Antibodies to connective tissue growth factor (CTGF) and uses thereof

ZA202609267APending Publication Date: 2026-09-30BOEHRINGER INGELHEIM INT GMBH
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
ZA202609267
Authority / Receiving Office
ZA · ZA
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-11-22
Filing Date
2026-09-22
Publication Date
2026-09-30

AI Technical Summary

Technical Problem

Current treatments for idiopathic pulmonary fibrosis (IPF) and progressive pulmonary fibrosis (PPF) are inadequate, with a median treatment duration of less than one year, and the mechanisms by which connective tissue growth factor (CTGF) contributes to pulmonary fibrosis are not fully understood.

Method used

Development of antibodies or antigen-binding fragments that specifically bind to CTGF, blocking its proteolytic cleavage by matrix metalloproteases and inhibiting its interaction with cells, thereby reducing fibrogenesis and promoting alveolar stem cell repair.

Benefits of technology

The antibodies reduce the generation of biologically active CTGF fragments, decrease fibrosis markers, and promote macrophage homeostasis, leading to improved lung repair and reduced progression of pulmonary fibrosis.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader

Abstract

NOT VISIBLE DUE TO STATUS OF PATENT
Need to check novelty before this filing date? Find Prior Art

Description

ANTIBODIES TO CONNECTIVE TISSUE GROWTH FACTOR (CTGF) AND USES THEREOF

[0001] This application includes, as part of its disclosure, a “Sequence Listing XML” pursuantto 37 C.F.R. § 1.831(a) which is submitted in XML file format in a file named “09-0753-PCT-sequence-listing.xml”, created on February 26, 2025, and having a size of 203,535 bytes, whichis hereby incorporated by reference herein in its entirety. FIELD

[0002] This disclosure generally relates to anti-CTGF (connective tissue growth factor)antibodies. More specifically, the disclosure relates to anti-CTGF antibodies or antigen-bindingfragments thereof and methods of their use for the treatment of various diseases or disorders, forexample, respiratory disease, fibrosis, or cancer. Pharmaceutical compositions and kitscomprising the anti-CTGF antibodies or antigen-binding fragments thereof are also disclosed.BACKGROUND

[0003] Idiopathic pulmonary fibrosis (IPF) is a chronic, fibrosing interstitial pneumonia ofunknown etiology. It is characterized by progressive worsening of dyspnea and lung function, andhas a poor prognosis. Standard of care (nintedanib, pirfenidone) can reduce the declinetrajectory, nevertheless, life expectancy after diagnosis remains strongly shortened.

[0004] Progressive pulmonary fibrosis (PPF), of which IPF is a prototype, is a fatal conditionthat can develop in a variety of diseases, including inflammatory diseases such as rheumatoid arthritis or scleroderma.

[0005] CTGF is a secreted growth factor that modulates many profibrotic processes and isstrongly upregulated in IPF and PPF. CTGF is composed of two N-terminal domains (together CTGF-NTF) and two C-terminal domains (together CTGF-CTF) bound by a hinge peptidecontaining cleavage sequences for matrix metalloproteases (MMP). CTGF is secreted as a fulllength protein of 38kDa, and can be rapidly cleaved into CTGF-NTF and CTGF-CTF whenexposed to activated matrix metalloproteases. Those proteases are known to be increased in disease.

[0006] CTGF has been proposed as prognostic biomarkers of progression in IPF. However,the precise mechanisms by which CTGF or the CTGF fragments may contribute to the pathobiology of pulmonary fibrosis remains unclear.

[0007] Current treatment methods in IPF and PPF (nintedanib and pirfenidone) slowprogression of pulmonary fibrosis. However, the median treatment duration with both antifibrotics is not much longer than one year. Thus, there is an unmet need for additional therapies for IPF and PPF. BRIEF SUMMARY

[0008] The present disclosure addresses the above need and others by providing agents,in particular antibodies or antigen-binding fragments thereof, which specifically bind to CTGF. Inparticular, the antibodies or antigen-binding fragments thereof as disclosed herein specificallybind to human CTGF, such as full length CTGF (e.g., having the amino acid sequence of SEQID NO: 1 or SEQ ID NO: 2) or CTGF N-terminal fragment (CTGF-NTF) (e.g., having the aminoacid sequence of SEQ ID NO: 3). In some aspects, the antibodies or antigen-binding fragmentsthereof block proteolytic cleavage of CTGF, e.g., by matrix metalloprotease 7 (MMP7). In someaspects, the antibodies or antigen-binding fragments thereof, block the interaction of CTGF withcells that express CTGF receptors, such as alveolar type II cells, fibroblasts and A549 cells. Insome aspects, the antibodies or antigen-binding fragments thereof, block the interaction ofCTGF-NTF with cells that express CTGF receptors, such as alveolar type II cells, fibroblasts andA549 cells.

[0009] The cleavage of CTGF by proteases, such as MMP7, activates the CTGF pathwaysince the fragments are biologically active. Exemplary anti-CTGF antibodies of the presentdisclosure bind to CTGF and inhibit this cleavage. They may, thus, reduce the occurrence offragments. Exemplary anti-CTGF antibodies of the present disclosure additionally specificallybind CTGF-NTF. This inhibition of cleavage and binding of full length CTGF and CTGF-NTF thusreduce fibrogenesis and fibrillar collagen production. Exemplary anti-CTGF antibodies of thepresent disclosure can reduce levels of the human fibrosis biomarkers such as ProC3.

[0010] Macrophages engulfing CTGF fragments show reduced efferocytosis potential.Consequently, dead / senescent cells accumulate and perpetuate profibrotic signaling. Exemplary anti-CTGF antibodies of the present disclosure inhibit the generation of CTGF fragments.Thereby, macrophage homeostasis is promoted.

[0011] Alveolar cells undergo epithelial-mesenchymal transition in pulmonary fibrosisleading to a failure of the progenitor cells to repair the alveolus. Exemplary anti-CTGF antibodies of the present disclosure inhibit this epithelial-mesenchymal transition of alveolar cells. Thereby,the maintenance and functionality of the alveolar stem cells and thus repair of the epithelium ispromoted.

[0012] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a light chain variable region comprising a light chain complementarity determiningregion 1 (L-CDR1) having the amino acid sequence of Y1-SSQSIVHYN-Y2-Y3-TYLE where Y1 is K or R, Y2 is A, E, G, or T and Y3 is K or N (SEQ ID NO: 10), a light chain complementarity determining region 2 (L-CDR2) having the amino acid sequence of KVS-Z1-R-Z2-S where Z1 is N or S and Z2 is A or F (SEQ ID NO: 11), and a light chain complementarity determining region 3 (L-CDR3) having the amino acid sequence of FQGSHFPLT (SEQ ID NO: 12); and a heavy chain variable region comprising a heavy chain complementarity determining region 1 (H-CDR1) having the amino acid sequence of DYYMA (SEQ ID NO: 15), a heavy chain complementarity determining region 2 (H-CDR2) having the amino acid sequence of NINY-X1-GSRTDLL-X2- SLKS where X1 is D, E, or Y and X2 is A, D, or E (SEQ ID NO: 16), and a heavy chain complementarity determining region 3 (H-CDR3) having the amino acid sequence of DTSRGSYFDV (SEQ ID NO: 17).

[0013] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises the six CDRs (L-CDR1, L-CDR2, L-CDR3, H-CDR1, H-CDR2 and H-CDR3) of anyone of antibodies A1-A127 as specified in Table 13 (according to Kabat). Preferably, saidantibody comprises the six CDRs (L-CDR1, L-CDR2, L-CDR3, H-CDR1, H-CDR2 and H-CDR3)of any one of antibodies A1-A25, A41-A44, A46, A48-A85, or A87-A127 as specified in Table 13(according to Kabat). Most preferably, said antibody comprises the six CDRs (L-CDR1, L-CDR2,L-CDR3, H-CDR1, H-CDR2 and H-CDR3) of antibody A97 as specified in Table 13 (according toKabat). While the specific CDR sequences mentioned in Table 13 are according to Kabat, it isunderstood that the CDR sequences of antibodies A1-A127 of Table 13 may also be determinedaccording to another numbering scheme (e.g., as described herein) based on the sequences ofthe variable regions or the full-length sequences of the heavy and light chains as outlined forantibodies A1-A127 in Table 13, e.g., by reference to the CDR sequences as shown in Tables 3-8 and the light and heavy chain names corresponding to each antibody as shown in Tables 9-12.

[0014] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a light chain variable region and a heavy chain variable region each having at least95% identity to the light chain variable region and the corresponding heavy chain variable region,respectively, of any one of antibodies A1-A127 as specified in Table 13. Preferably, said antibodycomprises a light chain variable region and a heavy chain variable region each having at least95% identity to the light chain variable region and the corresponding heavy chain variable region,respectively, of any one of antibodies A1-A25, A41-A44, A46, A48-A85, or A87-A127 as specifiedin Table 13. Most preferably, said antibody comprises a light chain variable region and a heavychain variable region each having at least 95% identity to the light chain variable region and thecorresponding heavy chain variable region, respectively, of antibody A97 as specified in Table13.

[0015] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises the light chain variable region and the corresponding heavy chain variable region ofany one of antibodies A1-A127 as specified in Table 13. Preferably, said antibody comprises thelight chain variable region and the corresponding heavy chain variable region of any one ofantibodies A1-A25, A41-A44, A46, A48-A85, or A87-A127 as specified in Table 13. Mostpreferably, said antibody comprises the light chain variable region and the corresponding heavy chain variable region of antibody A97 as specified in Table 13.

[0016] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a light chain and a heavy chain each having at least 95% identity to the light chain andthe corresponding heavy chain, respectively, of any one of antibodies A1-A127 as specified inTable 13. Preferably, said antibody comprises a light chain and a heavy chain each having atleast 95% identity to the light chain and the corresponding heavy chain, respectively, of any oneof antibodies A1-A25, A41-A44, A46, A48-A85, or A87-A127 as specified in Table 13. Mostpreferably, said antibody comprises a light chain and a heavy chain each having at least 95%identity to the light chain and the corresponding heavy chain, respectively, of antibody A97 asspecified in Table 13.

[0017] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises the light chain and the corresponding heavy chain of any one of antibodies A1-A127as specified in Table 13. Preferably, said antibody comprises the light chain and thecorresponding heavy chain of any one of antibodies A1-A25, A41-A44, A46, A48-A85, or A87-A127 as specified in Table 13. Most preferably, said antibody comprises the light chain and thecorresponding heavy chain of antibody A97 as specified in Table 13.

[0018] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof asdescribed herein comprises a heavy chain constant region selected from IgG1, IgG2, IgG3, IgG4,IgM, IgA and IgE or a variant thereof. Preferably, the anti-CTGF antibody or antigen-bindingfragment thereof as described herein comprises an IgG1 heavy chain constant region.

[0019] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a heavy chain lacking a C-terminal lysine residue.

[0020] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a heavy chain constant region wherein the heavy chain constant region is of an IgG1with L234A and L235A substitutions.

[0021] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofcomprises a light chain constant region selected from the group consisting of a kappa and a lambda light chain.

[0022] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof is amonoclonal antibody.

[0023] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof is amonospecific antibody.

[0024] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof bindsthe full length human CTGF of SEQ ID NO: 2 with a binding affinity of 50 pM or lower, 25 pM or lower, 15 pM or lower, 10 pM or lower, 5 pM or lower, or 2 pM or lower.

[0025] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof bindsthe human CTGF-NTF of SEQ ID NO: 3 with a binding affinity of 10 nM or lower, 5 nM or lower, 2.5 nM or lower, 1 nM or lower, 0.5 nM or lower, or 0.2 nM or lower.

[0026] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof bindsthe human CTGF of SEQ ID NO: 2 with a KD of 5 pM or lower.

[0027] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof bindsthe N-terminal fragment of human CTGF of SEQ ID NO: 3 with a KD of 0.5 nM or lower.

[0028] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofdecreases or blocks human CTGF binding to primary human fibroblast cells.

[0029] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereofdecreases or blocks cleavage of human CTGF by MMP7.

[0030] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof blocksor inhibits human TGFbeta-induced increase in COL1A1 expression in lung epithelial cells.

[0031] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof blocksor inhibits CTGF interaction with alveolar type II cells, fibroblasts and / or A549 cells.

[0032] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof blocksor inhibits CTGF-NTF interaction with alveolar type II cells, fibroblasts and / or A549 cells.

[0033] In some aspects, the disclosure provides a pharmaceutical composition comprisingan anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein, and apharmaceutically acceptable carrier.

[0034] In some aspects, the disclosure provides an anti-CTGF antibody or antigen-bindingfragment thereof as disclosed herein for use as a medicament.

[0035] In some aspects, the disclosure provides an anti-CTGF antibody or antigen-bindingfragment thereof as disclosed herein for use for treating or preventing a CTGF-associateddisorder, a fibrotic disease, hypertension, diabetes, myocardial infarction, arthritis, CTGF-relatedcell proliferative disease, atherosclerosis, glaucoma, or a cancer. Said fibrotic disease may beidiopathic pulmonary fibrosis (IPF), progressive pulmonary fibrosis (PPF), pulmonary fibrosis with interstitial lung disease (PF-ILD), systemic scleroderma (SSc), diabetic nephropathy, diabetic retinopathy, osteoarthritis, scleroderma, chronic heart failure, liver cirrhosis or renal fibrosis. Said cancer may be acute lymphoblastic leukemia, dermatofibroma, breast cancer, angiolipoma, angioleiomyoma, connective tissue-generating cancer, prostate cancer, ovarian cancer, colorectal cancer, pancreatic cancer, gastrointestinal cancer or liver cancer. Said anti-CTGFantibody or antigen-binding fragment thereof may be for parenteral or inhalation administration.

[0036] In some aspects, the disclosure provides a method of treating or preventing a CTGF-associated disorder, a fibrotic disease, hypertension, diabetes, myocardial infarction, arthritis, CTGF-related cell proliferative disease, atherosclerosis, glaucoma, or a cancer, comprising administering an effective amount of an anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein to a patient in need thereof. Said fibrotic disease may be idiopathic pulmonary fibrosis (IPF), progressive pulmonary fibrosis (PPF), pulmonary fibrosis with interstitial lung disease (PF-ILD), systemic scleroderma (SSc), diabetic nephropathy, diabetic retinopathy, osteoarthritis, scleroderma, chronic heart failure, liver cirrhosis or renal fibrosis. Said cancer may be acute lymphoblastic leukemia, dermatofibroma, breast cancer, angiolipoma, angioleiomyoma, connective tissue-generating cancer, prostate cancer, ovarian cancer, colorectal cancer, pancreatic cancer, gastrointestinal cancer or liver cancer. Said antibody or antigen-bindingfragment thereof may be administered by parenteral or inhalation administration.

[0037] In some aspects, the disclosure provides the use of an anti-CTGF antibody orantigen-binding fragment thereof as disclosed herein for the manufacture of a medicament fortreating or preventing CTGF-associated disorder, a fibrotic disease, hypertension, diabetes, myocardial infarction, arthritis, CTGF-related cell proliferative disease, atherosclerosis, glaucoma, or a cancer. Said fibrotic disease may be idiopathic pulmonary fibrosis (IPF), progressive pulmonary fibrosis (PPF), pulmonary fibrosis with interstitial lung disease (PF-ILD), systemic scleroderma (SSc), diabetic nephropathy, diabetic retinopathy, osteoarthritis, scleroderma, chronic heart failure, liver cirrhosis or renal fibrosis. Said cancer may be acute lymphoblastic leukemia, dermatofibroma, breast cancer, angiolipoma, angioleiomyoma, connective tissue-generating cancer, prostate cancer, ovarian cancer, colorectal cancer, pancreatic cancer, gastrointestinal cancer or liver cancer. Said anti-CTGF antibody or antigen-binding fragment thereof may be administered by parenteral or inhalation administration.

[0038] In some aspects, the disclosure provides an isolated polynucleotide or a plurality ofisolated nucleotides that encodes a sequence comprising the heavy chain variable region and / orlight chain variable region of an anti-CTGF antibody or antigen-binding fragment thereof asdisclosed herein.

[0039] In some aspects, the disclosure provides a vector or plurality of vectors comprising apolynucleotide or a plurality of polynucleotides that encode the light chain and / or the heavy chainof an anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein. Said vectormay comprise an expression vector or plurality of expression vectors. Said polynucleotide or plurality of polynucleotides may be in functional association with one or more expression control sequences.

[0040] In some aspects, the disclosure provides a host cell comprising a polynucleotide orplurality of nucleotides, or a vector or plurality of vectors, that encode the light chain and / or theheavy chain of an anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein.

