 (HCDR3I), an LCDR1 of SEQ ID NO: 52 (LCDR1G), an LCDR2 of SEQ ID NO: 64 (LCDR2G), and an LCDR3 of SEQ ID NO: 76 (LCDR3H).

[0212] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 24 (HCDR2J), and an HCDR3 of SEQ ID NO: 40 (HCDR3J). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 53 (LCDR1H), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).

[0213] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 24 (HCDR2J), an HCDR3 of SEQ ID NO: 40 (HCDR3J), an LCDR1 of SEQ ID NO: 53 (LCDR1H), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).

[0214] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), and an HCDR3 of SEQ ID NO: 40 (HCDR3J). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: LCDR3I.

[0215] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: Attorney Docket No.: MTX-04225 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), an HCDR3 of SEQ ID NO: 40 (HCDR3J), an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 77 (LCDR3I).

[0216] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), and an HCDR3 of SEQ ID NO: 41 (HCDR3K). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 78 (LCDR3J).

[0217] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 9 (HCDR1I), an HCDR2 of SEQ ID NO: 25 (HCDR2K), an HCDR3 of SEQ ID NO: 41 (HCDR3K), an LCDR1 of SEQ ID NO: 54 (LCDR1I), an LCDR2 of SEQ ID NO: 65 (LCDR2H), and an LCDR3 of SEQ ID NO: 78 (LCDR3J).

[0218] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: HCDR2L, and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0219] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 26 (HCDR2L), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0220] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80, LCDR3L. Attorney Docket No.: MTX-04225

[0221] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0222] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 67 (LCDR2J), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0223] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 67 (LCDR2J), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0224] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), and an HCDR3 of SEQ ID NO: 43 (HCDR3M). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0225] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 27 (HCDR2M), an HCDR3 of SEQ ID NO: 43 (HCDR3M), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0226] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen- Attorney Docket No.: MTX-04225 binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0227] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0228] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 29 (HCDR2O), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0229] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 11 (HCDR1K), an HCDR2 of SEQ ID NO: 29 (HCDR2O), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 56 (LCDR1K), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0230] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0231] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0232] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 12 (HCDR1L), an HCDR2 of SEQ ID NO: 28 Attorney Docket No.: MTX-04225 (HCDR2N), and an HCDR3 of SEQ ID NO: 42 (HCDR3L). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0233] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 12 (HCDR1L), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 42 (HCDR3L), an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 80 (LCDR3L).

[0234] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), and an HCDR3 of SEQ ID NO: 44 (HCDR3N). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0235] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 10 (HCDR1J), an HCDR2 of SEQ ID NO: 28 (HCDR2N), an HCDR3 of SEQ ID NO: 44 (HCDR3N), an LCDR1 of SEQ ID NO: 55 (LCDR1J), an LCDR2 of SEQ ID NO: 66 (LCDR2I), and an LCDR3 of SEQ ID NO: 79 (LCDR3K).

[0236] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 13 (HCDR1M), an HCDR2 of SEQ ID NO: 30, HCDR2P, and an HCDR3 of SEQ ID NO: 45 (HCDR3O). In some embodiments, the antibody or antigen- binding fragment thereof comprises an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 81 (LCDR3M).

[0237] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 13 (HCDR1M), an HCDR2 of SEQ ID NO: 30 (HCDR2P), an HCDR3 of SEQ ID NO: 45 (HCDR3O), an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 81 (LCDR3M). Attorney Docket No.: MTX-04225

[0238] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 14 (HCDR1N), an HCDR2 of SEQ ID NO: 30 (HCDR2P), and an HCDR3 of SEQ ID NO: 29 (HCDR2O). In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 82 (LCDR3N).

[0239] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 14 (HCDR1N), an HCDR2 of SEQ ID NO: 30 (HCDR2P), an HCDR3 of SEQ ID NO: 29 (HCDR2O), an LCDR1 of SEQ ID NO: 57 (LCDR1L), an LCDR2 of SEQ ID NO: 68 (LCDR2K), and an LCDR3 of SEQ ID NO: 82 (LCDR3N).In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table C. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table C. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table C.

[0240] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 comprising an amino Attorney Docket No.: MTX-04225 acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO: 75, LCDR3G).

[0241] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYTFTSYW (SEQ ID NO: 8, HCDR1H), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYPSDSYT (SEQ ID NO: 23, HCDR2I), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TRRANYVGAMDY (SEQ ID NO: 39, HCDR3I), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SSVSY (SEQ ID NO: 52, LCDR1G), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from ATS (SEQ ID NO: 64, LCDR2G), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QQWSSNPLT (SEQ ID NO: 76, LCDR3H).

