Antimicrobial Peptide Sequences Targeting Drug-Resistant Pathogens
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Current antimicrobial agents are ineffective against single- or multi-drug resistant pathogens, particularly carbapenem-resistant Enterobacteriaceae, which cause significant infections and deaths, necessitating the development of new therapeutic and prophylactic strategies.
Innovation Solution
Development of antimicrobial peptides with specific amino acid sequences, including FRWRRFFRKAKRFLKRHGVSIAIGTVRLLRRFG and RRWRRFFQKAKRFVKRHGVSIAVGAYRIIG, and their variants, which can be administered to treat infections, prevent biofilm growth, promote wound healing, and diagnose or treat endotoxemia by binding to lipopolysaccharide.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Reliability
If conventional antimicrobial agents are used, then they are effective against susceptible pathogens, but they are ineffective against drug-resistant pathogens including carbapenem-resistant Enterobacteriaceae
Solution Approach 1:
The patent employs parameter changes by modifying the chemical structure of antimicrobial agents through the development of novel peptides with specific amino acid sequences. These structural parameter changes enable the peptides to effectively target and disrupt drug-resistant pathogens including carbapenem-resistant Enterobacteriaceae, thereby expanding the spectrum of activity while maintaining reliability.
Solution Approach 2:
The patent utilizes composite materials by creating peptides composed of specific combinations of amino acids (such as cationic amino acids like arginine and lysine combined with hydrophobic amino acids). This composite structure at the molecular level enables the peptides to interact with and disrupt bacterial membranes of resistant pathogens, achieving both broad-spectrum activity and reliable antimicrobial effectiveness.
2Adaptability or versatility
If new antimicrobial peptides are developed, then broad-spectrum activity against resistant pathogens is achieved, but complexity of peptide sequence design increases
Solution Approach 1:
The patent applies parameter changes by establishing specific quantitative parameters for peptide design, including amino acid composition ratios (e.g., cationic amino acids comprising 20-50 mol%), peptide length (10-50 amino acids), and charge density. These defined parameter ranges simplify the design process while enabling broad-spectrum activity against resistant pathogens.
Solution Approach 2:
The patent implements local quality by incorporating specific functional regions within the peptide sequence, such as cationic amino acid-rich domains for electrostatic interaction with bacterial membranes and hydrophobic regions for membrane insertion. This localized functional organization achieves broad-spectrum activity while maintaining manageable design complexity through modular structure.
Applied Scientific Principles
This section explains which scientific principles are used to turn an abstract innovation direction into a practical engineering solution.
Function Achieved in This Case
The peptides effectively target and disrupt microbial organisms, including drug-resistant pathogens, reduce biofilm formation, and provide diagnostic capabilities, demonstrating broad-spectrum antimicrobial activity and therapeutic potential.
Implementation Method 1
The peptides effectively target and disrupt microbial organisms... by binding to lipopolysaccharide
Data Source
AI summary
Peptides are described herein, in particular peptides having antimicrobial properties, as are compositions, articles, and kits comprising such peptides, and methods for using the peptides.