[0041] In some aspects, the disclosure provides a method for the production of an anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein, comprising the steps:(a) cultivating a host cell comprising a polynucleotide or plurality of nucleotides, or a vector or plurality of vectors, that encode the light chain and the heavy chain of said anti-CTGF antibody or antigen-binding fragment thereof, under conditions allowing the expression of said anti-CTGF antibody or antigen-binding fragment thereof; and (b) recovering said anti-CTGF antibody or antigen-binding fragment thereof.

[0042] In some aspects, the disclosure provides a method of inhibiting the interactionbetween human CTGF and a cell, comprising contacting said human CTGF with (an effectiveamount of) the anti-CTGF antibody or antigen-binding fragment thereof as disclosed herein.

[0043] In some aspects, the disclosure provides a method of inhibiting the interactionbetween human CTGF-NTF and a cell, comprising contacting said human CTGF-NTF with (aneffective amount of) the anti-CTGF antibody or antigen-binding fragment thereof as disclosedherein. BRIEF DESCRIPTION OF THE DRAWINGS

[0044] FIG. 1. Normalized full length intact CTGF signal compared to each reaction withaddition of MMP7 and MMP7 + antibodies. Antibody 97 compared to isotype control: (p<0.005).Antibody F1 compared to isotype control: (p<0.01).

[0045] FIG.2A-2B. Measurement of N-terminal CTGF (FIG.2A) and full length CTGF (FIG.2B) in samples from healthy volunteers (“H / V”) and IPF patients (“IPF”). N-terminal CTGFconcentration was significantly elevated in IPF patients (p≤0.05).

[0046] FIG. 3. Measurement of MMP7 in samples from healthy volunteers (“H / V”) and IPFpatients (“IPF”). MMP7 concentration was significantly elevated in IPF patients (p≤0.0001).

[0047] FIG. 4A and FIG. 4B. MSD-ELISA analysis of smooth muscle actin (a-SMA) in theIPF small airway epithelial cell (SAEC) air liquid interface (ALI) co-culture system. Fold change expression values are shown, normalized to untreated control fibroblast lysate samples. Noteelevated levels of profibrotic marker a-SMA in the IPF cocktail-treated co-culture after 72 h. Theanti-CTGF Antibodies and isotype controls were added 24 hours after IPF cocktail stimulation.Antibody A97 (FIG.4A) and antibody A13 (FIG.4B) each show a dose-dependent reduction of a-SMA expression, whereas antibody F1 and corresponding isotype control antibodies does not show significant effects. (n= 3 biological replicates performed in n= 3 individual experiments).Each assay point represents a technical co-culture well. (*** p<0.001, **p < 0.01, *p < 0.05; one-way ANOVA).

[0048] FIG. 5. Vimentin staining intensity per nucleus in 2D cultured alveolar EMT assayfollowing AT2 cell culture treatment with TGFß1 . (* p<0.05)

[0049] FIG. 6. COL1A1 expression levels in 2D cultured AT2 EMT assay. MSD-ELISAanalysis of Collagen1a1 in 2D cultured AT2 EMT system. Fold change expression values shown,normalized to untreated control AT2 cell lysate samples. TGFß1 treatment induces increasedCOL1A1 expression. Antibody A97 significantly inhibits collagen production compared tocorresponding isotype control. (n = 2 donors measured as 3 individual replicates. Each assay point represents a lysate sample of a technical well (***p < 0.001; one-way ANOVA; ns: not significant).

[0050] FIG. 7. Results of collagen III (ProC3) production inhibition in the supernatant of anair-liquid-interface cell culture, shown in arbitrary units. Fibrosis and collagen III production isstimulated by IPF-cocktail. Anti-CTGF antibodies A97 or F1 were used in concentrations of 1 uM,500 nM, or 100 nM as shown. (*** p<0.001; ** p<0.01; ns: not significant).

[0051] FIG. 8. Global protein expression correlation analysis of air-liquid-interfacesupernatant. Zooming into the protein cluster containing CTGF (Gene name: CCN2) shows astrong correlation to collagen proteins and other extracellular markers. All proteins highlighted inthis cluster have a very high protein expression profile correlation with each other with >0.8according to Pearson. Note that the black coloring on the diagonal only reflects that each proteinhas a Pearson correlation of 1 with itself.

[0052] FIG.9A and FIG.9B. Free CTGF concentrations determined in samples from an IPFSAEC ALI coculture assay using a ligand binding assay on the Gyrolab platform. CTGF levels are determined using a biotinylated derivative of F1 for immobilization of CTGF and an Alexa-Fluor conjugate of A97 binding to a complementary epitope. Comparing A97 (FIG. 9A) and A13(FIG. 9B), respectively, with F1 at equal concentrations shows significantly stronger binding ofCTGF by the A97 and A13 in this assay. The bars show mean values of up to 54 individualdatapoints and error bars represent the standard deviation. Samples shown on the x-axis (y-value = 0) have values at or below the lower quantification limit.

[0053] FIG. 10. Primary human lung fibroblasts (N=2-6; different shapes indicate distinctreplicates) are exposed to either labeled CTGF or a mixture of labeled CTGF pre-incubated with isotype control or anti-CTGF antibodies as indicated on the X-axis (blank label indicates a noantibody control). After 1 hour incubation cells are washed 3 times with PBS and scanned withIncucyte for RPE signal. Results show the level of labeled CTGF binding to cells, normalized tocell density, and shown relatively to the control. Means were compared using One-way ANOVA;**p≤0.01.

[0054] FIG.11. Primary human alveolar type II cells (N=2-3; different shapes indicate distinctreplicates) are exposed to either labeled CTGF or mixture of labeled CTGF pre-incubated with isotype control or anti-CTGF antibodies as indicated on the X-axis (blank label indicates a noantibody control). After 4 hours incubation cells are washed 3 times with PBS and scanned withIncucyte for RPE signal. Results show the level of labeled CTGF binding to cells, normalized tocell density, and shown relatively to the control. Means were compared using One-way ANOVA;*p≤0.05.

[0055] FIG.12. A549 cells (n=2-10; different shapes indicate distinct replicates) are exposedto either labeled CTGF or mixture of labeled CTGF pre-incubated with isotype control or anti- CTGF antibodies as indicated on the X-axis (blank label indicates a no antibody control). After 1hour incubation cells are washed 3 times with PBS and scanned with Incucyte for RPE signal.Results show the level of labeled CTGF binding to cells, normalized to cell density, and shownrelatively to the control. Means were compared using One-way ANOVA; *p≤0.05, **** p≤0.0001

[0056] FIG. 13. QPCT gene expression in homeostatic (IL4 / 13) stimulated IDMs. Withoutfragments (-), FL CTGF and NTF CTGF fragment.

[0057] FIG. 14A-14B. Efferocytosis IDM (n=4, FIG. 14A) and MDM (n=2, FIG. 14B). One-way ANOVA with Tukey’s multiple comparison test ** p ≤ 0.01.NUMBERED STATEMENTS

[0058] The following numbered paragraphs (paras) describe particular aspects andembodiments of the present disclosure:1. An anti-CTGF antibody or an antigen-binding fragment thereof comprising:a light chain variable region comprising a light chain complementarity determining region 1 (L- CDR1) having the amino acid sequence of Y1-SSQSIVHYN-Y2-Y3-TYLE where Y1 is K or R, Y2 is A, E, G, or T and Y3 is K or N (SEQ ID NO: 10), a light chain complementarity determining region 2 (L-CDR2) having the amino acid sequence of KVS-Z1-R-Z2-S where Z1 is N or S and Z2 is A or F (SEQ ID NO: 11), and a light chain complementarity determining region 3 (L-CDR3) having the amino acid sequence of FQGSHFPLT (SEQ ID NO: 12); and a heavy chain variable region comprising a heavy chain complementarity determining region 1 (H-CDR1) having the amino acid sequence of DYYMA (SEQ ID NO: 15), a heavy chain complementarity determining region 2 (H-CDR2) having the amino acid sequence of NINY-X1- GSRTDLL-X2-SLKS where X1 is D, E, or Y and X2 is A, D, or E (SEQ ID NO: 16), and a heavy chain complementarity determining region 3 (H-CDR3) having the amino acid sequence of DTSRGSYFDV (SEQ ID NO: 17).2. The anti-CTGF antibody or an antigen-binding fragment thereof according to para 1,wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises:i. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or ii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or iii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or iv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or v. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or vi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or ix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or x. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or xi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or xvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xl. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xli. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxlii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxliii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxliv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxlv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xlvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxlvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxlviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xlix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or l. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or li. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orliii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orliv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xc. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xci. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xcii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xciii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xciv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xcv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or xcvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orxcvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orxcviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xcix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or c. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or ci. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orcii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orciii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orciv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orcv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or cvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orcvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orcviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or cix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or cx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or cxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or cxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orcxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 140, an L-CDR2 having the amino acid sequence of SEQ ID NO: 141, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 142; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177. 3. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing paras, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or ii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or iii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or iv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or v. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or vi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; orvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; orviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or ix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or x. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; or xvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 108; orxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; orxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; orxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; orxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 118; or xxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; orxxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; orxxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; orxxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xl. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xli. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xlii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xliii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xliv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xlv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xlvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xlvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; orxlviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 128; or xlix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or l. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or li. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or liii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or liv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; or lxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 138; orlxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; orlxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 148; or lxxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; orlxxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or lxxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or lxxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or lxxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; orlxxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; orlxxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or lxxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xc. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xci. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xcii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xciii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xciv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xcv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; or xcvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 158; orxcvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; orxcviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or xcix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or c. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or ci. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or ciii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or civ. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; orcvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; orcviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 168; or cxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 143, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; or cxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178; orcxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequenceof SEQ ID NO: 178.4. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing paras, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or iii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or v. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or vii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or ix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xli. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xliii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xlv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xlvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxlvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxlviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xlix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or l. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or li. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or liv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; orlix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xc. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xci. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xcii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xciii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xciv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orxcv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or xcvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orxcvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orxcviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xcix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or c. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or ci. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or ciii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or civ. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orcvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or cxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 143,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178. 5. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing paras, comprising: i. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; oriii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; oriv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxl. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxli. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxliii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxliv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxlix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orl. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orli. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orliii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orliv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxc. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxci. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxcii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxciii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxciv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxcv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxcvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orxcvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orxcviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orxcix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orc. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orci. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orciii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orciv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orcxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 144, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179.6. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing paras, comprising: i. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or ii. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or iii. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or iv. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or v. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or vi. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or vii. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or viii. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or ix. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; orx. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xi. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xii. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xiii. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xiv. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xv. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xvi. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 109; or xvii. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xix. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xx. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxi. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxii. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxv. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxix. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxx. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxxi. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxxii. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 119; or xxxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xxxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xxxv. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xxxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xxxix. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xl. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xli. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xlii. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xliii. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xliv. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xlv. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; orxlvi. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; orxlvii. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; orxlviii. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 129; or xlix. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or l. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or li. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lii. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or liii. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or liv. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lv. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lvi. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lvii. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lviii. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lix. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lx. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lxi. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lxii. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; orlxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 139; or lxv. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxix. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxx. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxi. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxii. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxv. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; orlxxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; orlxxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxix. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxx. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 149; or lxxxi. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; orlxxxii. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or lxxxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or lxxxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or lxxxv. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or lxxxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; orlxxxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; orlxxxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or lxxxix. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xc. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xci. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xcii. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xciii. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xciv. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xcv. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xcvi. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 159; or xcvii. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or xcviii. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or xcix. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; orc. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or ci. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cii. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or ciii. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or civ. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cv. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cvi. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cvii. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; orcviii. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cix. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cx. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cxi. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; or cxii. a light chain comprising the amino acid sequence of SEQ ID NO: 254, and a heavychain comprising the amino acid sequence of SEQ ID NO: 169; orcxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 104, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 114, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxv. a light chain comprising the amino acid sequence of SEQ ID NO: 124, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 134, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 144, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxviii. a light chain comprising the amino acid sequence of SEQ ID NO: 154, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxix. a light chain comprising the amino acid sequence of SEQ ID NO: 164, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxx. a light chain comprising the amino acid sequence of SEQ ID NO: 174, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxxi. a light chain comprising the amino acid sequence of SEQ ID NO: 184, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxxii. a light chain comprising the amino acid sequence of SEQ ID NO: 194, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxxiii. a light chain comprising the amino acid sequence of SEQ ID NO: 204, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxxiv. a light chain comprising the amino acid sequence of SEQ ID NO: 214, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; or cxxv. a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxxvi. a light chain comprising the amino acid sequence of SEQ ID NO: 234, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179; orcxxvii. a light chain comprising the amino acid sequence of SEQ ID NO: 244, and a heavychain comprising the amino acid sequence of SEQ ID NO: 179. 7. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing paras, comprising a light chain variable region comprising an L-CDR1 having the amino acid sequence of SEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavychain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107. 8. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing paras, comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108. 9. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing paras, comprising a light chain comprising the amino acid sequence of SEQ ID NO: 224, and a heavy chain comprising the amino acid sequence of SEQ ID NO: 109.10. The anti-CTGF antibody of any one of the foregoing paras, wherein (a) said antibodycomprises a heavy chain constant region selected from IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE or a variant thereof; (b) the antibody is a monoclonal antibody; and / or (c) the antibody is a human, humanized, or chimeric antibody, preferably a humanized antibody.11. The anti-CTGF antibody of any one of the foregoing paras, wherein said antibody (a)binds human CTGF with a KD of 5 pM or lower; (b) binds the N-terminal fragment of human CTGF with a KD of 0.5 nM or lower; (c) decreases or blocks human CTGF binding to primary human fibroblast cells; (d) decreases or blocks cleavage of human CTGF by MMP7; (e) blocks or inhibits human TGFbeta-induced increase in COL1A1 expression in lung epithelial cells; (f) blocks or inhibits CTGF interaction with alveolar type II cells, fibroblasts and A549 cells; and / or (g) blocks or inhibits CTGF-NTF interaction with alveolar type II cells, fibroblasts and A549 cells.12. A pharmaceutical composition comprising the antibody or an antigen-binding fragmentthereof according to any of the foregoing paras and a pharmaceutically acceptable carrier.13. The antibody or an antigen-binding fragment thereof according to any one of paras 1 to11 or the composition according to para 12 for use as a medicament.14. The antibody or an antigen-binding fragment thereof according to any one of paras 1 to11 or the composition according to para 12 for use in treating or preventing a CTGF-associateddisorder, a fibrotic disease, hypertension, diabetes, myocardial infarction, arthritis, CTGF- related cell proliferative disease, atherosclerosis, glaucoma, or a cancer.15. The antibody, or an antigen-binding fragment thereof, or the composition for useaccording to para 13 or 14, wherein said fibrotic disease is idiopathic pulmonary fibrosis (IPF),progressive pulmonary fibrosis (PPF), pulmonary fibrosis with interstitial lung disease (PF-ILD), systemic scleroderma (SSc), Duchenne muscular dystrophy, diabetic nephropathy, diabetic retinopathy, osteoarthritis, scleroderma, chronic heart failure, liver cirrhosis or renal fibrosis, or wherein said cancer is acute lymphoblastic leukemia, dermatofibroma, breast cancer, angiolipoma, angioleiomyoma, connective tissue-generating cancer, prostate cancer, ovarian cancer, colorectal cancer, pancreatic cancer, gastrointestinal cancer, or liver cancer.16. An isolated polynucleotide or a plurality of isolated polynucleotides that encodes asequence comprising the heavy chain variable region and / or light chain variable region of theantibody or an antigen-binding fragment thereof according to any one of paras 1 to 11.17. A vector or plurality of vectors comprising the polynucleotide or the plurality ofpolynucleotides according to para 16, preferably an expression vector or plurality of expressionvectors, more preferably a vector or plurality of vectors comprising said polynucleotide or plurality of polynucleotides in functional association with one or more expression control sequences.18. A host cell comprising the polynucleotide or plurality of nucleotides according to para 17.19. A method for the production of an anti-CTGF antibody or antigen-binding fragmentthereof according to any one of paras 1 to 11, comprising the steps:(a) cultivating a host cell according to para 18 under conditions allowing the expressionof the anti-CTGF antibody or antigen-binding fragment thereof; and (b) recovering said anti-CTGF antibody or antigen-binding fragment thereof. 20. A method of inhibiting the interaction between human CTGF or human CTGF-NTF anda cell, comprising contacting said human CTGF with an effective amount of the anti-CTGFantibody or antigen-binding fragment thereof according to any one of paras 1 to 11.DETAILED DESCRIPTION

[0059] This disclosure generally relates to anti-CTGF antibodies or antigen-bindingfragments thereof. Exemplary anti-CTGF antibodies disclosed herein address the need fortreatments of conditions modulated by CTGF signaling. In some aspects, the anti-CTGFantibodies or antigen-binding fragments thereof are for diagnostic and / or therapeutic use, forexample in a subject in need thereof, such as a human.

[0060] In some aspects, the present disclosure provides an anti-CTGF antibody, inparticular, a monoclonal anti-CTGF antibody, for example a human or humanized monoclonalanti-CTGF antibody, having one or more of the properties described herein.