[0242] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWVGGIT (SEQ ID NO: 24, HCDR2J), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINKF (SEQ ID NO: 53, LCDR1H), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRT (SEQ ID NO: 77, LCDR3I).

[0243] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWAGGIT (SEQ ID NO: 25, HCDR2K), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGDFDV (SEQ ID NO: 40, HCDR3J), a LCDR1 comprising an amino Attorney Docket No.: MTX-04225 acid sequence with no greater than 2 amino acids different from QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRT (SEQ ID NO: 77, LCDR3I).

[0244] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLTSYG (SEQ ID NO: 9, HCDR1I), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IWAGGIT (SEQ ID NO: 25, HCDR2K), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARDGYYGHFDV (SEQ ID NO: 41, HCDR3K), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINKY (SEQ ID NO: 54, LCDR1I), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YTS (SEQ ID NO: 65, LCDR2H), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDNLRA (SEQ ID NO: 78, LCDR3J).

[0245] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGSA (SEQ ID NO: 26, HCDR2L), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0246] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino Attorney Docket No.: MTX-04225 acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0247] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YSS (SEQ ID NO: 67, LCDR2J), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0248] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGST (SEQ ID NO: 27, HCDR2M), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDPMDY (SEQ ID NO: 43, HCDR3M), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L). Attorney Docket No.: MTX-04225

[0249] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0250] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSSA (SEQ ID NO: 11, HCDR1K), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISVGGSI (SEQ ID NO: 29, HCDR2O), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDY (SEQ ID NO: 56, LCDR1K), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0251] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 7, HCDR1G), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IDPSDSET (SEQ ID NO: 22, HCDR2H), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEGWYFDV (SEQ ID NO: 38, HCDR3H), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 51, LCDR1F), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from KVS (SEQ ID NO: 63, LCDR2F), and a LCDR3 comprising an amino Attorney Docket No.: MTX-04225 acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO: 75, LCDR3G).

[0252] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0253] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSNCA (SEQ ID NO: 12, HCDR1L), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGDYDAMDY (SEQ ID NO: 42, HCDR3L), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHSFPFT (SEQ ID NO: 80, LCDR3L).

[0254] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFTFSSDA (SEQ ID NO: 10, HCDR1J), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from ISIGGST (SEQ ID NO: 28, HCDR2N), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from TRGGDYDAMDY (SEQ ID NO: 44, HCDR3N), a LCDR1 comprising an amino Attorney Docket No.: MTX-04225 acid sequence with no greater than 2 amino acids different from QSISDL (SEQ ID NO: 55, LCDR1J), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from YAS (SEQ ID NO: 66, LCDR2I), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from QNGHNFPFT (SEQ ID NO: 79, LCDR3K).

[0255] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLSTSDMG (SEQ ID NO: 13, HCDR1M), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYWDDDK (SEQ ID NO: 30, HCDR2P), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRGTAVVAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LHYDDFPLT (SEQ ID NO: 81, LCDR3M).

[0256] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GFSLSTSDLG (SEQ ID NO: 14, HCDR1N), a HCDR2 comprising an amino acid sequence with no greater than 2 amino acids different from IYWDDDK (SEQ ID NO: 30, HCDR2P), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from VRGTAVVAFYWYFDV (SEQ ID NO: 45, HCDR3O), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QDINNY (SEQ ID NO: 57, LCDR1L), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from RAN (SEQ ID NO: 68, LCDR2K), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from LQYDDFPLT (SEQ ID NO: 82, LCDR3N). Attorney Docket No.: MTX-04225 Table D. Exemplary VH and VL Sequences of Mouse anti-α7β1 Integrin Antibodies. Attorney Docket No.: MTX-04225

[0257] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy Attorney Docket No.: MTX-04225 region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 142 (VH8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 142 (VH8).

[0258] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 154 (VH9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 154 (VH9). In some Attorney Docket No.: MTX-04225 embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 154 (VH9).

[0259] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 148 (VH10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 148 (VH10).

[0260] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a Attorney Docket No.: MTX-04225 variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 150 (VH11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 150 (VH11).

[0261] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: Attorney Docket No.: MTX-04225 152 (VH12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 152 (VH12).

[0262] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 156 (VH13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 156 (VH13).

[0263] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 158 (VH14). In some Attorney Docket No.: MTX-04225 embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 158 (VH14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 158 (VH14).

[0264] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a Attorney Docket No.: MTX-04225 variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 160 (VH15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 160 (VH15).

[0265] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 162 (VH16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 162 (VH16).

[0266] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising Attorney Docket No.: MTX-04225 an amino acid sequence at least 85% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 164 (VH17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 164 (VH17).

