C/EBPβ Antagonist Peptide Dosing for Solid Tumor Cell Death

Resolve Bottlenecks,
Find Innovative Solutions
Generate Solutions

Solution Overview

Problem

Existing therapies lack effective inhibitors for CCAAT-enhancer-binding protein β (C/EBPβ), a transcription factor that promotes tumor survival and proliferation and inhibits differentiation in various cancers, due to the difficulty in targeting transcription factors.

Innovation Solution

A pharmaceutical composition comprising a peptide antagonist of C/EBPβ with the D-amino acid sequence VAEAREELERLEARLGQARGELKKWKMRRNQFWLKLQR (ST101) is administered intravenously at doses of 0.5-16 mg/kg to treat solid tumors, including melanoma, carcinoma, and sarcoma, disrupting C/EBPβ's interaction with cofactors like ATF5 to induce tumor cell death.

Engineering Contradictions & Design Principles

VSEngineering Contradiction Analysis

1Reliability

If transcription factors like C/EBPβ are targeted for therapeutic intervention, then tumor survival and proliferation are inhibited, but the difficulty in targeting transcription factors prevents effective inhibitor development

Engineering Contradiction:
Improvetherapeutic effectivenessVSAvoidtargeting difficulty
Core Design Contradiction:
ReliabilityVSDevice complexity

Solution Approach 1:

The patent uses an artificial mRNA molecule as an intermediary to deliver the sequence encoding the C/EBPβ inhibitor peptide into cells. This mRNA intermediary bypasses the difficulty of directly targeting transcription factors by delivering the inhibitory sequence through transcription and translation pathways, allowing the inhibitor peptide to be produced endogenously within the cell and effectively block C/EBPβ function.

Inventive Principle:
Principle #24Intermediary (Mediator)

Solution Approach 2:

The patent employs D-amino acids in the inhibitor peptide sequence to change the chemical parameters of the peptide, making it resistant to proteolytic degradation while maintaining ability to inhibit C/EBPβ. This parameter change in amino acid configuration enhances the stability and effectiveness of the inhibitor.

Inventive Principle:
Principle #35Parameter changes

2Productivity

If C/EBPβ is inhibited to promote differentiation and reduce proliferation, then tumor growth is suppressed, but achieving effective delivery and sustained action of the inhibitor is challenging

Engineering Contradiction:
Improvetumor growth suppressionVSAvoidinhibitor persistence
Core Design Contradiction:
ProductivityVSDuration of action of moving object

Solution Approach 1:

The patent performs preliminary action by introducing the mRNA encoding the inhibitor peptide before the tumor cells need protection. The mRNA is delivered and translated into the inhibitor peptide that then persists to block C/EBPβ function, providing preemptive and sustained inhibition of tumor growth pathways.

Inventive Principle:
Principle #10Preliminary action

Solution Approach 2:

The use of stable D-amino acid-containing peptide ensures continuous inhibition of C/EBPβ by preventing its degradation. The inhibitor peptide maintains its structure and function over extended periods, providing continuous blockade of the transcription factor's oncogenic activities without rapid breakdown.

Inventive Principle:
Principle #20Continuity of useful action

3Ease of manufacture

If conventional amino acid sequences are used for C/EBPβ inhibitors, then the inhibitors can be synthesized, but they are rapidly degraded and lack sustained therapeutic effect

Engineering Contradiction:
Improvepeptide synthesisVSAvoidpeptide stability
Core Design Contradiction:
Ease of manufactureVSStability of the object's composition

Solution Approach 1:

The patent changes the stereochemical parameter of the amino acids from L-form to D-form in the inhibitor peptide sequence. This parameter change makes the peptide resistant to proteolytic enzymes that specifically degrade L-amino acid sequences, thereby dramatically increasing stability while maintaining the ability to inhibit C/EBPβ and remaining synthesizable.

Inventive Principle:
Principle #35Parameter changes

Data Source

PatentEP4168033B1Administration of cebp-beta antagonist and methods of use
Publication Date: 2026.02.25 SAPIENCE THERAPEUTICS INC
  • EP4168033B1 patent drawingFigure 1
  • EP4168033B1 patent drawingFigure 2
  • EP4168033B1 patent drawingFigure 3A~3B

AI summary

Provided are methods of administering a peptide antagonist of CCAAT/enhancer-binding protein beta (C/ΕΒΡβ) and methods of treating solid tumors by administering a peptide antagonist of C/ΕΒΡβ.