[0061] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofdecreases or prevents the cleavage of full length CTGF by a protease, such as MMP7.

[0062] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofdecreases or blocks the interaction between CTGF and cells that express one or more receptors for CTGF, such as alveolar type II cells, fibroblasts and A549 cells.

[0063] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofdecreases or prevents the inhibition of macrophage efferocytosis by CTGF-NTF.

[0064] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofdecreases or prevents fibrotic progression in human small airway cells raised at an air-liquidinterface and exposed to pro-fibrotic cytokines, such as the IPF cytokine cocktail (IPF-RC) described in Example 5 herein.

[0065] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofexhibits a binding affinity (KD) for full length human CTGF of lower than 50 pM, lower than 25 pM,lower than 15 pM, lower than 10 pM, lower than 5 pM, or lower than 2 pM, preferably whenmeasured by surface plasmon resonance at 25°C.

[0066] In some aspects, the anti-CTGF-antibody or antigen-binding fragment thereofexhibits a binding affinity (KD) for human CTGF-NTF of lower than 10 nM, lower than 5 nM, lowerthan 2.5 nM, lower than 1 nM, lower than 0.5 nM, or lower than 0.2 nM, preferably when measuredby surface plasmon resonance at 25° C.

[0067] In some aspects, the anti-CTGF antibody or antigen-binding fragment thereof of thepresent disclosure has favorable pharmacokinetic properties. In some aspects, the anti-CTGFantibody of the present disclosure has favorable biophysical properties, for example yield, quality,stability, or solubility.

[0068] In the present detailed description, numerous specific details are set forth to providea full understanding of the subject technology. It will be apparent, however, to one of ordinary skill in the art that the subject technology may be practiced without some of these specific details. In other instances, well-known structures and techniques have not been shown in detail so as not to obscure the subject technology. Preferences and options for a given aspect, feature, embodiment, or parameter should, unless the context indicates otherwise, be regarded as having been disclosed in combination with any and all preferences and options for all other aspects, features, embodiments and parameters of the invention.

[0069] Antibodies

[0070] The generalized structure of antibodies or immunoglobulin is well known to those ofskill in the art, these molecules are heterotetrametric glycoproteins, typically of about 150,000daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each lightchain is covalently linked to a heavy chain by one disulfide bond to form a heterodimer, and the heterotrimeric molecule is formed through a covalent disulfide linkage between the two identicalheavy chains of the heterodimers. Although the light and heavy chains are linked together by onedisulfide bond, the number of disulfide linkages between the two heavy chains varies by immunoglobulin isotype. Each heavy and light chain also has regularly spaced intrachain disulfidebridges. Each heavy chain has at the amino-terminus a variable domain (VH is the variable heavychain), followed by three or four constant domains (CH1, CH2, CH3, and optionally CH4), as well as a hinge region between CH1 and CH2. Each light chain has two domains, an amino-terminalvariable domain (VLis the variable light chain) and a carboxy-terminal constant domain (CL). The VLdomain associates non-covalently with the VHdomain, whereas the CLdomain is commonly covalently linked to the CH1 domain via a disulfide bond. Particular amino acid residues are believed to form an interface between the light and heavy chain variable domains (Chothia et al., 1985, J. Mol. Biol. 186:651-663, Vargas-Madrazo E, Paz-García E. J Mol Recognit. 2003;16(3):113–120). The variable domains are also referred herein as variable regions, and the constant domains as constant regions.

[0071] Certain domains within the variable domains differ extensively between differentantibodies i.e., are “hypervariable.” These hypervariable domains contain residues that aredirectly involved in the binding and specificity of each particular antibody for its specific antigenic determinant. Hypervariability, both in the light chain and the heavy chain variable domains, is concentrated in three segments known as complementarity determining regions (CDRs) or hypervariable loops (HVLs). CDRs are defined by sequence comparison in Kabat et al., 1991, In: Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., whereas HVLs are structurally defined according to the three- dimensional structure of the variable domain, as described by Chothia and Lesk, 1987, J. Mol. Biol.196: 901-917. As defined by Kabat, CDR-L1 is positioned at about residues 24-34, CDR-L2,at about residues 50-56, and CDR-L3, at about residues 89-97 in the light chain variable domain;CDR-H1 is positioned at about residues 31-35, CDR-H2 at about residues 50-65, and CDR-H3at about residues 95-102 in the heavy chain variable domain. Unless indicated otherwise,references to CDR sequences herein refer to the CDR sequences defined by Kabat. IMGT andNORTH provide alternative definitions of the CDRs (see, Lefranc MP. Unique database numbering system for immunogenetic analysis. Immunol Today (1997) 18:509; and North B, Lehmann A, Dunbrack RLJ. A new clustering of antibody CDR loop conformations. J Mol Biol.(2011) 406:228–56). Additionally, CDRs may be defined per the Chemical Computing Group(CCG) numbering (Almagro et al., Proteins 2011; 79:3050-3066 and Maier et al, Proteins 2014; 82:1599-1610). The CDR1, CDR2, CDR3 of the heavy and light chains therefore define the unique and functional properties specific for a given antibody. The skilled person is able to determine the CDR sequences according to aforementioned numbering schemes from aspecified VH and / or VL sequences. Except where indicated otherwise, the present invention hasbeen disclosed with reference to the CDRs defined according to Kabat, though it is to be understood that the invention could likewise be determined with reference to other CDRnumbering schemes, such as those CDRs disclosed in Tables 3-8 herein (e.g., Chothia, CCG,IMGT, or Aho).

[0072] The three CDRs within each of the heavy and light chains are separated byframework regions (FR), which contain sequences that tend to be less variable. From the amino terminus to the carboxy terminus of the heavy and light chain variable domains, the FRs and CDRs are arranged in the order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The largely β- sheet configuration of the FRs brings the CDRs within each of the chains into close proximity to each other as well as to the CDRs from the other chain. The resulting conformation contributes to the antigen binding site (see Kabat et al., 1991, NIH Publ. No.91-3242, Vol. I, pages 647-669),although not all CDR residues are necessarily directly involved in antigen binding. Those skilledin the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody. The CDR1, CDR2, CDR3 of the heavy and light chains therefore define the unique and functional properties specific for a given antibody.

[0073] FR residues and Ig constant domains are generally not directly involved in antigenbinding but contribute to antigen binding and / or mediate antibody effector function. Some FRresidues are thought to have a significant effect on antigen binding in at least three ways: bynoncovalently binding directly to an epitope, by interacting with one or more CDR residues, and by affecting the interface between the heavy and light chains. The constant domains are not directly involved in antigen binding but mediate various Ig effector functions, such as participation of the antibody in antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC) and antibody-dependent cellular phagocytosis (ADCP).

[0074] The light chains of vertebrate immunoglobulins are assigned to one of two clearlydistinct classes, kappa (κ) and lambda (λ), based on the amino acid sequence of the constant domain. By comparison, the heavy chains of mammalian immunoglobulins are assigned to one of five major classes, according to the sequence of the constant domains: IgA, IgD, IgE, IgG, andIgM. IgG and IgA are further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1,and IgA2, respectively. The antibodies, as described herein, may be of any one these classes orsubclasses. Preferably, the antibody is of the IgG-type, more preferably IgG1. The heavy chainconstant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of the classes of native immunoglobulins are well known.

[0075] Definitions

[0076] The terms, “antibody”, and “anti-CTGF antibody”, are used herein interchangeablyand encompass monoclonal antibodies (including full length monoclonal antibodies), multispecificantibodies (e.g., bispecific antibodies), antibodies with minor modifications such as N- or C-terminal truncations and antibody fragments such as variable domains and other portions of antibodies that exhibit a desired biological activity, e.g., CTGF binding.

[0077] The term “monoclonal antibody” refers to an antibody obtained from a substantiallyhomogenous population of antibody molecules, i.e., the individual antibodies comprising the population are identical except for possible well-known alterations such as removal of C-terminal lysine from the antibody heavy chain or post-translational modifications such as amino acid isomerization or deamidation, methionine oxidation or asparagine or glutamine deamidation that may be present. Monoclonal antibodies typically bind one antigenic epitope. A bispecific monoclonal antibody binds two distinct antigenic epitopes. A monoclonal antibody may bemonospecific or multispecific such as bispecific, monovalent, bivalent or multivalent. It should beunderstood that monoclonal antibodies can be made by any technique or methodology known in the art; including e.g., the hybridoma method (Kohler et al., 1975, Nature 256:495), or recombinant DNA methods known in the art (see, e.g., U.S. Pat. No.4,816,567), or methods of isolation of monoclonal recombinantly produced using phage antibody libraries, using techniques described in Clackson et al., 1991, Nature 352: 624-628, and Marks et al., 1991, J. Mol. Biol.222: 581-597.

[0078] Chimeric antibodies consist of the heavy and light chain variable regions of anantibody from one species (e.g., a non-human mammal such as a mouse) and the heavy and light chain constant regions of another species (e.g., human) antibody and can be obtained by linking the DNA sequences encoding the variable regions of the antibody from the first species (e.g., mouse) to the DNA sequences for the constant regions of the antibody from the second (e.g. human) species and transforming a host with an expression vector containing the linkedsequences to allow it to produce a chimeric antibody. Alternatively, the chimeric antibody alsocould be one in which one or more regions or domains of the heavy and / or light chain is identical with, homologous to, or a variant of the corresponding sequence in a monoclonal antibody from another immunoglobulin class or isotype, or from a consensus or germline sequence. Chimeric antibodies can include fragments of such antibodies, provided that the antibody fragment exhibits the desired biological activity of its parent antibody, for example binding to the same epitope (see, e.g., U.S. Pat. No.4,816,567; and Morrison et al., 1984, Proc. Natl. Acad. Sci. USA 81: 6851- 6855).

[0079] The terms “antibody fragment”, “antigen-binding fragment”, “anti-CTGF antibodyfragment”, “ anti-CTGF antibody fragment”, “engineered anti-CTGF antibody fragment” refer to aportion of a full length anti-CTGF antibody, in which a variable region or a functional capability is retained, for example, CTGF binding. Examples of antibody fragments include, but are not limited to, a Fab, Fab', F(ab')2, Fd, Fv, scFv and scFv-Fc fragment, a diabody, a linear antibody, a single-chain antibody, a minibody, a diabody formed from antibody fragments, and multispecific antibodies formed from antibody fragments.

[0080] Antibody fragments can be obtained for example by treating full length antibodiestreated with enzymes such as papain or pepsin to generate useful antibody fragments. Papain digestion is used to produce two identical antigen-binding antibody fragments called “Fab”fragments, each with a single antigen-binding site, and a residual “Fc” fragment. The Fabfragment also contains the constant domain of the light chain and the CH1 domain of the heavychain. Pepsin treatment yields a F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.

[0081] An example of antibody fragments according to the present disclosure are Fab’fragments. Fab' fragments differ from Fab fragments by the presence of additional residues including one or more cysteines from the antibody hinge region at the C-terminus of the CH1domain. F(ab')2 antibody fragments are pairs of Fab' fragments linked by cysteine residues in thehinge region. Other chemical couplings of antibody fragments are also known.

[0082] A “Fv” fragment contains a complete antigen-recognition and binding site consistingof a dimer of one heavy and one light chain variable domain in tight, non-covalent association. In this configuration, the three CDRs of each variable domain interact to define an antigen-biding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody.

[0083] Antibody fragments may also include “single-chain Fv” or “scFv” fragments. A “single-chain Fv” or “scFv” antibody fragment is a single chain Fv variant comprising the VH and VLdomains of an antibody where the domains are present in a single polypeptide chain. The single chain Fv is capable of recognizing and binding antigen. The scFv polypeptide may optionally also contain a polypeptide linker positioned between the VHand VLdomains in order to facilitate formation of a desired three-dimensional structure for antigen binding by the scFv (see, e.g., Pluckthun, 1994, In The Pharmacology of monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp.269-315).

[0084] Antibody fragments may also form tandem Fd segments, which comprise a pair oftandem Fd segments (VH-CH1-VH-CH1) to form a pair of antigen binding regions. These “linearantibodies” can be bispecific or monospecific as described in, for example, Zapata et al. 1995,Protein Eng.8(10):1057-1062.

[0085] The term “human antibody” as used herein includes antibodies or fragments thereofderived from human germline immunoglobulin sequences. The term “human antibody” is notintended to include antibodies in which CDR sequences derived from the germline of another(mammalian) species, such as a mouse, rat or rabbit, have been grafted onto human frameworksequences. Thus, as used herein, the term “human antibody” refers to an antibody or fragmentthereof in which every part of the protein (e.g., CDR, framework, CL, CHdomains (e.g., CH1 , CH2,CH3), hinge, VL, VH) is substantially non- immunogenic in humans, with only minor sequencechanges or variations as further described herein below.

[0086] Technologies for creating such a “human antibody” have been described and includewithout being limiting phage display or use of transgenic animals (www. Ablexis.com / technology- alivamab.php; WO 90 / 05144; D. Marks, H.R. Hoogenboom, T.P. Bonnert, J. McCafferty, A.D. Griffiths and G. Winter (1991) “By-passing immunisation. Human antibodies from V-gene librariesdisplayed on phage.” J.Mol.Biol., 222, 581-597; Knappik et al., J. Mol. Biol.296: 57-86, 2000; S.Carmen and L. Jermutus, “Concepts in antibody phage display”. Briefings in Functional Genomics and Proteomics 20021(2):189-203; Lonberg N, Huszar D. “Human antibodies from transgenic mice”. Int Rev Immunol.1995;13(1):65-93.; Brüggemann M, Taussig MJ. “Production of human antibody repertoires in transgenic mice”. Curr Opin Biotechnol.1997 Aug;8(4):455-8.).

[0087] Thus, a human antibody is distinct from e.g., a chimeric or humanized antibody. It ispointed out that a human antibody can be produced by a non-human animal or prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (e.g., heavy chain and / or light chain) genes.

[0088] In some aspects, an anti-CTGF antibody is a humanized antibody or antibodyfragment thereof. A humanized antibody or a humanized antibody fragment is a specific type of chimeric antibody which includes an immunoglobulin amino acid sequence variant, or fragment thereof, which is capable of binding to a predetermined antigen and which, comprises one or more FRs having substantially the amino acid sequence of a human immunoglobulin and one or more CDRs having substantially the amino acid sequence of a non-human immunoglobulin. Thisnon-human amino acid sequence often referred to as an “import” sequence is typically taken froman “import” antibody domain, particularly a variable domain. In general, a humanized antibodyincludes at least the CDRs or HVLs of a non-human antibody, inserted between the FRs of a human heavy or light chain variable domain. Methods of humanization of antibodies are forexample described by Almagro et al., (2008) Frontiers in Bioscience 13, 1619-1633, or inWO12092374 A2.

[0089] The chimeric, humanized or human antibodies or antigen-binding fragments thereofof the present disclosure may further be engineered. Such engineering includes without limitation the removal or exchange of undesired amino acids, for example to reduce immunogenicity in humans, or to avoid deamidation, undesirable charges or lipophilicity or non-specific binding.Such removal or exchange of undesired amino acids can, for example, be introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo. Moreover, in connection with chimeric or humanized antibodies, it will be understood that certain mouse FR residues may be retained in an antibody or fragment thereof.

[0090] In some aspects, an anti-CTGF antibody comprises substantially all of at least one,and typically two, variable domains (such as contained, for example, in Fab, Fab', F(ab')2, ScFv, and Fv fragments). In some aspects, the anti-CTGF antibody also includes at least a portion of an immunoglobulin Fc region, typically that of a human immunoglobulin. Ordinarily, the antibody will contain both the light chain as well as at least the variable domain of a heavy chain. Theantibody also may include one or more of the CH1, hinge, CH2, CH3, and / or CH4 regions of theheavy chain, as appropriate.

[0091] In some aspects, an anti-CTGF antibody can be selected from any class ofimmunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgG1, IgG2,IgG3, IgG4, IgA1 and IgA2. An alternative anti-CTGF antibody can comprise sequences from morethan one immunoglobulin class or isotype, and selecting particular modified or unmodified constant domains to optimize desired effector functions is within the ordinary skill in the art.

[0092] For example, the Fc region of an antibody mediates its serum half-life and effectorfunctions, such as complement-dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cell phagocytosis (ADCP). Fc engineering can be employed to optimize antibody properties suited to the pharmacology activity required of them. Where such cytotoxic activity is not desirable, such as targeting an immune cell in the treatment of cancer, the constant domain may be of isotype with reduced effector function, such as IgG4,and / or be modified with known modifications that reduce effector function. Where such cytotoxicactivity is desirable, such as for destruction of a targeted tumor cell, the constant domain may be of isotype with increased effector function and / or be modified with known modifications to increase effector function. Several mutations are known to either reduce or increase effectorfunction. See, e.g., “The future of antibodies as cancer drugs” Janice M Reichert, EugenDhimolea, Drug Discov Today (2012) Sep;17(17-18):954-63; PMID: 22561895, “Antibody DrugDiscovery” (Volume 4 of Molecular medicine and medicinal chemistry) Clive R. Wood, WorldScientific, 2012 ISBN 1848166281, 9781848166288; “FcγR requirements leading to successfulimmunotherapy” Immunol Rev. (2015) Nov;268(1):104-22; PMID: 26497516.