[0267] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 166 (VH18). In some Attorney Docket No.: MTX-04225 embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 166 (VH18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 166 (VH18).

[0268] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 170 (VH20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 170 (VH20).

[0269] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin Attorney Docket No.: MTX-04225 α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 172 (VH21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 172 (VH21).

[0270] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising Attorney Docket No.: MTX-04225 an amino acid sequence at least 98% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 144 (VH22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 144 (VH22).

[0271] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 146 (VH23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 146 (VH23).

[0272] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 83% identical to SEQ ID NO: 134 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 143 (VL8). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 143 (VL8).

[0273] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 98% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 155 (VL9). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 155 (VL9).

[0274] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 149 (VL10). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 149 (VL10).

[0275] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin Attorney Docket No.: MTX-04225 α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 151 (VL11). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 151 (VL11).

[0276] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising Attorney Docket No.: MTX-04225 an amino acid sequence at least 98% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 153 (VL12). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 153 (VL12).

[0277] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 157 (VL13). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 157 (VL13).

[0278] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 83% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 159 (VL14). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 159 (VL14).

[0279] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin Attorney Docket No.: MTX-04225 α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 161 (VL15). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 161 (VL15).

[0280] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 163 (VL16). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 163 (VL16).

[0281] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or Attorney Docket No.: MTX-04225 antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 165 (VL17). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 165 (VL17).

[0282] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 95% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 167 (VL18).

[0283] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 167 (VL18). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 167 (VL18).

[0284] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% Attorney Docket No.: MTX-04225 identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 169 (VL19). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 169 (VL19).

[0285] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or Attorney Docket No.: MTX-04225 antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 171 (VL20). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 171 (VL20).

[0286] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 173 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 73 (VL21). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 173 (VL21). Attorney Docket No.: MTX-04225

[0287] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 145 (VL22). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 145 (VL22).

[0288] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment Attorney Docket No.: MTX-04225 thereof comprises a variable light region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 147 (VL23). In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable light region comprising an amino acid sequence identical to SEQ ID NO: 147 (VL23).

[0289] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 142 (VH8) and a light variable region comprising an amino acid sequence of SEQ ID NO: 143 (VL8).

[0290] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 154 (VH9) and a light variable region comprising an amino acid sequence of SEQ ID NO: 155 (VL9).

[0291] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 149 (VH10) and a light variable region comprising an amino acid sequence of SEQ ID NO: 149 (VL10).

[0292] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 150 (VH11) and a light variable region comprising an amino acid sequence of SEQ ID NO: 151 (VL11).

[0293] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: Attorney Docket No.: MTX-04225 152 (VH12) and a light variable region comprising an amino acid sequence of SEQ ID NO: 153 (VL12).

[0294] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 156 (VH13) and a light variable region comprising an amino acid sequence of SEQ ID NO: 157 (VL13).

[0295] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 158 (VH14) and a light variable region comprising an amino acid sequence of SEQ ID NO: 159 (VL14).

[0296] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 160 (VH15) and a light variable region comprising an amino acid sequence of SEQ ID NO: 161 (VL15).

[0297] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 162 (VH16) and a light variable region comprising an amino acid sequence of SEQ ID NO: 163 (VL16).

[0298] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 164 (VH17) and a light variable region comprising an amino acid sequence of SEQ ID NO: 165 (VL17).

[0299] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 166 (VH18) and a light variable region comprising an amino acid sequence of SEQ ID NO: 167 (VL18).

[0300] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: Attorney Docket No.: MTX-04225 170 (VH20) and a light variable region comprising an amino acid sequence of SEQ ID NO: 171 (VL20).

[0301] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 172 (VH21) and a light variable region comprising an amino acid sequence of SEQ ID NO: 173 (VL21).

[0302] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 144 (VH22) and a light variable region comprising an amino acid sequence of SEQ ID NO: 145 (VL22).

[0303] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a heavy variable region comprising an amino acid sequence of SEQ ID NO: 146 (VH23) and a light variable region comprising an amino acid sequence of SEQ ID NO: 147 (VL23). Humanized, Affinity-Optimized Anti-α7β1 Integrin Antibodies

[0304] In some embodiments, the integrin α7β1 antibody or antigen binding fragment comprises at least one, two, or three complementary determining regions (CDRs) from a heavy chain variable region having an amino acid sequence as set forth in Table E, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In some embodiments, integrin α7β1 antibody or antigen binding fragment thereof comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table E, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions). In an embodiment, the integrin α7β1 antibody or antigen binding fragment thereof comprises at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table E, or a sequence Attorney Docket No.: MTX-04225 substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and / or having one or more substitutions, e.g., conserved substitutions).

