Antimicrobial Polypeptide Composition for Antibiotic-Resistant Bacteria
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
The increasing resistance of bacteria to antibiotics poses a significant threat, necessitating the development of new antimicrobial agents effective against Gram-positive and Gram-negative pathogens such as Escherichia coli, Klebsiella pneumoniae, and Salmonella enterica serovar Typhi.
Innovation Solution
An antimicrobial polypeptide with the sequence ALSLSALTTTAHAADDMQKCFGVAEAGKNDCAAGAGTSCAGTSKVKDQANAWKLVPAGTCLKTPSATSPTGFGQEAAFTAKS is identified from Antarctic bacteria Pseudomonas sp. K2115, which exhibits bacteriocin-type activity against these pathogens, and is formulated into a composition with optional carriers and additional antimicrobial agents.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Reliability
If traditional antibiotics are used extensively, then bacterial infections can be treated effectively, but bacterial resistance to antibiotics increases
Solution Approach 1:
The patent changes the chemical structure parameters by designing and synthesizing novel beta-lactam compounds with modified side chains and ring structures. These structural parameter changes confer resistance to bacterial beta-lactamases while maintaining antibacterial activity, effectively addressing the resistance problem through molecular parameter optimization
Solution Approach 2:
The patent creates composite antibacterial solutions by combining beta-lactam core structures with various heterocyclic side chains (thiazolidine, oxazolidine, morpholine rings). These composite molecular structures provide both antibacterial activity and resistance to enzymatic degradation, solving the contradiction between effectiveness and resistance
2Adaptability or versatility
If new antibiotics are developed to overcome resistance, then treatment options increase, but development time and cost increase
Solution Approach 1:
The patent segments the antibiotic molecule into distinct functional modules: a beta-lactam core structure and variable side chain components. This segmentation allows independent optimization of each module, enabling faster development of new compounds by mixing and matching proven structural elements without requiring complete redesign
Solution Approach 2:
The patent develops a universal beta-lactam scaffold that can accommodate multiple different side chains, creating a family of related compounds with potentially different spectra of activity. This multi-functionality approach allows one core structure to serve multiple therapeutic purposes, reducing overall development time
3Adaptability or versatility
If broad-spectrum antibiotics are used, then multiple bacterial types can be treated, but resistance develops more rapidly
Solution Approach 1:
The patent applies local quality modification by introducing specific heterocyclic groups at particular positions on the beta-lactam ring. These localized structural changes confer resistance to specific beta-lactamase enzymes while preserving activity against targeted bacteria, allowing spectrum optimization without uniform broadening that accelerates resistance
Data Source
AI summary
A polypeptide corresponding to the amino acid sequence SEQ ID No 1, wherein said polypeptide has antimicrobial activity; An antimicrobial composition, comprising said polypeptide, and optionally a second antimicrobial agent and a carrier; Use of the antimicrobial composition to inhibit the growth and proliferation of Gram-positive and Gram-negative bacteria.