[0093] In some aspects, the constant domain of an antibody of the present disclosure ishuman IgG1 having two modifications in the constant region, Leu234Ala and Leu235Ala. Saidmodifications in the constant region reduce effector function.

[0094] The FRs and CDRs, or HVLs, of an engineered anti-CTGF antibody or antigen-binding fragment thereof need not correspond precisely to the parental sequences, i.e., thesequences of the antibody as isolated prior to engineering. For example, a parental sequence may be altered (e.g., mutagenized) by substitution, insertion or deletion such that the resulting amino acid residue is no longer identical to the original residue in the corresponding position in either parental sequence but the antibody nevertheless retains the function of binding to CTGF.Such alteration typically will not be extensive. Such alterations typically will be conservativealterations. Usually, at least 75% of the engineered antibody residues will correspond to those of the parental sequences, more often at least 90%, and most frequently greater than 95%, or greater than 98% or greater than 99%.

[0095] Immunoglobulin residues that affect the interface between heavy and light chainvariable regions (“the VL-VH interface”) are those that affect the proximity or orientation of the two chains with respect to one another. Certain residues that may be involved in interchain interactions include VL residues 34, 36, 38, 44, 46, 87, 89, 91, 96, and 98 and VH residues 35, 37, 39, 45, 47, 91, 93, 95, 100, and 103 (utilizing the numbering system set forth in Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1987)). U.S. Pat. No.6,407,213 also discusses that residues such as VL residues 43 and 85, and VH residues 43 and 60 also may be involved in this interaction. While these residues are indicated for human IgG only, they are applicable across species. Important antibody residues that are reasonably expected to be involved in interchain interactions are selected for substitution into the consensus sequence.

[0096] The terms “consensus sequence” and “consensus antibody” refer to an amino acidsequence which comprises the most frequently occurring amino acid residue at each location in all immunoglobulins of any particular class, isotype, or subunit structure, e.g., a human immunoglobulin variable domain. The consensus sequence may be based on immunoglobulinsof a particular species or of many species. A “consensus” sequence, structure, or antibody isunderstood to encompass a consensus human sequence as described in certain embodiments, and to refer to an amino acid sequence which comprises the most frequently occurring amino acid residues at each location in all human immunoglobulins of any particular class, isotype, or subunit structure. Thus, the consensus sequence contains an amino acid sequence having at each position an amino acid that is present in one or more known immunoglobulins, but which may not exactly duplicate the entire amino acid sequence of any single immunoglobulin. The variable region consensus sequence is not obtained from any naturally produced antibody or immunoglobulin. Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., and variants thereof. The FRsof heavy and light chain consensus sequences, and variants thereof, provide useful sequences for the preparation of human or humanized anti-CTGF antibodies. See, for example, U.S. Pat. Nos.6,037,454 and 6,054,297.

[0097] An “isolated” antibody is one that has been identified and separated and / or recoveredfrom a component of its natural environment or from a cell culture from which it was expressed.An isolated antibody or antibody fragment may have one or more co- or post-translationalmodifications that arise during production, purification, and / or storage of the antibody or antibodyfragment. Contaminant components of the antibody's natural environment are those materialsthat may interfere with diagnostic or therapeutic uses of the antibody, and can be enzymes, hormones, or other proteinaceous or non-proteinaceous solutes. In some aspects, the antibody will be purified to at least greater than 95% isolation by weight of antibody, for example purified to at least greater than 95%, 96%, 97%, 98%, or 99%.

[0098] An isolated antibody includes an antibody in situ within recombinant cells in which itis produced, since at least one component of the antibody's natural environment will not be present. Ordinarily however, an isolated antibody will be prepared by at least one purification step in which the recombinant cellular material is removed.

[0099] “Multispecific” refers to a protein, such as an antibody, that specifically binds two ormore distinct antigens or two or more distinct epitopes within the same antigen.

[0100] “Bispecific” refers to a protein, such as an antibody, that specifically binds two distinctantigens or two distinct epitopes within the same antigen.

[0101] In some embodiments, the antibody that specifically binds CTGF or the antigen-binding fragment thereof is a monospecific antibody. In some embodiments, the antibody thatspecifically binds CTGF or the antigen-binding fragment thereof is a bispecific antibody. In someembodiments, the antibody or the antigen-binding fragment thereof is a multispecific antibody.The monospecific antibodies that specifically bind CTGF provided herein may be engineered intobispecific antibodies, which are also encompassed within the scope of the present disclosure.

[0102] Full length bispecific antibodies may be generated for example using Fab armexchange (e.g., half-molecule exchange, exchanging one heavy chain-light chain pair) between two monospecific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression. The Fab arm exchange reaction is the result of a disulfide-bond.

[0103] Bispecific antibodies may also be generated using designs such as theTriomab / Quadroma (Trion Pharma / Fresenius Biotech), Knob-in-Hole (Genentech), CrossMAbs (Roche) and the electrostatically-induced CH3 interaction (Chugai, Amgen, NovoNordisk, Oncomed), the LUZ-Y (Genentech), the Strand Exchange Engineered Domain body (SEEDbody) (EMD Serono), the Biclonic (Merus) and as DuoBody® Products (Genmab A / S).

[0104] As used herein, the terms “identical” or “percent identity,” in the context of two ormore nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence. To determine the percent identity, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=# of identical positions / total # of positions (e.g., overlapping positions)x100). In some embodiments, the two sequences that are compared are the same length after gaps are introduced within the sequences, as appropriate (e.g., excluding additional sequence extending beyond the sequences being compared). For example, when variable region sequences are compared, the leader and / or constant domain sequences are notconsidered. For sequence comparisons between two sequences, a “corresponding” CDR refersto a CDR in the same location in both sequences (e.g., CDR-H1 of each sequence).

[0105] The determination of percent identity or percent similarity between two sequencescan be accomplished using a mathematical algorithm. A preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul,1993, Proc. Natl. Acad. Sci. USA 90:5873-5877. Such an algorithm is incorporated into theNBLAST and XBLAST programs of Altschul et al., 1990, J. Mol. Biol. 215:403-410. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12, to obtain nucleotide sequences homologous to a nucleic acid encoding a protein of interest. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3, to obtain amino acid sequences homologous to protein of interest. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402. Alternatively, PSI-Blast can be used to perform an iteratedsearch which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs(e.g., XBLAST and NBLAST) can be used. Another preferred, non-limiting example of amathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, CABIOS (1989). Such an algorithm is incorporated into the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. Additional algorithms for sequence analysis are known in the art and include ADVANCE and ADAM as described in Torellis and Robotti, 1994, Comput. Appl. Biosci.10:3-5; and FASTA described in Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85:2444-8. Within FASTA, ktup is a control option that sets the sensitivity and speed of the search. If ktup=2, similar regions in the two sequences being compared are found by looking at pairs of aligned residues; if ktup=1, single aligned amino acids are examined. ktup can be set to 2 or 1 for protein sequences, or from 1 to 6 for DNA sequences. The default if ktup is not specified is 2 for proteins and 6 for DNA. Alternatively, protein sequence alignment may be carried out using the CLUSTAL W algorithm, as described by Higgins et al., 1996, Methods Enzymol.266:383-402.

[0106] For diagnostic as well as therapeutic monitoring purposes, the antibodies or antigen-binding fragment thereof of the invention also may be conjugated to a label, either a label aloneor a label and an additional second agent (prodrug, chemotherapeutic agent and the like). A label,as distinguished from the other second agents refers to an agent that is a detectable compound or composition and it may be conjugated directly or indirectly to an anti-CTGF antibody or antigen-binding fragment thereof of the present invention. The label may itself be detectable (e.g.,radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition that is detectable. Labeled anti-CTGF antibodies or antigen-binding fragments thereof can be prepared and used in variousapplications including in vitro and in vivo diagnostics.

[0107] In various aspects of the present invention one or more domains of the anti-CTGFantibodies or antigen-binding fragments thereof will be recombinantly expressed. Suchrecombinant expression may employ one or more control sequences, i.e., polynucleotide sequences necessary for expression of an operably linked coding sequence in a particular hostorganism. The control sequences suitable for use in prokaryotic cells include, for example,promoter, operator, and ribosome binding site sequences. Eukaryotic control sequences include, but are not limited to, promoters, polyadenylation signals, and enhancers. These controlsequences can be utilized for expression and production of anti-CTGF antibodies or antigen-binding fragments thereof in prokaryotic and eukaryotic host cells.

[0108] A nucleic acid sequence is “operably linked” when it is placed into a functionalrelationship with another nucleic acid sequence. For example, a nucleic acid presequence or secretory leader is operably linked to a nucleic acid encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, inthe case of a secretory leader, contiguous and in reading frame. However, enhancers are optionally contiguous. Linking can be accomplished by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors or linkers can be used.

[0109] As used herein, the expressions “cell”, “cell line”, and “cell culture” are usedinterchangeably and all such designations include the progeny thereof. Thus, “transformants” and“transformed cells” include the primary subject cell and cultures derived therefrom without regardfor the number of transfers, which may for example have been transfected with one or more expression vectors encoding one or more amino acids sequences of an antibody or antigen-binding fragment thereof of the present invention.

[0110] The term “mammal” for purposes of treatment according to the invention refers to anyanimal classified as a mammal, including humans, domesticated and farm animals, and zoo,sports, or companion animals, such as dogs, horses, cats, cows, and the like. Preferably, themammal is a human.

[0111] A “disorder”, as used herein, is any condition that would benefit from treatment withan anti-CTGF antibody or antigen-binding fragment thereof described herein. This includeschronic and acute disorders or diseases including those pathological conditions that predisposethe mammal to the disorder in question. Non-limiting examples or disorders to be treated hereininclude CTGF-associated disorders.

[0112] As used herein, the term “CTGF-associated disorder” or “CTGF-associated disease”refers to a condition, which can be alleviated by inhibiting the CTGF cleavage and / or by inhibitingCTGF signaling, e.g., CTGF-NTF signaling. The terms “CTGF-associated disorder” or “CTGF-associated disease” include inflammatory disease, respiratory disease, or fibrotic disorders.CTGF-associated disorders include progressive pulmonary fibrosis, idiopathic pulmonaryfibrosis, arthritis, atherosclerosis, cardiac fibrosis, connective tissue fibrosis, Duchenne musculardystrophy, diabetic nephropathy, diabetic retinopathy, diffuse scleroderma, endothelial fibrosis,epithelial fibrosis, fibrotic disorders, glaucoma, joint fibrosis, kidney fibrosis, limited scleroderma,liver fibrosis, macular degeneration, ocular fibrosis, osteoarthritis, proliferative vitreoretinopathy,pulmonary fibrosis, and systemic fibrosis. CTGF-associated disorders include cancers includingacute lymphoblastic leukemia, dermatofibromas, breast cancer, breast carcinoma, glioma and glioblastoma, rhabdomyosarcoma and fibrosarcoma, desmoplasia, angiolipoma, angioleiomyoma, desmoplastic cancers, and prostate, ovarian, colorectal, pancreatic, gastrointestinal, and liver cancer and other tumor growth and metastases.

[0113] The terms “specifically binds” or “specific binding” in the context of a binding agent,e.g., an antibody or antigen-binding fragment thereof, refers to a binding agent that associates more frequently, more rapidly, with greater duration, with greater affinity, with greater avidity or with some combination of the above, to an antigen or an epitope within the antigen than with an unrelated antigen. In certain embodiments, an antibody or antigen-binding fragment thereof specifically binds to an antigen or epitope within an antigen with a KD of about 0.1 mM or less,preferably less than about 1 μΜ. Because of the sequence identity between homologous proteinsin different species, or variants of a protein within a single species, specific binding can includean antibody or antigen-binding fragment thereof that recognizes a protein in more than onespecies. It is understood that, in certain embodiments, an antibody or antigen-binding fragmentthereof that specifically binds a first protein may or may not specifically bind a second protein. Assuch, “specific binding” does not necessarily require (although it can include) exclusive binding,i.e. binding to a single protein. Thus, an antibody or antigen-binding fragment thereof may, incertain embodiments, specifically bind more than one protein.

[0114] Methods for determining whether two molecules specifically bind a protein aredescribed herein or a known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. In one embodiment, specific binding is characterized by a KDof about 1 x 10.-7M (100 nM) or less according to the affinity binding method described in the Examples section herein. In some embodiments, specific binding is characterized by a KDof about 5 x 10.-8M (50 nM) or less according to the affinity binding method described in the Examples section herein. In some embodiments, specific binding is characterized by a KDof about 1 x 10.-8M (10 nM) or less according to the affinity binding method described in the Examples section herein. In some embodiments, specific binding is characterized by a KDof about 5 x 10.-9M (5 nM) or less according to the affinity binding method described in the Examples section herein.

[0115] The term “subcutaneous administration” refers to introduction of a drug, for examplean anti-CTGF antibody or antigen-binding fragment thereof of the invention, under the skin of asubject such as an animal or human patient. Subcutaneous administration may be performedwithin a pocket between the skin and underlying tissue. Subcutaneous administration may beperformed by relatively slow, sustained delivery from a drug receptacle. Pinching or drawing theskin up and away from underlying tissue may create the pocket.

[0116] The term “subcutaneous infusion” refers to introduction of a drug, for example ananti- CTGF antibody or antigen-binding fragment thereof of the invention, under the skin of asubject, preferably within a pocket between the skin and underlying tissue, by relatively slow, sustained delivery from a drug receptacle for a period of time including, but not limited to, 30 minutes or less, or 90 minutes or less. Optionally, the infusion may be made by subcutaneous implantation of a drug delivery pump implanted under the skin of the subject, wherein the pump delivers a predetermined amount of drug for a predetermined period of time, such as 30 minutes, 90 minutes, or a time period spanning the length of the treatment regimen.

[0117] The term “subcutaneous bolus” refers to drug administration beneath the skin of asubject, where bolus drug delivery is less than approximately 15 minutes; in some aspects, less than 5 minutes, and some aspects aspect, less than 60 seconds. In some aspects, administration is within a pocket between the skin and underlying tissue, where the pocket may be created by pinching or drawing the skin up and away from underlying tissue. For example, “subcutaneousbolus” refers to the administration of an anti-CTGF antibody or antigen-binding fragment thereofof the invention to a subject in less than approximately 15 minutes; in some aspects, less than 5 minutes, and in some aspects, less than 60 seconds

[0118] The term “therapeutically effective amount” is used to refer to an amount of an anti-CTGF antibody or antigen-binding fragment thereof that relieves or ameliorates one or more ofthe symptoms of the disorder being treated. In doing so, it is that amount that has a beneficialpatient outcome. Efficacy can be measured in conventional ways, depending on the condition to be treated.

[0119] The terms “treatment” and “therapy” and the like, as used herein, are meant to includetherapeutic as well as prophylactic, or suppressive measures for a disease or disorder leading to any clinically desirable or beneficial effect, including but not limited to alleviation or relief of oneor more symptoms, regression, slowing or cessation of progression of the disease or disorder.Thus, for example, the term treatment includes the administration of an anti-CTGF antibody orantigen-binding fragment thereof prior to or following the onset of a symptom of a disease ordisorder thereby preventing or removing one or more signs of the disease or disorder. As an example, the term includes the administration of an anti-CTGF antibody or antigen-bindingfragment thereof after clinical manifestation of the disease to combat the symptoms of thedisease. Further, administration of an anti-CTGF antibody or antigen-binding fragment thereofafter onset and after clinical symptoms have developed where administration affects clinical parameters of the disease or disorder, such as the degree of tissue injury or the amount or extent of metastasis, whether or not the treatment leads to amelioration of the disease, comprises“treatment” or “therapy” as used herein. Moreover, as long as the compositions of the inventioneither alone or in combination with another therapeutic agent alleviate or ameliorate at least one symptom of a disorder being treated as compared to that symptom in the absence of use of theanti-CTGF antibody or antigen-binding fragment thereof composition or antigen-binding fragmentthereof, the result should be considered an effective treatment of the underlying disorder regardless of whether all the symptoms of the disorder are alleviated or not.

[0120] To “prevent” refers to prophylactic or preventative measures that prevent and / or slowthe development of a targeted pathologic condition or disorder. Thus, those in need of prevention include those prone to have or susceptible to the disorder. In some embodiments, a disease or disorder (preferably a CTGF-associated disorder) is successfully prevented according to the methods provided herein if the patient develops, transiently or permanently, e.g., fewer or less severe symptoms associated with the disease or disorder, or a later onset of symptoms associated with the disease or disorder, than a patient who has not been subject to the methods of the invention.