[0305] In some embodiments, the antibody or antigen-binding fragment thereof is a humanized α7β1 antibody. In some embodiments, the antibody or antigen-binding fragment thereof comprises CDRs selected from Table E. Unless indicated otherwise, the CDR sequences shown in the present application are in the IMGT numbering scheme. Table E. Exemplary CDRs of humanized, affinity optimized anti-α7β1antibodies. Attorney Docket No.: MTX-04225

[0306] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, and an HCDR3 of SEQ ID NO: 38. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, an HCDR3 of SEQ ID NO: 38, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0307] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 27, an HCDR3 of SEQ ID NO: 38, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. Attorney Docket No.: MTX-04225

[0308] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 103. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 103, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0309] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 103, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0310] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.

[0311] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.

[0312] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 188. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ Attorney Docket No.: MTX-04225 ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0313] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0314] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 189. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0315] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0316] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 190. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0317] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. Attorney Docket No.: MTX-04225

[0318] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 191. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0319] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0320] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 192. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75.

[0321] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 75

[0322] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 193. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ Attorney Docket No.: MTX-04225 ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0323] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0324] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 194. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.

[0325] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 107.

[0326] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 194. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107.

[0327] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO: 107. Attorney Docket No.: MTX-04225

[0328] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 195. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0329] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0330] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0331] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO: 75.

[0332] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 104. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ Attorney Docket No.: MTX-04225 ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.

[0333] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 75.

[0334] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 190. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0335] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO: 198.

[0336] In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, and an HCDR3 of SEQ ID NO: 189. In some embodiments, the antibody or antigen-binding fragment thereof comprises an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107. In some embodiments, the antibody or antigen-binding fragment thereof comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107.

[0337] In some embodiments, the antibody or antigen-binding fragment thereof competes with a reference antibody, wherein the reference antibody comprises an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO: 107. Attorney Docket No.: MTX-04225

[0338] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises CDRs with one or more amino acid different from CDRs shown in Table E. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 5 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 4 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 3 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 2 amino acids different from any one of the CDRs shown in Table E. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a CDR with no more than 1 amino acid different from any one of the CDRs shown in Table E.

[0339] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 101), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IDPSDSET (SEQ ID O: 102), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGREWYYDV (SEQ ID NO: 103), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from EVS (SEQ ID NO: 106), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SQSTHVPWT (SEQ ID NO:75, LCDR3G).

[0340] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from GYSFTRYW (SEQ ID NO: 101), a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from IDPSDSET (SEQ ID NO: 102), a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from ARGGYFGEEWYHDV (SEQ ID NO: 104), a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from EVS (SEQ Attorney Docket No.: MTX-04225 ID No: 106), and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from AQSTQLPYT (SEQ ID NO: 107).

[0341] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 188, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.

[0342] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 189, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0343] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 190, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75. Attorney Docket No.: MTX-04225

[0344] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 191, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0345] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 192, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0346] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 193, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.

[0347] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no Attorney Docket No.: MTX-04225 greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 194, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107.

[0348] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 194, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 196, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107.

[0349] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 195, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 63, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0350] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 104, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID Attorney Docket No.: MTX-04225 NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 63, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0351] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 104, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 197, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 75.

[0352] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 190, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 106, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 198.

[0353] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a HCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 101, a HCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 102, a HCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 189, a LCDR1 comprising an amino acid sequence with no greater than 2 amino acids different from SEQ ID NO: 105, a LCDR2 comprising an amino acid sequence with no greater than 1 amino acid different from SEQ ID NO: 197, and a LCDR3 comprising an amino acid sequence with no greater than 4 amino acids different from SEQ ID NO: 107. Attorney Docket No.: MTX-04225 Table F. Exemplary VH and VL Sequences of Humanized anti-α7β1 Integrin Antibodies. Attorney Docket No.: MTX-04225

[0354] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence Attorney Docket No.: MTX-04225 at least 83% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 186. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 186.

[0355] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 Attorney Docket No.: MTX-04225 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 108. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 108.

[0356] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID No: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region Attorney Docket No.: MTX-04225 comprising an amino acid sequence at least 90% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 110. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 110.

[0357] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: Attorney Docket No.: MTX-04225 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 199. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 199.

[0358] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding Attorney Docket No.: MTX-04225 fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 201. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 201.

[0359] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence Attorney Docket No.: MTX-04225 at least 95% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 203. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 203.

[0360] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 Attorney Docket No.: MTX-04225 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 205. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 205.

[0361] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region Attorney Docket No.: MTX-04225 comprising an amino acid sequence at least 99% identical to SEQ ID NO: 207. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 207.

