C/EBPβ Antagonist Peptide Dosing for Solid Tumor Cell Death
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Existing therapies lack effective inhibitors for CCAAT-enhancer-binding protein β (C/EBPβ), a transcription factor that promotes tumor survival and proliferation and inhibits differentiation in various cancers, due to the difficulty in targeting transcription factors.
Innovation Solution
A pharmaceutical composition comprising a peptide antagonist of C/EBPβ with the D-amino acid sequence VAEAREELERLEARLGQARGELKKWKMRRNQFWLKLQR (ST101) is administered intravenously at doses of 0.5-16 mg/kg to treat solid tumors, including melanoma, carcinoma, and sarcoma, disrupting C/EBPβ's interaction with cofactors like ATF5 to induce tumor cell death.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Reliability
If transcription factors like C/EBPβ are targeted for therapeutic intervention, then tumor survival and proliferation are inhibited, but the difficulty in targeting transcription factors prevents effective inhibitor development
Solution Approach 1:
The patent uses an artificial mRNA molecule as an intermediary to deliver the sequence encoding the C/EBPβ inhibitor peptide into cells. This mRNA intermediary bypasses the difficulty of directly targeting transcription factors by delivering the inhibitory sequence through transcription and translation pathways, allowing the inhibitor peptide to be produced endogenously within the cell and effectively block C/EBPβ function.
Solution Approach 2:
The patent employs D-amino acids in the inhibitor peptide sequence to change the chemical parameters of the peptide, making it resistant to proteolytic degradation while maintaining ability to inhibit C/EBPβ. This parameter change in amino acid configuration enhances the stability and effectiveness of the inhibitor.
2Productivity
If C/EBPβ is inhibited to promote differentiation and reduce proliferation, then tumor growth is suppressed, but achieving effective delivery and sustained action of the inhibitor is challenging
Solution Approach 1:
The patent performs preliminary action by introducing the mRNA encoding the inhibitor peptide before the tumor cells need protection. The mRNA is delivered and translated into the inhibitor peptide that then persists to block C/EBPβ function, providing preemptive and sustained inhibition of tumor growth pathways.
Solution Approach 2:
The use of stable D-amino acid-containing peptide ensures continuous inhibition of C/EBPβ by preventing its degradation. The inhibitor peptide maintains its structure and function over extended periods, providing continuous blockade of the transcription factor's oncogenic activities without rapid breakdown.
3Ease of manufacture
If conventional amino acid sequences are used for C/EBPβ inhibitors, then the inhibitors can be synthesized, but they are rapidly degraded and lack sustained therapeutic effect
Solution Approach 1:
The patent changes the stereochemical parameter of the amino acids from L-form to D-form in the inhibitor peptide sequence. This parameter change makes the peptide resistant to proteolytic enzymes that specifically degrade L-amino acid sequences, thereby dramatically increasing stability while maintaining the ability to inhibit C/EBPβ and remaining synthesizable.
Data Source
Figure 1
Figure 2
Figure 3A~3B
AI summary
Provided are methods of administering a peptide antagonist of CCAAT/enhancer-binding protein beta (C/ΕΒΡβ) and methods of treating solid tumors by administering a peptide antagonist of C/ΕΒΡβ.