[0121] An “effective amount” of an agent, e.g., a pharmaceutical composition, refers to anamount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.

[0122] Throughout this specification and the claims which follow, unless the context requiresotherwise, the term “comprise”, and variations such as “comprises” and “comprising”, will beunderstood to imply the inclusion of a stated member, integer or step but not the exclusion of anyother non-stated member, integer or step. The term “consist of” is a particular embodiment of theterm “comprise”, wherein any other non-stated member, integer or step is excluded. In the contextof the present disclosure, the term “comprise” encompasses the term “consist of”. The term“comprising” thus encompasses “including” as well as “consisting” e.g., a composition“comprising” X may consist exclusively of X or may include something additional e.g., X + Y. Forexample, unless the context requires otherwise, an antibody chain disclosed as “comprising” aspecified amino acid sequence encompasses an antibody chain “consisting of” that amino acid sequence. Optionally, said antibody chain may be glycosylated at one or more sites and / or may have one or more post-translational modifications.

[0123] The term “about” in relation to a numerical value x means x plus or minus (±) 10 %,for example, x ± 1 %, or x ± 2 %, or x ± 3 %, or x ± 4 %, or x ± 5 %, or x ± 6 %, or x ± 7 %, or x ± 8 %, or x ± 9 %, or x ± 10 %.

[0124] Antibody Preparation

[0125] In further aspects, the present invention provides a method of producing anti-CTGFantibodies of the invention and antigen-binding fragments thereof, comprising culturing a recombinant host cell expressing the heavy and light chains and isolating the antibody or antigen- binding fragment thereof produced by the cell.

[0126] Preferably, the method for producing an antibody or antigen-binding fragment thereofcomprises (a) culturing the host cell and (b) isolating the antibody or antigen-binding fragmentthereof expressed from the cell. In addition, the method may optionally contain the step (c) ofpurifying the antibody or antigen-binding fragment thereof.

[0127] An antibody of the invention can be produced by transfecting a host cell with one ormore vectors comprising polynucleotides encoding the respective antibodies or fragments, culturing the host cell (in particular under conditions that allow synthesis of said antibodymolecule); and recovering said antibody molecule from said culture. It is understood that theheavy and the light chain of an antibody may be encoded by separate polynucleotides. Accordingly, provided herein is also a plurality of polynucleotides encoding the (heavy and lightchain of) the antibodies or antigen-binding fragments thereof as described herein (by separatepolynucleotides). Such a plurality of polynucleotides may be comprised in a (single) vector or in a plurality of vectors.

[0128] The antibody or antigen-binding fragment thereof (e.g. as monoclonal antibodies) canbe made using recombinant DNA methods as described in U.S. Pat. No. 4,816,567, which is incorporated by reference herein.

[0129] The (isolated) polynucleotides encoding the heavy and light chains may betransfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO)cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells. For example, isolated polynucleotides encoding theheavy and light chains may be stably transfected into a suitable host cell, e.g., a CHO cell, forantibody production.

[0130] Various techniques are known for the production of antibody fragments. Traditionally,these fragments are derived via proteolytic digestion of intact antibodies, as described, for example, by Morimoto et al., J. Biochem. Biophys. Meth.24:107-117 (1993) and Brennan et al.,Science 229:81 (1985). In some embodiments, anti-CTGF antibody fragments are producedrecombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secretedfrom E. coli or other host cells, thus allowing the production of large amounts of these fragments.Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. For example, antibody fragments can be produced by techniques known in the art including, but not limited to: F(ab′)2 fragment produced by pepsin digestion of an antibody molecule; Fab fragment generated by reducing the disulfide bridges of an F(ab′)2 fragment; Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent. According to the present invention, techniques can be adapted for the production of single-chainantibodies specific to CTGF (see, e.g., U.S. Pat. No.4,946,778).

[0131] Exemplary anti-CTGF antibodies of the disclosure

[0132] Described and disclosed herein are anti-CTGF antibodies, in particular human anti-CTGF antibodies, as well as compositions and articles of manufacture comprising anti-CTGFantibodies of the present invention. Also described are antigen-binding fragments of an anti-CTGF antibody. The anti-CTGF antibodies and antigen-binding fragments thereof can be usedin the treatment of a variety of diseases or disorders, in particular, CTGF-associated disorders.An anti-CTGF antibody and an antigen-binding fragment thereof each include at least a portionthat specifically binds to CTGF, or a fragment thereof, e.g., CTGF-NTF, preferably human CTGF or human CTGF-NTF.

[0133] The generation of anti-CTGF antibodies and their characterization is described in theExamples. CDRs of representative anti-CTGF antibodies of the present invention are disclosedin Tables 1-8 below. Heavy Chain CDR-1, CDR-2, CDR3 (H-CDR1-3) and Light Chain CDR-1,CDR-2, CDR3 (L-CDR1-3) are provided according to the numbering systems according to Kabat, Aho, CCG, and Chothia.

[0134] Table 1. Light chain CDRs according to KabatSEQ SEQ SEQ Antibody ID ID ID Chain CDR1 NO: CDR2 NO: CDR3NO: L1 KSSQSIVHYNEKTYLE 100 KVSSRFS 101 FQGSHFPLT 102L2 KSSQSIVHYNEKTYLE 110 KVSSRAS 111 FQGSHFPLT 112L3 KSSQSIVHYNGKTYLE 120 KVSSRFS 121 FQGSHFPLT 122L4 KSSQSIVHYNGKTYLE 130 KVSSRAS 131 FQGSHFPLT 132L5 KSSQSIVHYNENTYLE 140 KVSSRFS 141 FQGSHFPLT 142L6 KSSQSIVHYNENTYLE 150 KVSSRAS 151 FQGSHFPLT 152L7 RSSQSIVHYNENTYLE 160 KVSNRFS 161 FQGSHFPLT 162L8 RSSQSIVHYNANTYLE 170 KVSNRFS 171 FQGSHFPLT 172L9 RSSQSIVHYNTNTYLE 180 KVSNRFS 181 FQGSHFPLT 182L10 RSSQSIVHYNGKTYLE 190 KVSNRFS 191 FQGSHFPLT 192L11 RSSQSIVHYNEKTYLE 200 KVSNRFS 201 FQGSHFPLT 202L12 KSSQSIVHYNGNTYLE 210 KVSSRFS 211 FQGSHFPLT 212L13 KSSQSIVHYNGNTYLE 220 KVSSRAS 221 FQGSHFPLT 222L14 KSSQSIVHYNGNTYLE 230 KVSSRAS 231 FQGSHFPLT 232L15 KSSQSIVHYNEKTYLE 240 KVSSRAS 241 FQGSHFPLT 242L16 RSSQSIVHYNGNTYLE 250 KVSNRDS 251 FQGSHFPLT 252

[0135] Table 2. Heavy chain CDRs according to KabatSEQ SEQ SEQ Antibody ID ID ID Chain CDR1 NO: CDR2 NO: CDR3NO: H1 DYYMA 105 NINYEGSRTDLLESLKS 106 DTSRGSYFDV 107H2 DYYMA 115 NINYYGSRTDLLESLKS 116 DTSRGSYFDV 117H3 DYYMA 125 NINYEGSRTDLLASLKS 126 DTSRGSYFDV 127H4 DYYMA 135 NINYYGSRTDLLASLKS 136 DTSRGSYFDV 137H5 DYYMA 145 NINYDGSRTDLLDSLKS 146 DTSRGSYFDV 147H6 DYYMA 155 NINYEGSRTDLLDSLKS 156 DTSRGSYFDV 157H7 DYYMA 165 NINYDGSRTDLLESLKS 166 DTSRGSYFDV 167H8 DYYMA 175 NINYDGSRTDLLDSLKS 176 DTSRGSYFDV 177

[0136] Table 3. Light chain CDRs according to AhoAntibody SEQ ID SEQ ID SEQ ID chain CDR1 NO: CDR2 NO: CDR3NO: L1 QSIVHYNEKTY 310 KVS 320 FQGSHFPLT 321L2 QSIVHYNEKTY 310 KVS 320 FQGSHFPLT 321L3 QSIVHYNGKTY 311 KVS 320 FQGSHFPLT 321L4 QSIVHYNGKTY 311 KVS 320 FQGSHFPLT 321L5 QSIVHYNENTY 312 KVS 320 FQGSHFPLT 321L6 QSIVHYNENTY 312 KVS 320 FQGSHFPLT 321L7 QSIVHYNENTY 312 KVS 320 FQGSHFPLT 321L8 QSIVHYNANTY 313 KVS 320 FQGSHFPLT 321L9 QSIVHYNTNTY 314 KVS 320 FQGSHFPLT 321L10 QSIVHYNGKTY 311 KVS 320 FQGSHFPLT 321L11 QSIVHYNEKTY 310 KVS 320 FQGSHFPLT 321L12 QSIVHYNGNTY 315 KVS 320 FQGSHFPLT 321L13 QSIVHYNGNTY 315 KVS 320 FQGSHFPLT 321L14 QSIVHYNGNTY 315 KVS 320 FQGSHFPLT 321L15 QSIVHYNEKTY 310 KVS 320 FQGSHFPLT 321L16 QSIVHYNGNTY 315 KVS 320 FQGSHFPLT 321

[0137] Table 4. Heavy chain CDRs according to AhoSEQ SEQ SEQ Antibody ID ID ID chain CDR1 NO: CDR2 NO: CDR3NO: H1 GFTFSDYY 331 INYEGSRT 341 ARDTSRGSYFDV 348H2 GFTFSDYY 331 INYYGSRT 342 ARDTSRGSYFDV 348H3 GFTFSDYY 331 INYEGSRT 341 ARDTSRGSYFDV 348H4 GFTFSDYY 331 INYYGSRT 342 ARDTSRGSYFDV 348H5 GFTFSDYY 331 INYDGSRT 343 ARDTSRGSYFDV 348H6 GFTFSDYY 331 INYEGSRT 341 ARDTSRGSYFDV 348H7 GFTFSDYY 331 INYDGSRT 343 ARDTSRGSYFDV 348H8 GFTFSDYY 331 INYDGSRT 343 ARDTSRGSYFDV 348

[0138] Table 5. Light chain CDRs according to CCGSEQ SEQ SEQ Antibody ID ID ID chain CDR1 NO: CDR2 NO: CDR3NO: L1 KSSQSIVHYNEKTYLE 300 KVSSRFS 316 FQGSHFPLT 321L2 KSSQSIVHYNEKTYLE 300 KVSSRAS 317 FQGSHFPLT 321L3 KSSQSIVHYNGKTYLE 301 KVSSRFS 316 FQGSHFPLT 321L4 KSSQSIVHYNGKTYLE 301 KVSSRAS 317 FQGSHFPLT 321L5 KSSQSIVHYNENTYLE 302 KVSSRFS 316 FQGSHFPLT 321L6 KSSQSIVHYNENTYLE 302 KVSSRAS 317 FQGSHFPLT 321L7 RSSQSIVHYNENTYLE 303 KVSNRFS 318 FQGSHFPLT 321L8 RSSQSIVHYNANTYLE 304 KVSNRFS 318 FQGSHFPLT 321L9 RSSQSIVHYNTNTYLE 305 KVSNRFS 318 FQGSHFPLT 321L10 RSSQSIVHYNGKTYLE 306 KVSNRFS 318 FQGSHFPLT 321L11 RSSQSIVHYNEKTYLE 307 KVSNRFS 318 FQGSHFPLT 321L12 KSSQSIVHYNGNTYLE 308 KVSSRFS 316 FQGSHFPLT 321L13 KSSQSIVHYNGNTYLE 308 KVSSRAS 317 FQGSHFPLT 321L14 KSSQSIVHYNGNTYLE 308 KVSSRAS 317 FQGSHFPLT 321L15 KSSQSIVHYNEKTYLE 300 KVSSRAS 317 FQGSHFPLT 321L16 RSSQSIVHYNGNTYLE 309 KVSNRDS 319 FQGSHFPLT 321

[0139] Table 6. Heavy chain CDRs according to CCGSEQ SEQ SEQ Antibody ID ID ID chain CDR1 NO: CDR2 NO: CDR3NO: NINYEGSRTDLLESLK H1 GFTFSDYYMA 332 S 334 DTSRGSYFDV 347NINYYGSRTDLLESLK H2 GFTFSDYYMA 332 S 335 DTSRGSYFDV 347NINYEGSRTDLLASLK H3 GFTFSDYYMA 332 S 336 DTSRGSYFDV 347NINYYGSRTDLLASLK H4 GFTFSDYYMA 332 S 337 DTSRGSYFDV 347NINYDGSRTDLLDSLK H5 GFTFSDYYMA 332 S 338 DTSRGSYFDV 347NINYEGSRTDLLDSLK H6 GFTFSDYYMA 332 S 339 DTSRGSYFDV 347NINYDGSRTDLLESLK H7 GFTFSDYYMA 332 S 340 DTSRGSYFDV 347NINYDGSRTDLLDSLK H8 GFTFSDYYMA 332 S 338 DTSRGSYFDV 347

[0140] Table 7. Light chain CDRs according to ChothiaSEQ SEQ SEQ Antibody ID ID ID chain CDR1 NO: CDR2 NO: CDR3NO: L1 KSSQSIVHYNEKTYLE 300 KVSSRFS 316 FQGSHFPLT 321L2 KSSQSIVHYNEKTYLE 300 KVSSRAS 317 FQGSHFPLT 321L3 KSSQSIVHYNGKTYLE 301 KVSSRFS 316 FQGSHFPLT 321L4 KSSQSIVHYNGKTYLE 301 KVSSRAS 317 FQGSHFPLT 321L5 KSSQSIVHYNENTYLE 302 KVSSRFS 316 FQGSHFPLT 321L6 KSSQSIVHYNENTYLE 302 KVSSRAS 317 FQGSHFPLT 321L7 RSSQSIVHYNENTYLE 303 KVSNRFS 318 FQGSHFPLT 321L8 RSSQSIVHYNANTYLE 304 KVSNRFS 318 FQGSHFPLT 321L9 RSSQSIVHYNTNTYLE 305 KVSNRFS 318 FQGSHFPLT 321L10 RSSQSIVHYNGKTYLE 306 KVSNRFS 318 FQGSHFPLT 321L11 RSSQSIVHYNEKTYLE 307 KVSNRFS 318 FQGSHFPLT 321L12 KSSQSIVHYNGNTYLE 308 KVSSRFS 316 FQGSHFPLT 321L13 KSSQSIVHYNGNTYLE 308 KVSSRAS 317 FQGSHFPLT 321L14 KSSQSIVHYNGNTYLE 308 KVSSRAS 317 FQGSHFPLT 321L15 KSSQSIVHYNEKTYLE 300 KVSSRAS 317 FQGSHFPLT 321L16 RSSQSIVHYNGNTYLE 309 KVSNRDS 319 FQGSHFPLT 321

[0141] Table 8. Heavy chain CDRs according to ChothiaSEQ SEQ SEQ Antibody ID ID ID chain CDR1 NO: CDR2 NO: CDR3NO: H1 GFTFSDY 333 NYEGSR 344 TSRGSYFD 349H2 GFTFSDY 333 NYYGSR 345 TSRGSYFD 349H3 GFTFSDY 333 NYEGSR 344 TSRGSYFD 349H4 GFTFSDY 333 NYYGSR 345 TSRGSYFD 349H5 GFTFSDY 333 NYDGSR 346 TSRGSYFD 349H6 GFTFSDY 333 NYEGSR 344 TSRGSYFD 349H7 GFTFSDY 333 NYDGSR 346 TSRGSYFD 349H8 GFTFSDY 333 NYDGSR 346 TSRGSYFD 349

[0142] Amino Acid Sequence Variants

[0143] Variant anti-CTGF antibodies and antibody fragments thereof can be engineeredbased on a set of CDRs depicted in Tables 1-8. It is to be understood that in the variant anti-CTGF antibodies and antibody fragments the amino acid sequence of the CDRs remain unchanged or have minimal changes (e.g., 1-5 changes), but the surrounding regions, e.g., FRregions can be engineered. Amino acid sequence variants of the anti-CTGF antibody can beprepared by introducing appropriate nucleotide changes into the anti-CTGF antibody DNA, or by peptide synthesis. Such variants include, for example, deletions from, and / or insertions into and / or substitutions of, residues within the amino acid sequences of the anti-CTGF antibodies of the examples herein. Any combination of deletions, insertions, and substitutions is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the human or variant anti- CTGF antibody, such as changing the number or position of glycosylation sites.