[0362] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 9. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 209. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 209. Attorney Docket No.: MTX-04225

[0363] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 211. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 211.

[0364] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen Attorney Docket No.: MTX-04225 binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 213. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 213.

[0365] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid Attorney Docket No.: MTX-04225 sequence at least 85% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 215. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 215.

[0366] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 217. In some embodiments, the Attorney Docket No.: MTX-04225 integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 217. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 217.

[0367] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a Attorney Docket No.: MTX-04225 variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 93% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 94% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 95% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 97% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 98% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 99% identical to SEQ ID NO: 219. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence identical to SEQ ID NO: 219.

[0368] In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 80% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 83% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 85% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 87% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable heavy region comprising an amino acid sequence at least 92% identical to SEQ ID NO: 221. In some embodiments, the integrin α7β1 antibody or antigen binding fragment thereof comprises a variable he...

Claims

Attorney Docket No.: MTX-04225 CLAIMS What is claimed is:

1. An antibody or an antigen-binding fragment that binds to calf-2 domain of α7β1 integrin but does not compete with the 20TFT antibody, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

2. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes for binding with a reference antibody for binding to α7β1 integrin, wherein the reference antibody comprises a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32), a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70).

3. An antibody or an antigen-binding fragment that binds α7β1 integrin comprising: (a) a means for stabilizing the extended conformations of the α7β1 integrin; and optionally, (b) an Fc domain.

4. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody binds to region comprising positions 856-862, 867-889, 1011-1017, 897-905 or 1002-1010 of the amino acid sequence of integrin α7, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

5. An antibody or an antigen-binding fragment that binds to calf-1 domain of α7β1 integrin, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

6. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes with a reference antibody for binding to α7β1 integrin, wherein the reference antibody comprises a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38), aAttorney Docket No.: MTX-04225ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

7. An antibody or an antigen-binding fragment that binds α7β1 integrin and competes with a reference antibody for binding to α7β1 integrin, wherein the reference antibody comprises a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40), a LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

8. An antibody or an antigen-binding fragment that binds α7β1 integrin comprising: (a) a means for binding to calf-1 domain of α7β1 integrin; and (b) an Fc domain.

9. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody binds to a region comprising positions 771-778, 793-805 of the amino acid sequence of integrin α7, wherein the antibody stabilizes the extended conformations of α7β1 integrin.

10. The antibody or an antigen-binding fragment of claim 9, wherein the region comprises amino acids R771, A772, L773, D774, P775, A776, E777, K778, E793, L794, G795, N796, P797, M798, K799, R800, G801, A802, Q803, V804, and / or T805.

11. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSYT (SEQ ID NO: 2), a HCDR2 of sequence ISIVGNYI (SEQ ID NO: 16), and a HCDR3 of sequence ARRKWEHDAFDI (SEQ ID NO: 32); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence TSRDNSGNHVV (SEQ ID NO: 70).Attorney Docket No.: MTX-04225 12. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GYTFTGYY (SEQ ID NO: 1), a HCDR2 of sequence INPNSGGT (SEQ ID NO: 15), and a HCDR3 of sequence AREGANWDYYYYGMDV (SEQ ID NO: 31); and a LCDR1 of sequence SSNIGSKT (SEQ ID NO: 46), a LCDR2 of sequence SNN (SEQ ID NO: 58), and a LCDR3 of sequence AAWDDSLNGPV (SEQ ID NO: 69).

13. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHVV (SEQ ID NO: 71).

14. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence ISDSGGIA (SEQ ID NO: 18), and a HCDR3 of sequence VRDGY (SEQ ID NO: 34); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

15. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

16. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:Attorney Docket No.: MTX-04225 a HCDR1 of sequence GFTFSRFW (SEQ ID NO: 5), a HCDR2 of sequence TKQDGSEK (SEQ ID NO: 20), and a HCDR3 of sequence AREGSGAYWAFDI (SEQ ID NO: 36); and a LCDR1 of sequence QSLVHNDGNTY (SEQ ID NO: 49), a LCDR2 of sequence KIS (SEQ ID NO: 61), and a LCDR3 of sequence LQATQFPLT (SEQ ID NO: 73).

17. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GGSISSYY (SEQ ID NO: 6), a HCDR2 of sequence IYTRGST (SEQ ID NO: 21), and a HCDR3 of sequence ARVFGGNYRFDAFHI (SEQ ID NO: 37); and a LCDR1 of sequence SSNIGAGYD (SEQ ID NO: 50), a LCDR2 of sequence GNN (SEQ ID NO: 62), and a LCDR3 of sequence QSYDSSLSGYV (SEQ ID NO: 74).

18. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 7), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 22), and a HCDR3 of sequence ARGGYFGEGWYFDV (SEQ ID NO: 38); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 51), a LCDR2 of sequence KVS (SEQ ID NO: 63), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO: 75).

19. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GYTFTSYW (SEQ ID NO: 8), a HCDR2 of sequence IYPSDSYT (SEQ ID NO: 23), and a HCDR3 of sequence TRRANYVGAMDY (SEQ ID NO: 39); and a LCDR1 of sequence SSVSY (SEQ ID NO: 52), a LCDR2 of sequence ATS (SEQ ID NO: 64), and a LCDR3 of sequence QQWSSNPLT (SEQ ID NO: 76).

20. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWVGGIT (SEQ ID NO: 24), and a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40); andAttorney Docket No.: MTX-04225 a LCDR1 of sequence QDINKF (SEQ ID NO: 53), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

21. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGDFDV (SEQ ID NO: 40); and a LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRT (SEQ ID NO: 77).

22. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLTSYG (SEQ ID NO: 9), a HCDR2 of sequence IWAGGIT (SEQ ID NO: 25), and a HCDR3 of sequence ARDGYYGHFDV (SEQ ID NO: 41); and a LCDR1 of sequence QDINKY (SEQ ID NO: 54), a LCDR2 of sequence YTS (SEQ ID NO: 65), and a LCDR3 of sequence LQYDNLRA (SEQ ID NO: 78).

23. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGSA (SEQ ID NO: 26), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 178); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

24. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).Attorney Docket No.: MTX-04225 25. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YSS (SEQ ID NO: 67), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

26. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGST (SEQ ID NO: 27), and a HCDR3 of sequence ARGGDYDPMDY (SEQ ID NO: 43); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

27. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

28. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSSA (SEQ ID NO: 11), a HCDR2 of sequence ISVGGSI (SEQ ID NO: 29), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDY (SEQ ID NO: 56), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

29. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises:Attorney Docket No.: MTX-04225 a HCDR1 of sequence GFTFSSYS (SEQ ID NO: 3), a HCDR2 of sequence ISTSSSYI (SEQ ID NO: 17), and a HCDR3 of sequence ARRAWESDAFAI (SEQ ID NO: 33); and a LCDR1 of sequence SLRSYY (SEQ ID NO: 47), a LCDR2 of sequence GKN (SEQ ID NO: 59), and a LCDR3 of sequence NSRDSSGNHVV (SEQ ID NO: 71); or a HCDR1 of sequence GFTFSSYA (SEQ ID NO: 4), a HCDR2 of sequence IHYSGGTT (SEQ ID NO: 19), and a HCDR3 of sequence VKDGY (SEQ ID NO: 35); and a LCDR1 of sequence QSLLDSDDGYTY (SEQ ID NO: 48), a LCDR2 of sequence TLS (SEQ ID NO: 60), and a LCDR3 of sequence MQRIEFPLT (SEQ ID NO: 72).

30. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSNCA (SEQ ID NO: 12), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence ARGGDYDAMDY (SEQ ID NO: 42); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHSFPFT (SEQ ID NO: 80).

31. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFTFSSDA (SEQ ID NO: 10), a HCDR2 of sequence ISIGGST (SEQ ID NO: 28), and a HCDR3 of sequence TRGGDYDAMDY (SEQ ID NO: 44); and a LCDR1 of sequence QSISDL (SEQ ID NO: 55), a LCDR2 of sequence YAS (SEQ ID NO: 66), and a LCDR3 of sequence QNGHNFPFT (SEQ ID NO: 79).

32. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLSTSDMG (SEQ ID NO: 13), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45); and a LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LHYDDFPLT (SEQ ID NO: 81).Attorney Docket No.: MTX-04225 33. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: a HCDR1 of sequence GFSLSTSDLG (SEQ ID NO: 14), a HCDR2 of sequence IYWDDDK (SEQ ID NO: 30), and a HCDR3 of sequence VRGTAVVAFYWYFDV (SEQ ID NO: 45); and a LCDR1 of sequence QDINNY (SEQ ID NO: 57), a LCDR2 of sequence RAN (SEQ ID NO: 68), and a LCDR3 of sequence LQYDDFPLT (SEQ ID NO: 82).

34. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen-binding fragment comprises: a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGREWYYDV (SEQ ID NO: 103); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence SQSTHVPWT (SEQ ID NO:75).

35. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen-binding fragment comprises: a HCDR1 of sequence GYSFTRYW (SEQ ID NO: 101), a HCDR2 of sequence IDPSDSET (SEQ ID NO: 102), and a HCDR3 of sequence ARGGYFGEEWYHDV (SEQ ID NO: 104); and a LCDR1 of sequence QSLVHRNGNTY (SEQ ID NO: 105), a LCDR2 of sequence EVS (SEQ ID NO: 106), and a LCDR3 of sequence AQSTQLPYT (SEQ ID NO: 107).

36. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 188, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

198.

37. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 ofAttorney Docket No.: MTX-04225 SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

38. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

39. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 191, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

40. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 192, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

75.

41. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 193, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

198.

42. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

107.

43. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 194, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 196, and an LCDR3 of SEQ ID NO:

107.

44. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 ofAttorney Docket No.: MTX-04225 SEQ ID NO: 195, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO:

75.

45. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 63, and an LCDR3 of SEQ ID NO:

75.

46. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 104, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO:

75.

47. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 190, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 106, and an LCDR3 of SEQ ID NO:

198.

48. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody comprises: an HCDR1 of SEQ ID NO: 101, an HCDR2 of SEQ ID NO: 102, an HCDR3 of SEQ ID NO: 189, an LCDR1 of SEQ ID NO: 105, an LCDR2 of SEQ ID NO: 197, and an LCDR3 of SEQ ID NO:

107.

49. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 128, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 129; ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 131; iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 132, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 133;Attorney Docket No.: MTX-04225 iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 134, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 135; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 136, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 137; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 138, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 139; or vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 140, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

141.

50. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: a variable heavy region comprising an amino acid sequence of SEQ ID NO: 130, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

131.

51. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 118, and a light chain comprising an amino acid sequence of SEQ ID NO: 119; or ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 120, and a light chain comprising an amino acid sequence of SEQ ID NO:

121.

52. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 143;Attorney Docket No.: MTX-04225 ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 144, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 145; iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 146, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 147; iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 148, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 149; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 150, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 151; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 152, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 153; vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 154, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 155; viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 156, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 157; ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 158, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 159; x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 160, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 161; xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 162, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 163;Attorney Docket No.: MTX-04225 xii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 164, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 165; xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 166, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 167; xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 170, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 171; or xv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 172, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 173; or xvi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 186, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

187.

53. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: a variable heavy region comprising an amino acid sequence of SEQ ID NO: 142, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

143.

54. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 108, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 109; ii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 110, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 111;Attorney Docket No.: MTX-04225 iii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 199, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 200; iv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 201, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 202; v) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 203, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 204; vi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 205, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 206; vii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 207, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 208; viii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 209, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 210; ix) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 211, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 212; x) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 213, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 214; xi) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 215, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 216; xii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 217, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 218;Attorney Docket No.: MTX-04225 xiii) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 219, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 220; xiv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 221, and a variable light chain region comprising an amino acid sequence of SEQ ID NO: 222; or xv) a variable heavy region comprising an amino acid sequence of SEQ ID NO: 223, and a variable light chain region comprising an amino acid sequence of SEQ ID NO:

224.

55. An antibody or an antigen-binding fragment that binds α7β1 integrin, wherein the antibody or antigen binding fragment comprises: i) a heavy chain comprising an amino acid sequence of SEQ ID NO: 112, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; ii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 114, and a light chain comprising an amino acid sequence of SEQ ID NO: 113; iii) a heavy chain comprising an amino acid sequence of SEQ ID NO: 115, and a light chain comprising an amino acid sequence of SEQ ID NO: 116; or iv) a heavy chain comprising an amino acid sequence of SEQ ID NO: 117, and a light chain comprising an amino acid sequence of SEQ ID NO:

116.

56. The antibody or antigen-binding fragment of any one of the preceding claims, wherein the antibody or antigen binding fragment has an affinity (Kd) to α7β1 integrin or a fragment thereof of between about 0.1 to 300 nM.

57. The antibody or antigen-binding fragment of claim 56, wherein the α7β1 integrin or a fragment thereof is α7β1 ectodomain, β1 ectodomain, α7 leg, calf-1 domain, calf-2 domain, or calf-1 and calf-2 domains.

58. The antibody or antigen-binding fragment of claim 56, wherein the α7β1 integrin is a human α7β1 integrin.Attorney Docket No.: MTX-04225 59. The antibody or antigen-binding fragment of claim 58, wherein the antibody has an affinity to a human α7β1 ectodomain of about 3 to 6 nM.

60. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof activates α7β1 integrin with a maximal efficacy or Emax of between about 100% to 300% as compared to the 20TFT or TS2 / 16 antibody.

61. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof has EC50 value of between 0.3 nM to 50 nM.

62. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof specifically binds α7β1 integrin and does not bind α6β1 integrin or α3β1integrin.

63. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a Fab, a single chain Fv (scFv), a single domain antibody (sdAb), a VHH, a variable heavy chain (VH), a variable light chain (VL), a Fab-like bispecific antibody (bsFab), a single- domain antibody-linked Fab (s-Fab), or a combination thereof.

64. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a humanized antibody.

65. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a human antibody.

66. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is a chimeric antibody.Attorney Docket No.: MTX-04225 67. The antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof is an IgG.

68. The antibody or antigen binding fragment thereof of claim 54, wherein the antibody or antigen binding fragment thereof is derived from IgG1, IgG2, IgG3, or IgG4.

69. The antibody or antigen binding fragment thereof of any one of preceding claims, wherein the antibody or antigen binding fragment thereof contains a Fc region.

70. The antibody or antigen binding fragment thereof of claim 69, wherein the Fc region contains one or more mutations.

71. A method of treating a disease or disorder in a subject associated with a α7β1 integrin defect, comprising administering to the subject the antibody or antigen binding fragment thereof of any one of the preceding claims.

72. The method of claim 71, wherein the disease or disorder associated with a α7β1 integrin defect is selected from a list comprising cardiomyopathy, congestive heart failure and muscular dystrophy.

73. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscular dystrophy.

74. The method of any one of claims 71-73, wherein the administration is to a muscle cell, wherein the muscle cell comprises a mutation in a dystrophin gene.

75. The method of claim 74, wherein the muscle cell lacks dystrophin or comprises a non- functional dystrophin.Attorney Docket No.: MTX-04225 76. The method of any one of claims 73-75, wherein the muscular dystrophy is Duchenne muscular dystrophy, Becker muscular dystrophy, limb girdle muscular dystrophy, Fukuyama congenital muscular dystrophy (FCMD) or merosin deficient congenital muscular dystrophy type lA (MDC1A).

77. The method of claim 76, wherein the muscular dystrophy is Duchenne muscular dystrophy.

78. The method of claim 76, wherein the muscular dystrophy is Becker muscular dystrophy.

79. The method of any one of claims 73-78, wherein the administration reduces one or more serum biomarkers of muscle fiber damage.

80. The method of claim 79, wherein the one or more biomarkers is creatine kinase, LDH cytotox, and / or IL-6.

81. The method of any one of claims 73-80, wherein the administration reduces muscle damage, inflammation, fibrosis, necrosis and / or atrophy.

82. The method of any one of claim 73-81, wherein the administration increases muscle cell adhesion.

83. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in an increase in expression of α7.

84. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment of any one of claims 1-70, wherein the administration results in amelioration of one or more symptoms of the muscle atrophy.

85. The method of claim 84, wherein the subject has reduced muscle loss as compared to a control upon administration of the antibody or the binding fragment thereof.Attorney Docket No.: MTX-04225 86. The method of claim 84, wherein the subject has less than 20% muscle weight change as compared to a control upon administration of the antibody or the binding fragment thereof.

87. The method of claim 85 or 86, wherein the control is a baseline value prior to administration of the antibody or the binding fragment thereof.

88. The method of claim 85 or 86, wherein the control is historical data.

89. The method of claim 85 or 86, wherein the control is a comparable subject to which the antibody or antigen binding fragment thereof was not administered.

90. A pharmaceutical composition comprising the antibody or antigen binding fragment thereof of any one of claims 1-70, and a pharmaceutically acceptable carrier.

91. The pharmaceutical composition of claim 90, wherein the composition is for parenteral or oral administration.

92. The pharmaceutical composition of claim 90, wherein the composition is for administration by a route selected from intravenous, intradermal, transdermal, intraocular, intranasal, intramuscular, subcutaneous, and transmucosal.

93. A method of treating cardiomyopathy, congestive heart failure or other cardiac muscle disorder by administering to a subject in need thereof the antibody or antigen binding fragment thereof of any one of claims 1-70.

94. A method of treating a muscular dystrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising: a) an antibody means for stabilizing the extended conformations of the α7β1 integrin; and b) one or more physiologically acceptable carriers, excipients or diluents.Attorney Docket No.: MTX-04225 95. The antibody or antigen binding fragment thereof of any one of claims 1-70, wherein the antibody or the antigen-binding fragment binds to the α7β1 integrin as measured by the Surface Plasmon Resonance (SPR) assay as described in Example 4.

96. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising: a) an antibody means for stabilizing the extended conformations of the α7β1 integrin; and b) one or more physiologically acceptable carriers, excipients or diluents.

97. A method of treating a muscle atrophy in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising: a) an antibody means for increasing α7 expression; and b) one or more physiologically acceptable carriers, excipients or diluents.