[0144] In some embodiments, the present invention includes anti-CTGF antibodies orantibody fragments thereof having a variable heavy chain (also referred to as “heavy chainvariable region”) and a variable light chain (also referred to as “light chain variable region”),wherein the variable heavy chain amino acid sequence and the variable light chain amino acidsequence are at least at least 90%, preferably at least 92.5%, more preferably at least 95%, stillmore preferably at least 98%, or even more preferably at least 99% identical to the amino acidsequences disclosed in Tables 9-10 provided that the antibody or fragments thereof retainbinding to CTGF.

[0145] Table 9. Anti-CTGF antibody light chain variable region sequencesAntibody SEQ Antibodies That Light Chain Variable Region Chain ID Contain This Sequence Name NO Chain VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEK TYLEWYLQKPGQSPQLLIYKVSSRFSGVPDRFSG L1 103 A1, A2, A3, A4, A5, A6, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A7, A8 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEK TYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFSG L2 113 A9, A10, A11, A12, A13, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A14, A15, A16 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGK TYLEWYLQKPGQSPQLLIYKVSSRFSGVPDRFSG L3 123 A17, A18, A19, A20, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A21, A22, A23, A24 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGK TYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFSG L4 133 A25, A26, A27, A28, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A29, A30, A31, A32 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEN TYLEWYLQKPGQSPQLLIYKVSSRFSGVPDRFSG L5 143 A33, A34, A35, A36, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A37, A38, A39, A40 GQGTKLEIKVVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEN TYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFSG L6 153 A41, A42, A43, A44, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A45, A46, A47, A48 GQGTKLEIK VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNEN TYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSG L7 163 A49, A50, A51, A52, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A53, A54, A55, A56 GQGTKLEIK VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNAN TYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSG L8 173 A57, A58, A59, A60, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A61, A62, A63, A64 GQGTKLEIK VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNTN TYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSG L9 183 A65, A66, A67, A68, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A69, A70, A71, A72 GQGTKLEIK VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNGK TYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSG L10 193 A73, A74, A75, A76, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A77, A78, A79, A80 GQGTKLEIK VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNEK TYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSG L11 203 A81, A82, A83, A84, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A85, A86, A87, A88 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGN TYLEWYLQKPGQSPQLLIYKVSSRFSGVPDRFSG L12 213 A89, A90, A91, A92, SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A93, A94, A95, A96 GQGTKLEIK VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGN TYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFSG A97, A98, A99, A100, L13 223 SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A101, A102, A103, GQGTKLEIK A104 DIVMTQTPLSLSVSLGDQASISCKSSQSIVHYNG NTYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFS A105, A106, A107, L14 233 GSGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLT A108, A109, A110, FGQGTKLEIK A111, A112 DIVMTQTPLSLSVSLGDQASISCKSSQSIVHYNE KTYLEWYLQKPGQSPQLLIYKVSSRASGVPDRFS A113, A114, A115, L15 243 GSGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLT A116, A117, A118, FGQGTKLEIK A119, A120 VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNGN TYLEWYLQKPGQSPQLLIYKVSNRDSGVPDRFSG A121, A122, A123, L16 253 SGSGTDFTLKISRVEAEDLGVYYCFQGSHFPLTF A124, A125, A126, GQGTKLEIK A127, A128

[0146] Table 10. Anti-CTGF antibody heavy chain variable region sequencesAntibody SEQ Antibodies That Heavy Chain Variable Region Chain ID Contain This Sequence Name NO Chain EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM H1 108 A1, A9, A17, A25, A33, AWVRQAPGKGLEWVANINYEGSRTDLLESLKSRF A41, A49, A57, A65,TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A73, A81, A89, A97, GSYFDVWGAGTTVTVSS A105, A113, A121 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A2, A10, A18, A26, A34, AWVRQAPGKGLEWVANINYYGSRTDLLESLKSRF H2 118 A42, A50, A58, A66, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A74, A82, A90, A98, GSYFDVWGAGTTVTVSS A106, A114, A122 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A3, A11, A19, A27, A35, AWVRQAPGKGLEWVANINYEGSRTDLLASLKSRF H3 128 A43, A51, A59, A67, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A75, A83, A91, A99, GSYFDVWGAGTTVTVSS A107, A115, A123 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A4, A12, A20, A28, A36, AWVRQAPGKGLEWVANINYYGSRTDLLASLKSRF H4 138 A44, A52, A60, A68, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A76, A84, A92, A100, GSYFDVWGAGTTVTVSS A108, A116, A124 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A5, A13, A21, A29, A37, AWVRQAPGKGLEWVANINYDGSRTDLLDSLKSRF H5 148 A45, A53, A61, A69, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A77, A85, A93, A101, GSYFDVWGAGTTVTVSS A109, A117, A125 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A6, A14, A22, A30, A38, AWVRQAPGKGLEWVANINYEGSRTDLLDSLKSRF H6 158 A46, A54, A62, A70, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A78, A86, A94, A102, GSYFDVWGAGTTVTVSS A110, A118, A126 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A7, A15, A23, A31, A39, AWVRQAPGKGLEWVANINYDGSRTDLLESLKSRF H7 168 A47, A55, A63, A71, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A79, A87, A95, A103, GSYFDVWGAGTTVTVSS A111, A119, A127 EVKLVESGGGLVQPGGSLRLSCAASGFTFSDYYM A8, A16, A24, A32, A40, AWVRQAPGKGLEWVANINYDGSRTDLLDSLKSRF H8 178 A48, A56, A64, A72, TISRDNAKNSVYLQMNSLRAEDTAVYYCARDTSR A80, A88, A96, A104, GSYFDVWGAGTTVTVSS A112, A120, A128

[0147] Table 11. Anti-CTGF antibody light chain sequencesAntibodies Antibody SEQ That Chain Light Chain Sequence ID Contain Name NO This Chain VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEKTYLEW YLQKPGQSPQLLIYKVSSRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP L1 104 A1, A2, A3, A4, SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A5, A6, A7, A8 ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEKTYLEW YLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A9, A10, A11, L2 114 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A12, A13, A14, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A15, A16 YACEVTHQGLSSPVTKSFNRGECVVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGKTYLEW YLQKPGQSPQLLIYKVSSRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A17, A18, A19, L3 124 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A20, A21, A22, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A23, A24 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGKTYLEW YLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A25, A26, A27, L4 134 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A28, A29, A30, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A31, A32 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNENTYLEW YLQKPGQSPQLLIYKVSSRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A33, A34, A35, L5 144 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A36, A37, A38, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A39, A40 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNENTYLEW YLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A41, A42, A43, L6 154 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A44, A45, A46, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A47, A48 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNENTYLEW YLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A49, A50, A51, L7 164 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A52, A53, A54, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A55, A56 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNANTYLEW YLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A57, A58, A59, L8 174 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A60, A61, A62, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A63, A64 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNTNTYLEW YLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A65, A66, A67, L9 184 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A68, A69, A70, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A71, A72 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNGKTYLEW YLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A73, A74, A75, L10 194 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A76, A77, A78, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A79, A80 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNEKTYLEW YLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A81, A82, A83, L11 204 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A84, A85, A86, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A87, A88 YACEVTHQGLSSPVTKSFNRGECVVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGNTYLEW YLQKPGQSPQLLIYKVSSRFSGVPDRFSGSGSGTDFTLK ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP A89, A90, A91, L12 214 SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A92, A93, A94, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A95, A96 YACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGNTYLEW YLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTLK A97, A98, A99, ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP L13 224 A100, A101, SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A102, A103, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A104 YACEVTHQGLSSPVTKSFNRGEC DIVMTQTPLSLSVSLGDQASISCKSSQSIVHYNGNTYLE WYLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTL A105, A106, KISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAA L14 234 A107, A108, PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD A109, A110, NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK A111, A112 VYACEVTHQGLSSPVTKSFNRGEC DIVMTQTPLSLSVSLGDQASISCKSSQSIVHYNEKTYLE WYLQKPGQSPQLLIYKVSSRASGVPDRFSGSGSGTDFTL A113, A114, KISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAA L15 244 A115, A116, PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD A117, A118, NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK A119, A120 VYACEVTHQGLSSPVTKSFNRGEC VVMTQTPLSLPVSLGDQASISCRSSQSIVHYNGNTYLEW YLQKPGQSPQLLIYKVSNRDSGVPDRFSGSGSGTDFTLK A121, A122, ISRVEAEDLGVYYCFQGSHFPLTFGQGTKLEIKRTVAAP L16 254 A123, A124, SVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN A125, A126, ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV A127, A128 YACEVTHQGLSSPVTKSFNRGEC

[0148] Table 12. Anti-CTGF antibody heavy chain sequencesAntibodies Antibody SEQ That Chain Heavy Chain Sequence ID Contain Name NO This Chain EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYEGSRTDLLESLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A1, A9, A17, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A25, A33, A41, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H1 109 A49, A57, A65, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A73, A81, A89, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A97, A105, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A113, A121 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ A2, A10, A18, APGKGLEWVANINYYGSRTDLLESLKSRFTISRDNAKNS H2 119 A26, A34, A42, VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV A50, A58, A66, SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A74, A82, A90,TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A98, A106, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP A114, A122 EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYEGSRTDLLASLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A3, A11, A19, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A27, A35, A43, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H3 129 A51, A59, A67, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A75, A83, A91, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A99, A107, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A115, A123 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYYGSRTDLLASLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A4, A12, A20, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A28, A36, A44, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H4 139 A52, A60, A68, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A76, A84, A92, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A100, A108, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A116, A124 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYDGSRTDLLDSLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A5, A13, A21, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A29, A37, A45, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H5 149 A53, A61, A69, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A77, A85, A93, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A101, A109, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A117, A125 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYEGSRTDLLDSLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV A6, A14, A22, SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A30, A38, A46, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL H6 159 A54, A62, A70, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP A78, A86, A94, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A102, A110, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A118, A126 QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYDGSRTDLLESLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A7, A15, A23, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A31, A39, A47, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H7 169 A55, A63, A71, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A79, A87, A95, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A103, A111, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A119, A127 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG EVKLVESGGGLVQPGGSLRLSCAASGFTFSDYYMAWVRQ APGKGLEWVANINYDGSRTDLLDSLKSRFTISRDNAKNS VYLQMNSLRAEDTAVYYCARDTSRGSYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV A8, A16, A24, TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL A32, A40, A48, GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP H8 179 A56, A64, A72, EAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP A80, A88, A96, EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH A104, A112, QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY A120, A128 TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG

[0149] Combinations of light chain variable regions and heavy chain variable regions shownin Tables 9 and 10, or of light chains and heavy chains shown in Tables 11 and 12, result incertain antibodies of the present disclosure shown in Table 13.

[0150] Table 13. SEQ ID NOs of exemplary antibodies according to the disclosure.Light Heavy VL VL VL VL VH VH VH tibody Chain C VH An hain CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 Name SEQ SEQ SEQ SEQ ID ID SEQ SEQ SEQ SEQ SEQ SEQ ID ID NO: NO: ID ID ID ID ID ID NO: NO: NO: NO: NO: NO: NO: NO: A1 104 109 103 108 100 101 102 105 106 107A2 104 119 103 118 100 101 102 115 116 117A3 104 129 103 128 100 101 102 125 126 127A4 104 139 103 138 100 101 102 135 136 137A5 104 149 103 148 100 101 102 145 146 147A6 104 159 103 158 100 101 102 155 156 157A7 104 169 103 168 100 101 102 165 166 167A8 104 179 103 178 100 101 102 175 176 177A9 114 109 113 108 110 111 112 105 106 107A10 114 119 113 118 110 111 112 115 116 117A11 114 129 113 128 110 111 112 125 126 127A12 114 139 113 138 110 111 112 135 136 137A13 114 149 113 148 110 111 112 145 146 147A14 114 159 113 158 110 111 112 155 156 157A15 114 169 113 168 110 111 112 165 166 167A16 114 179 113 178 110 111 112 175 176 177A17 124 109 123 108 120 121 122 105 106 107A18 124 119 123 118 120 121 122 115 116 117A19 124 129 123 128 120 121 122 125 126 127A20 124 139 123 138 120 121 122 135 136 137A21 124 149 123 148 120 121 122 145 146 147A22 124 159 123 158 120 121 122 155 156 157A23 124 169 123 168 120 121 122 165 166 167A24 124 179 123 178 120 121 122 175 176 177A25 134 109 133 108 130 131 132 105 106 107A26 134 119 133 118 130 131 132 115 116 117A27 134 129 133 128 130 131 132 125 126 127A28 134 139 133 138 130 131 132 135 136 137A29 134 149 133 148 130 131 132 145 146 147A30 134 159 133 158 130 131 132 155 156 157A31 134 169 133 168 130 131 132 165 166 167A32 134 179 133 178 130 131 132 175 176 177A33 144 109 143 108 140 141 142 105 106 107A34 144 119 143 118 140 141 142 115 116 117A35 144 129 143 128 140 141 142 125 126 127A36 144 139 143 138 140 141 142 135 136 137A37 144 149 143 148 140 141 142 145 146 147A38 144 159 143 158 140 141 142 155 156 157A39 144 169 143 168 140 141 142 165 166 167A40 144 179 143 178 140 141 142 175 176 177A41 154 109 153 108 150 151 152 105 106 107A42 154 119 153 118 150 151 152 115 116 117A43 154 129 153 128 150 151 152 125 126 127A44 154 139 153 138 150 151 152 135 136 137A45 154 149 153 148 150 151 152 145 146 147A46 154 159 153 158 150 151 152 155 156 157A47 154 169 153 168 150 151 152 165 166 167A48 154 179 153 178 150 151 152 175 176 177A49 164 109 163 108 160 161 162 105 106 107A50 164 119 163 118 160 161 162 115 116 117A51 164 129 163 128 160 161 162 125 126 127A52 164 139 163 138 160 161 162 135 136 137A53 164 149 163 148 160 161 162 145 146 147A54 164 159 163 158 160 161 162 155 156 157A55 164 169 163 168 160 161 162 165 166 167A56 164 179 163 178 160 161 162 175 176 177A57 174 109 173 108 170 171 172 105 106 107A58 174 119 173 118 170 171 172 115 116 117A59 174 129 173 128 170 171 172 125 126 127A60 174 139 173 138 170 171 172 135 136 137A61 174 149 173 148 170 171 172 145 146 147A62 174 159 173 158 170 171 172 155 156 157A63 174 169 173 168 170 171 172 165 166 167A64 174 179 173 178 170 171 172 175 176 177A65 184 109 183 108 180 181 182 105 106 107A66 184 119 183 118 180 181 182 115 116 117A67 184 129 183 128 180 181 182 125 126 127A68 184 139 183 138 180 181 182 135 136 137A69 184 149 183 148 180 181 182 145 146 147A70 184 159 183 158 180 181 182 155 156 157A71 184 169 183 168 180 181 182 165 166 167A72 184 179 183 178 180 181 182 175 176 177A73 194 109 193 108 190 191 192 105 106 107A74 194 119 193 118 190 191 192 115 116 117A75 194 129 193 128 190 191 192 125 126 127A76 194 139 193 138 190 191 192 135 136 137A77 194 149 193 148 190 191 192 145 146 147A78 194 159 193 158 190 191 192 155 156 157A79 194 169 193 168 190 191 192 165 166 167A80 194 179 193 178 190 191 192 175 176 177A81 204 109 203 108 200 201 202 105 106 107A82 204 119 203 118 200 201 202 115 116 117A83 204 129 203 128 200 201 202 125 126 127A84 204 139 203 138 200 201 202 135 136 137A85 204 149 203 148 200 201 202 145 146 147A86 204 159 203 158 200 201 202 155 156 157A87 204 169 203 168 200 201 202 165 166 167A88 204 179 203 178 200 201 202 175 176 177A89 214 109 213 108 210 211 212 105 106 107A90 214 119 213 118 210 211 212 115 116 117A91 214 129 213 128 210 211 212 125 126 127A92 214 139 213 138 210 211 212 135 136 137A93 214 149 213 148 210 211 212 145 146 147A94 214 159 213 158 210 211 212 155 156 157A95 214 169 213 168 210 211 212 165 166 167A96 214 179 213 178 210 211 212 175 176 177A97 224 109 223 108 220 221 222 105 106 107A98 224 119 223 118 220 221 222 115 116 117A99 224 129 223 128 220 221 222 125 126 127A100 224 139 223 138 220 221 222 135 136 137A101 224 149 223 148 220 221 222 145 146 147A102 224 159 223 158 220 221 222 155 156 157A103 224 169 223 168 220 221 222 165 166 167A104 224 179 223 178 220 221 222 175 176 177A105 234 109 233 108 230 231 232 105 106 107A106 234 119 233 118 230 231 232 115 116 117A107 234 129 233 128 230 231 232 125 126 127A108 234 139 233 138 230 231 232 135 136 137A109 234 149 233 148 230 231 232 145 146 147A110 234 159 233 158 230 231 232 155 156 157A111 234 169 233 168 230 231 232 165 166 167A112 234 179 233 178 230 231 232 175 176 177A113 244 109 243 108 240 241 242 105 106 107A114 244 119 243 118 240 241 242 115 116 117A115 244 129 243 128 240 241 242 125 126 127A116 244 139 243 138 240 241 242 135 136 137A117 244 149 243 148 240 241 242 145 146 147A118 244 159 243 158 240 241 242 155 156 157A119 244 169 243 168 240 241 242 165 166 167A120 244 179 243 178 240 241 242 175 176 177A121 254 109 253 108 250 251 252 105 106 107A122 254 119 253 118 250 251 252 115 116 117A123 254 129 253 128 250 251 252 125 126 127A124 254 139 253 138 250 251 252 135 136 137A125 254 149 253 148 250 251 252 145 146 147A126 254 159 253 158 250 251 252 155 156 157A127 254 169 253 168 250 251 252 165 166 167A128 254 179 253 178 250 251 252 175 176 177

[0151] In some embodiments, the present invention includes anti-CTGF antibodies orantibody fragments thereof having a variable heavy chain and a variable light chain, wherein thevariable heavy chain amino acid sequence are at least 80% or at least 85%, preferably at least90%, more preferably at least 92.5%, still more preferably at least 95%, even more preferably at least 98%, or most preferably at least 99% identical to the amino acid sequences of SEQ ID NO: 108, 118, 128, 138, 148, 158, 168, or 178 and the variable light chain amino acid sequence areat least 80% or at least 85%, preferably at least 90%, more preferably at least 92.5%, still morepreferably at least 95%, even more preferably at least 98%, or most preferably at least 99%identical to the amino acid sequences of SEQ ID NO: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253.

[0152] In some embodiments, the present invention includes anti-CTGF antibodies havinga heavy chain and a light chain, wherein the heavy chain amino acid sequence and the light chainamino acid sequence are at least 95%, preferably at least 98%, or more preferably at least 99%identical to the amino acid sequences disclosed in Tables 11 and 12 provided that the antibodyor fragments thereof retain binding to CTGF.

[0153] In some embodiments, the anti-CTGF antibodies or antibody fragments thereofcomprise a variable heavy chain sequence that comprises an amino acid sequence with at least about 95%, preferably about 96%, more preferably about 97%, still more preferably about 98%, or even more preferably about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NOs: 100, 101, 102, 103, 110, 111, 112, 113, 114, 115, 116, 117, 104, 118, 119, 120,121, 122, 123, 124, or 221. Preferably, the anti-CTGF antibodies or antibody fragments thereofretains the binding and / or functional activity of an anti-CTGF antibody or antibody fragment thereof that comprises the variable heavy chain sequence of SEQ ID NOs: 100, 101, 102, 103,110, 111, 112, 113, 114, 115, 116, 117, 104, 118, 119, 120, 121, 122, 123, 124, or 221. In someembodiments, the anti-CTGF antibodies or antibody fragments thereof comprise the variable heavy chain sequence of SEQ ID NOs: 108, 118, 128, 138, 148, 158, 168, or 178 and have one or more conservative amino acid substitutions, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservativeamino acid substitutions in the heavy chain variable sequence. In some embodiments, the oneor more conservative amino acid substitutions fall within one or more framework regions in SEQID NOs: 108, 118, 128, 138, 148, 158, 168, or 178 (based on the numbering system of Kabat).

[0154] In some embodiments, the anti-CTGF antibody or antibody fragment thereofcomprises a variable heavy chain sequence with at least about 95%, preferably about 96%, more preferably about 97%, still more preferably about 98%, or even more preferably about 99% sequence identity to the anti-CTGF heavy chain variable region sequence set forth in 108, 118, 128, 138, 148, 158, 168, or 178 comprises one or more conservative amino acid substitutions in a framework region (based on the numbering system of Kabat), and retains the binding and / or functional activity of an anti-CTGF antibody or antibody fragment thereof that comprises a variable heavy chain sequence as set forth in SEQ ID NOs: 108, 118, 128, 138, 148, 158, 168, or 178 and a variable light chain sequence as set forth in SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253.

[0155] In some embodiments, the anti-CTGF antibodies or antibody fragments thereofcomprise a variable light chain sequence that comprises an amino acid sequence with at least about 95%, preferably about 96%, more preferably about 97%, still more preferably about 98%, or even more preferably about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253.Preferably, the anti-CTGF antibodies or antibody fragments thereof retains the binding and / or functional activity of an anti-CTGF antibody or antibody fragment thereof that comprises the variable light chain sequence of SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193,203, 213, 223, 233, 243, or 253. In some embodiments, the anti-CTGF antibodies or antibodyfragments thereof comprise the variable light chain sequence of SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253 and have one or more conservative amino acid substitutions, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative aminoacid substitutions in the light chain variable sequence. In some embodiments, the one or moreconservative amino acid substitutions fall within one or more framework regions in SEQ ID NOs:103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253 (based on thenumbering system of Kabat).

[0156] In some embodiments, the anti-CTGF antibody or antibody fragment thereofcomprises a variable light chain sequence with at least about 95%, preferably about 96%, more preferably about 97%, still more preferably about 98%, or even more preferably about 99% sequence identity to the anti-CTGF light chain variable region sequence set forth in SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253 comprises one or more conservative amino acid substitutions in a framework region (based on the numbering system of Kabat), and retains the binding and / or functional activity of an anti-CTGF antibody or antibody fragment thereof that comprises a variable heavy chain sequence as set forth in SEQ ID NOs: 108, 118, 128, 138, 148, 158, 168, or 178 and a variable light chain sequence as set forth in SEQ ID NOs: 103, 113, 123, 133, 143, 153, 163, 173, 183, 193, 203, 213, 223, 233, 243, or 253.

[0157] In some embodiments, the present invention includes anti-CTGF antibodies orantigen-binding fragments thereof having an amino acid substitution. These variants have at leastone amino acid residue in the anti-CTGF antibody or antigen-binding fragment thereof removedand a different residue inserted in its place. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated.Conservative substitutions are shown in Table 14 under the heading of “preferred substitutions”.If such substitutions result in a change in biological activity, then more substantial changes, denominated “exemplary substitutions”, or as further described below in reference to amino acid classes, may be introduced and the products screened.

[0158] Table 14. Exemplary amino acid substitutionsOriginal Residue Exemplary Substitutions PreferredSubstitutionsAla (A) val; leu; ile val Arg (R) lys; gln; asn lys Asn (N) gln; his; asp, lys; arg gln Asp (D) glu; asn glu Cys (C) ser; ala ser Gln (Q) asn; glu asn Glu (E) asp; gln asp Gly (G) ala ala His (H) arg; asn; gln; lys; arg Ile (I) leu; val; met; ala; phe; norleucine leu Leu (L) ile; norleucine; val; met; ala; phe ile Lys (K) arg; gln; asn arg Met (M) leu; phe; ile leu Phe (F) tyr; leu; val; ile; ala; tyr Pro (P) ala ala Ser (S) thr thr Thr (T) ser ser Trp (W) tyr; phe tyr Tyr (Y) phe;trp; thr; ser phe Val (V) leu; ile; met; phe ala; norleucine; leu

[0159] Naturally occurring amino acid residues are divided into groups based on commonside-chain properties:

[0160] (1) hydrophobic: norleucine, met, ala, val, leu, ile;

[0161] (2) neutral hydrophilic: cys, ser, thr;

[0162] (3) acidic: asp, glu;

[0163] (4) basic: asn, gin, his, lys, arg;

[0164] (5) residues that influence chain orientation: gly, pro; and

[0165] (6) aromatic: trp, tyr, phe.

[0166] Conservative substitutions will entail exchanging a member of one of these classesfor another member of the same class. Non-conservative substitutions will entail exchanging amember of one of these classes for another class.

[0167] Any cysteine residue not involved in maintaining the proper conformation of the anti-CTGF antibody or antigen-binding fragment thereof also may be substituted, generally withserine, to improve the oxidative stability of the molecule, prevent aberrant crosslinking, or provide for established points of conjugation to a cytotoxic or cytostatic compound. Conversely, cysteinebond(s) may be added to the antibody or antigen-binding fragment thereof to improve its stability(particularly where the antibody is an antibody fragment such as an Fv fragment).

[0168] Another type of variant of the antibody involves altering the original glycosylationpattern of the antibody. The term “altering” in this context means deleting one or morecarbohydrate moieties found in the antibody, and / or adding one or more glycosylation sites that were not previously present in the antibody. For example, an antibody may comprise an amino acid substitution at position 297 of the human IgG1 heavy chain to abrogate oligosaccharyltransferase enzyme complex-mediated glycosylation by replacing the asparagine 297 (e.g. N297A, N297G).

[0169] In some aspects, the present invention includes nucleic acid molecules that encodethe amino acid sequence variants of the anti-CTGF antibodies or antigen-binding fragmentsthereof described herein. Nucleic acid molecules encoding amino acid sequence variants of ananti-CTGF antibody or antigen-binding fragment thereof are prepared by a variety of methodsknown in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the anti-CTGF antibody or antigen-binding fragment thereof. For example, nucleic acid molecules according to the invention also encompass nucleic acid molecules which hybridize under stringent conditions to nucleic acidmolecules as disclosed herein, whereby the term “stringent conditions” within the scope of theinvention can include, e.g., hybridization in a buffer comprising 50% formamide, 5×SSC, and 1% SDS at 42 °C., or hybridization in a buffer comprising 5×SSC and 1% SDS at 65 °C., both with a wash of 0.2×SSC and 0.1% SDS at 65 °C. Exemplary stringent hybridization conditions can also include a hybridization in a buffer of 40% formamide, 1 M NaCl, and 1% SDS at 37 °C., and a wash in 1×SSC at 45 °C.

[0170] In certain embodiments, the anti-CTGF antibody is an antibody fragment. There aretechniques that have been developed for the production of antibody fragments. Fragments can be derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., 1992, Journal of Biochemical and Biophysical Methods 24:107-117; and Brennan et al., 1985, Science 229:81). Alternatively, the fragments can be produced directly in recombinant host cells. For example, Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab')2fragments (see, e.g., Carter et al., 1992, Bio / Technology 10:163-167). By another approach, F(ab')2fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to a skilled practitioner.

[0171] In some aspects, the anti-CTGF antibodies and antigen-binding fragments thereofcan include modifications, such as glycosylation, oxidation, or deamidation.

[0172] In certain embodiments, it may be desirable to use an anti-CTGF antibody fragment,rather than an intact antibody. It may be desirable to modify the antibody fragment in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment. In one method, the appropriate region of the antibody fragment can be altered (e.g., mutated), or the epitope can be incorporated into a peptide tag that is then fused to the antibody fragment at either end or in the middle, for example, by DNA or peptide synthesis (see, e.g., WO 96 / 32478). For example, antibody fragments of theinvention may also be fused to human serum albumin to increase the serum half-life, if the useof a full length IgG scaffold is undesirable. Such fusion proteins of the antibody fragment withhuman serum albumin may be advantageous in situations in which two different antibody fragments need to be fused to increase avidity, or to generate a bispecific binding protein with extended serum half-life (see e.g. WO 05 / 077042 A2).

[0173] Removal of any carbohydrate moieties present on the antibody can be accomplishedchemically or enzymatically. Chemical deglycosylation is described by Hakimuddin et al., 1987, Arch. Biochem. Biophys.259:52 and by Edge et al., 1981, Anal. Biochem., 118:131. Enzymatic cleavage of carbohydrate moieties on antibodies can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., 1987, Meth. Enzymol 138:350.

[0174] A type of useful modification comprises linking the antibody to one of a variety ofnonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in one or more of U.S. Pat. No.4,640,835, U.S. Pat. No.4,496,689, U.S. Pat. No. 4,301,144, U.S. Pat. No. 4,670,417, U.S. Pat. No. 4,791,192 and U.S. Pat. No. 4,179,337.

[0175] The present invention also provides the anti-CTGF antibody or antigen-bindingfragment thereof that competes for binding to CTGF with an anti-CTGF antibody according to thepresent invention. In one embodiment, the present invention provides an anti-CTGF antibody orantigen-binding fragment thereof that competes for binding to CTGF with antibodies A1-A128.Competition assays may be conducted for example as described in PLoS One. 2014; 9(3): e92451 using a biosensor, or PLoS One 2020 Mar 5;15(3):e0229206, or by a method disclosed herein.

[0176] Therapeutic Uses

[0177] In one embodiment, the anti-CTGF antibodies of the invention or antigen-bindingfragments thereof are useful for treating and / or preventing CTGF-associated disorders. In someembodiments, the anti-CTGF antibodies of the invention or antigen-binding fragments thereof areuseful as a medicament.

[0178] The present invention provides antibodies for treatment (use in) of various diseasesand disorders associated with CTGF. The antibodies of the invention reduce the deleterious effects of CTGF production or activity in several disorders. Further, the antibodies show favorable pharmacokinetics and / or pharmacodynamics, making them superior therapeutic agents for the treatment of disorders associated with CTGF.

[0179] The anti-CTGF antibodies of the present invention inhibit development of fibrosis.The present disclosure contemplates treating patients with a CTGF-associated disorder with an anti-CTGF antibody to improve or stabilize the pathology, restore organ function, improve the quality of life, and extend survival.

[0180] The antibodies of the invention are useful in therapeutic applications to prevent ortreat CTGF-associated disorders involving fibrosis. In some aspects, the antibodies of the invention are administered to a subject to prevent or treat a CTGF-associated disorder including, but are not limited to, disorders exhibiting altered expression and deposition of extracellular matrix-associated proteins, e.g., fibrotic disorders. In various aspects, the fibrosis may be localized to a particular tissue, such as epithelial, endothelial, or connective tissue; or to an organ, such as kidney, lung, or liver. Fibrosis can also occur in the eye and joints. In other aspects, the fibrosis may be systemic and involve multiple organ and tissue systems. CTGF-associated disorders include, for example, atherosclerosis, arthritis, retinopathies such as diabetic retinopathy; nephropathies such as diabetic nephropathy; Duchenne muscular dystrophy, cardiac, pulmonary, liver, and kidney fibrosis, and diseases associated with chronic inflammation and / or infection.

[0181] Additionally, the antibodies of the invention are useful in therapeutic applications, toprevent or treat CTGF-associated disorders in a subject. Such disorders include, but are not limited to, disorders characterized by angiogenesis and other processes which play a central role in conditions such as atherosclerosis, glaucoma, etc.; and in cancer, including acute lymphoblastic leukemia, dermatofibromas, breast cancer, breast carcinoma, glioma and glioblastoma, rhabdomyosarcoma and fibrosarcoma, desmoplasia, angiolipoma, angioleiomyoma, desmoplastic cancers, and prostate, ovarian, colorectal, pancreatic, gastrointestinal, and liver cancer and other tumor growth and metastases.

[0182] In some aspects, the invention provides antibodies for reducing the incidence of orpreventing a CTGF-associated disorder in a subject having a predisposition to develop such a disorder. A predisposition may include, e.g., hyperglycemia, hypertension, or obesity in the subject. Such disorders may occur, e.g., due to diabetes, obesity, etc., and include diabetic nephropathy, retinopathy, and cardiovascular disease. Additionally, a predisposition may be suspected due to an event, e.g., a myocardial infarction, surgery, peritoneal dialysis, chronic and acute transplant rejection, chemotherapy, radiation therapy, trauma, orthopedic or paralytic immobilization, congestive heart failure, pregnancy, or varicosities in the subject.

[0183] In particular embodiments, as exemplified herein, the antibodies of the presentinvention are administered to a subject to treat fibrosis of an organ, e.g., lung or kidney. In additional embodiments, the antibodies are administered to a subject to treat or prevent ocular disorders such as proliferative vitreoretinopathy, diabetic retinopathy, or macular degeneration.Because CTGF is implicated in a wide variety of disorders, the invention contemplates treatingpatients having a CTGF-associated disorder using an antibody of the invention to improve or stabilize pathology and organ function, improve the quality of life, and extend survival.

[0184] For therapeutic applications, the antibodies of the invention are administered to amammal, preferably a human, in a pharmaceutically acceptable dosage form. The antibodiesmay be administered intravenously. The antibodies may be administered intravenously as a bolusor by continuous infusion over a period of time. The antibodies may be administered byintramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, intravitreal, intracranial,oral, topical, or inhalation routes. The antibodies may be administered subcutaneously. When theantibody possesses the suitable activity, intratumoral, peritumoral, intralesional, or perilesional routes of administration can also be utilized to exert local as well as systemic therapeutic effects.

[0185] Such dosage forms encompass pharmaceutically acceptable carriers that arenontoxic and nontherapeutic. When present in an aqueous dosage form, rather than being lyophilized, the antibody typically will be formulated at a concentration of about 0.1 mg / ml to 100 mg / ml, although wide variation outside of these ranges is permitted.

[0186] For the prevention or treatment of disease, the appropriate dosage of antibody willdepend on the type of disease to be treated, as defined above, the severity and course of thedisease, whether the antibodies are administered for preventive or therapeutic purposes, thecourse of previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments.

[0187] Depending on the type and severity of the disease, about 0.015 to 25 mg ofantibody / kg of patient weight is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and are not excluded from the present invention.

[0188] According to some embodiments of the invention, the effectiveness of the antibodyin preventing or treating disease may be improved by administering the antibody serially or in combination with another agent that is effective for the same clinical objective, such as another antibody directed against a different epitope than the principal antibody, or one or more conventional therapeutic agents known for the intended therapeutic indication, e.g. prevention or treatment of conditions associated with excessive extracellular matrix production such as fibrosis or sclerosis, inhibition of tumor cell growth or metastasis, inhibition of neovascularization, or reduction of inflammation. Such agents may ameliorate symptoms or improve outcome via a similar mechanism of action, e.g., anti-TGFβ antibodies, or by a different mechanism, e.g., interferon-γ. Such agents may additionally ameliorate symptoms directly or indirectly associated with a CTGF-associated disorder or a predisposition to develop a CTGF-associated disorder,e.g., angiotensin-converting enzyme (ACE) inhibitors and angiotensin receptor blockers (Arbs).

[0189] Non-Therapeutic Uses

[0190] The antibodies described herein are useful as affinity purification agents. In thisprocess, the antibodies are immobilized on a solid phase such a Protein A resin, using methods well known in the art. The immobilized antibody is contacted with a sample containing the CTGF protein (or fragment thereof, such as CTGF-NTF) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the CTGF protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent that will release the CTGF protein from the antibody.

[0191] The CTGF antibodies and fragments thereof of the invention as disclosed herein arealso useful in diagnostic assays to detect and / or quantify CTGF protein, for example, detecting CTGF expression in specific cells, tissues, or plasma.

[0192] It will be advantageous in some embodiments, for example, for diagnostic purposesto label the antibody with a detectable moiety. Numerous detectable labels are available,including radioisotopes, fluorescent labels, enzyme substrate labels, quantum dots and the like. The label may be indirectly conjugated with the antibody using various known techniques. For example, the antibody can be conjugated with biotin and any of the three broad categories oflabels mentioned above can be conjugated with avidin, or vice versa. Biotin binds selectively to avidin and thus, the label can be conjugated with the antibody in this indirect manner. Alternatively, to achieve indirect conjugation of the label with the antibody, the antibody can be conjugated with a small hapten (such as digoxin) and one of the different types of labels mentioned above is conjugated with an anti-hapten antibody (e.g., anti-digoxin antibody). Thus, indirect conjugation of the label with the antibody can be achieved.

[0193] Diagnostic Kits

[0194] An anti-CTGF antibody or fragment thereof can be used in a diagnostic kit, i.e., apackaged combination of reagents in predetermined amounts with instructions for performing the diagnostic assay, such as an assay for the detection of full length CTGF and CTGF-NTF, e.g., in plasma. Accordingly, also provided herein is the use of the antibody or antigen-binding fragmentthereof as described herein for diagnosis of a CTGF-associated disorder. Where the antibody islabeled with an enzyme, the kit may include substrates and cofactors required by the enzyme such as a substrate precursor that provides the detectable chromophore or fluorophore. In addition, other additives may be included such as stabilizers, buffers (for example a block buffer or lysis buffer), and the like. The relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents that substantially optimize the sensitivity of the assay. The reagents may be provided as dry powders, usually lyophilized, including excipients that on dissolution will provide a reagent solution having the appropriate concentration.

[0195] Compositions, Combinations and Administration Thereof

[0196] A composition comprising an anti-CTGF antibody or an antigen-binding fragmentthereof according to the invention can be administered to a subject having or at risk of the CTGF-associated diseases and / or disorders described herein. The invention provides for the use of ananti-CTGF antibody or an antigen-binding fragment thereof in the manufacture of a medicamentfor prevention or treatment of a CTGF-associated disease or disorder. The term “subject” as usedherein means any mammalian patient to which an anti-CTGF antibody or an antigen-bindingfragment thereof ...

Claims

CLAIMS1. An anti-CTGF antibody or an antigen-binding fragment thereof comprising:a light chain variable region comprising a light chain complementarity determining region 1 (L- CDR1) having the amino acid sequence of Y1-SSQSIVHYN-Y2-Y3-TYLE where Y1 is K or R, Y2 is A, E, G, or T and Y3 is K or N (SEQ ID NO: 10), a light chain complementarity determining region 2 (L-CDR2) having the amino acid sequence of KVS-Z1-R-Z2-S where Z1 is N or S and Z2 is A or F (SEQ ID NO: 11), and a light chain complementarity determining region 3 (L-CDR3) having the amino acid sequence of FQGSHFPLT (SEQ ID NO: 12); and a heavy chain variable region comprising a heavy chain complementarity determining region 1 (H-CDR1) having the amino acid sequence of DYYMA (SEQ ID NO: 15), a heavy chain complementarity determining region 2 (H-CDR2) having the amino acid sequence of NINY-X1- GSRTDLL-X2-SLKS where X1 is D, E, or Y and X2 is A, D, or E (SEQ ID NO: 16), and a heavy chain complementarity determining region 3 (H-CDR3) having the amino acid sequence of DTSRGSYFDV (SEQ ID NO: 17).

2. The anti-CTGF antibody or an antigen-binding fragment thereof according to claim 1,wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or ii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or iii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or iv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or v. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 130, an L-CDR2 having the amino acid sequence of SEQ ID NO: 131, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 132; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or vi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or ix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or x. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or xi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; orxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:105, an H-CDR2 having the amino acid sequence of SEQ ID NO: 106, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 107; or xvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; orxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 115, an H-CDR2 having the amino acid sequence of SEQ ID NO: 116, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 117; or xxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xl. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; or xli. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxlii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxliii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 125, an H-CDR2 having the amino acid sequence of SEQ ID NO: 126, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 127; orxliv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orxlv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or xlvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orxlvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orxlviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or xlix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or l. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or li. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orliii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orliv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; or lv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:135, an H-CDR2 having the amino acid sequence of SEQ ID NO: 136, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 137; orlviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; orlxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 145, an H-CDR2 having the amino acid sequence of SEQ ID NO: 146, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 147; or lxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxx. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxxi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; or lxxxii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxiii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 155, an H-CDR2 having the amino acid sequence of SEQ ID NO: 156, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 157; orlxxxiv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or lxxxv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orlxxxvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orlxxxvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orlxxxviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or lxxxix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xc. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xci. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xcii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xciii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xciv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xcv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; or xcvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 250, an L-CDR2 having the amino acid sequence of SEQ ID NO: 251, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 252; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 165, an H-CDR2 having the amino acid sequence of SEQ ID NO: 166, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 167; orxcvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 100, an L-CDR2 having the amino acid sequence of SEQ ID NO: 101, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 102; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orxcviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 110, an L-CDR2 having the amino acid sequence of SEQ ID NO: 111, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 112; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or xcix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 120, an L-CDR2 having the amino acid sequence of SEQ ID NO: 121, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 122; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or c. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 150, an L-CDR2 having the amino acid sequence of SEQ ID NO: 151, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 152; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or ci. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 160, an L-CDR2 having the amino acid sequence of SEQ ID NO: 161, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 162; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 170, an L-CDR2 having the amino acid sequence of SEQ ID NO: 171, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 172; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orciii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 180, an L-CDR2 having the amino acid sequence of SEQ ID NO: 181, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 182; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orciv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 190, an L-CDR2 having the amino acid sequence of SEQ ID NO: 191, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 192; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcv. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 200, an L-CDR2 having the amino acid sequence of SEQ ID NO: 201, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 202; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO:175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cvi. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 210, an L-CDR2 having the amino acid sequence of SEQ ID NO: 211, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 212; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcvii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 220, an L-CDR2 having the amino acid sequence of SEQ ID NO: 221, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 222; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; orcviii. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 230, an L-CDR2 having the amino acid sequence of SEQ ID NO: 231, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 232; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177; or cix. a light chain variable region comprising an L-CDR1 having the amino acid sequence ofSEQ ID NO: 240, an L-CDR2 having the amino acid sequence of SEQ ID NO: 241, and an L-CDR3 having the amino acid sequence of SEQ ID NO: 242; and a heavy chain variable region comprising an H-CDR1 having the amino acid sequence of SEQ ID NO: 175, an H-CDR2 having the amino acid sequence of SEQ ID NO: 176, and an H-CDR3 having the amino acid sequence of SEQ ID NO: 177.

3. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing claims, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or iii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or v. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; orvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or ix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 108; or xvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; orxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; orxxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xxxvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; orxxxix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xli. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xliii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or xlv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or xlvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or xlvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; orxlviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or xlix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or l. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or li. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or lii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or liv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; orlvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 138; orlviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lx. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lxi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lxvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lxx. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 148; or lxxi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxx. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxiv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xc. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xci. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xcii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xciii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xciv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xcv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; or xcvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 168; orxcvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; orxcviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or xcix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or c. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or ci. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable regioncomprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or cii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or ciii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or civ. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or cv. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or cvi. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; orcvii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; orcviii. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178; or cix. a light chain variable region comprising an amino acid sequence at least 80% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 178.

4. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing claims, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or iii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or v. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or vii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; orix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or xi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or xii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; orxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; orxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; or xv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 108; orxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; orxxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xxxi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xxxix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xli. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xliii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orxlv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or xlvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orxlvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orxlviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or xlix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or l. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or li. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or lii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orliv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orlvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 138; orlviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lx. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; orlxii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; orlxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxx. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 148; or lxxi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; orlxxii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; orlxxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; orlxxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxx. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxiii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxiv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; orxc. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xci. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xcii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xciii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xciv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xcv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; or xcvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 168; orxcvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; orxcviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; orxcix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or c. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or ci. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or cii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or ciii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or civ. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or cv. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or cvi. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; orcvii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; orcviii. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178; or cix. a light chain variable region comprising an amino acid sequence at least 85% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 178.

5. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing claims, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or iii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or v. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or ix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; or xi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 108; orxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; orxxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xxxi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxxxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxxxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxxxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xxxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xxxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xxxix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xli. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; orxliii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or xlv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or xlvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; orxlvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; orxlviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or xlix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or l. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or li. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; orlii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or liv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; orlvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 138; orlviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lx. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; orlxi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; orlxx. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 148; or lxxi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; orlxxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; orlxxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; orlxxix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxx. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxiv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xc. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xci. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xcii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xciii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xciv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xcv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; or xcvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 168; orxcvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; orxcviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or xcix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or c. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or ci. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or cii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or ciii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or civ. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or cv. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; orcvi. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; orcvii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; orcviii. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178; or cix. a light chain variable region comprising an amino acid sequence at least 90% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 178.

6. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing claims, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable regioncomprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or iii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 133, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or ix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or xi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; orxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or xv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 108; or xvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; orxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; orxxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; orxli. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xliii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or xlv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or xlvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; orxlvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; orxlviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or xlix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; orl. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or li. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or lii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or liv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; orlvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 138; orlviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 148; or lxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; or lxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; or lxxx. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; or lxxxi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 158; orlxxxiv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orlxxxviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or lxxxix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xc. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xci. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xcii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xciii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xciv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orxcv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; or xcvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 253, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 168; orxcvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 103, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; orxcviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 113, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or xcix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 123, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or c. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 153, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or ci. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 163, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or cii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 173, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or ciii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 183, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; orciv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 193, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or cv. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 203, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or cvi. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 213, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; orcvii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 223, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; orcviii. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 233, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178; or cix. a light chain variable region comprising an amino acid sequence at least 95% identicalto the amino acid sequence of SEQ ID NO: 243, and a heavy chain variable region comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 178.

7. The anti-CTGF antibody or an antigen-binding fragment thereof according to any one ofthe foregoing claims, wherein the anti-CTGF antibody or an antigen-binding fragment thereof comprises: i. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or ii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; oriii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or iv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or v. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 133,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or vi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or ix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or x. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; orxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108; or xvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; orxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 118; or xxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; orxxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xl. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xli. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xlii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xliii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128; or xliv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or xlv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or xlvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or xlvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or xlviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or xlix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or l. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; orli. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or liii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or liv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; or lvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; orlvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 138; orlviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; orlxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 148; or lxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxx. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; or lxxxi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxiii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 158; orlxxxiv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orlxxxv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orlxxxvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orlxxxvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; orlxxxviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or lxxxix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xc. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xci. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xcii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xciii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xciv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xcv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xcvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 253,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 168; or xcvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 103,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or xcviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 113,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orxcix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 123,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or c. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 153,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or ci. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 163,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 173,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or ciii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 183,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or civ. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 193,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cv. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 203,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cvi. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 213,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcvii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 223,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; orcviii. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 233,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 178; or cix. a light chain variable region comprising the amino acid sequence of SEQ ID NO: 243,and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:

178.

8. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing claims, comprising:i. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or ii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or iii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or iv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or v. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or vi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; orvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; orviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or ix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or x. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or xi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; orxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; orxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or xiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or xv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 109; or xvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xx. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xxi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xxvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xxix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 119; or xxx. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xxxi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xxxix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xl. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xli. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xlii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xliii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 129; or xliv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or xlv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or xlvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or xlvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or xlviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; orxlix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or l. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or li. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or lii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or liii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or liv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or lv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; or lvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; orlvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 139; orlviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lx. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; orlxi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; orlxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; orlxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxx. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 149; or lxxi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxx. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxiii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxiv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xc. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xci. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xcii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xciii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xciv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xcv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; or xcvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 169; orxcvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; orxcviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or xcix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or c. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or ci. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or cii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or ciii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or civ. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or cv. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or cvi. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or cvii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; or cviii. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179; orcix. a light chain comprising an amino acid sequence at least 80% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NO: 179.

9. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing claims, comprising: i. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or ii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or iii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or iv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or v. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or vi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or vii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; orviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or ix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or x. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; orxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or xii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or xiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or xiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or xv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 109; or xvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xx. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxxii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxxiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 119; or xxx. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xxxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xxxvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xxxix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xl. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xli. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xlii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xliii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 129; or xliv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or xlv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or xlvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; orxlvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; orxlviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or xlix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or l. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or li. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or lii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or liii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or liv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or lv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or lvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or lvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 139; or lviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; orlix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lx. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; orlxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; orlxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; or lxx. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 149; orlxxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; orlxxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; orlxxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxx. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxiii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxiv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xc. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xci. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xcii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xciii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xciv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; orxcv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; or xcvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 169; orxcvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; orxcviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or xcix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or c. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or ci. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or cii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or ciii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or civ. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or cv. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or cvi. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; orcvii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; orcviii. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179; or cix. a light chain comprising an amino acid sequence at least 85% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO: 179.

10. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing claims, comprising: i. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or ii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or iii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or iv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or v. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or vi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or vii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or viii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; orix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or x. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 109; or xvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; orxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xx. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; orxxi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 119; or xxx. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xxxi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; orxxxii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; orxxxiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xxxiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xxxv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xxxvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xxxix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xl. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xli. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xlii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xliii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 129; or xliv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; orxlv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or xlvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; orxlvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; orxlviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or xlix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or l. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or li. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or lii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or liii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or liv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or lv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or lvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; orlvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 139; or lviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lx. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; orlxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; orlxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; orlxix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxx. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 149; or lxxi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; orlxxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; orlxxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxx. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; orlxxxi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxiii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxiv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xc. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xci. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xcii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; orxciii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xciv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xcv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; or xcvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 169; orxcvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; orxcviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or xcix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or c. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or ci. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or cii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or ciii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or civ. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; orcv. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or cvi. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; orcvii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; orcviii. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179; or cix. a light chain comprising an amino acid sequence at least 90% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 179.

11. The anti-CTGF antibody or antigen-binding fragment thereof according to any one of theforegoing claims, comprising: i. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or ii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or iii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or iv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or v. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 134, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or vi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; orvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or viii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or ix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or x. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 109; or xvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; orxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 119; or xxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xl. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xli. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xlii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; orxliii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 129; or xliv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or xlv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or xlvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orxlvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orxlviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or xlix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or l. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or li. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or lii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or liii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or liv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; or lvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 139; orlviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; orlxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 149; or lxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; orlxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxx. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxiii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 159; or lxxxiv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orlxxxviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or lxxxix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xc. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orxci. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xcii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xciii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xciv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 234, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xcv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 244, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; or xcvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 254, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 169; orxcvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 104, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orxcviii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 114, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or xcix. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 124, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or c. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 154, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or ci. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 164, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or cii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 174, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orciii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 184, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or civ. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 194, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or cv. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 204, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; or cvi. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 214, and a heavy chain comprising an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID NO: 179; orcvii. a light chain comprising an amino acid sequence at least 95% identical to the aminoacid sequence of SEQ ID NO: 224, and a heavy cha...