ELISpot Kit for NMO Diagnosis Using AQP-4 Polypeptide Fragments
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Current diagnostic methods for neuromyelitis optica (NMO) rely heavily on clinical judgment, leading to inaccurate results due to the unclear cause of the disease, and there is a need for a more sensitive and specific detection method to differentiate NMO from other demyelinating diseases.
Innovation Solution
The development of an ELISpot diagnosis kit using a specific polypeptide fragment (IMVAFKGVWTQAFWKCLVTPPSVVGGLGVTMVHGNLT) that targets IL-4 T-cells in the peripheral blood, leveraging the ELISpot method and including components like IL-4 capture antibody, biotin-labeled IL-4 detection antibody, and substrate solutions for enhanced detection.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Measurement precision
If clinical diagnosis methods are used for NMO, then the diagnostic process is simple and quick, but the accuracy and reliability of diagnosis are significantly affected by doctor ability and lack sensitivity/specificity
Solution Approach 1:
The patent introduces an intermediary detection system (ELISpot kit with polypeptide antigens and antibodies) that mediates between the clinical suspicion of NMO and the definitive diagnosis. This intermediary system objectifies the diagnostic process by detecting specific immune responses (IL-4 secreting T cells) rather than relying solely on clinical judgment, thereby improving accuracy while maintaining operational simplicity for clinicians.
Solution Approach 2:
The patent replaces the mechanical/cognitive diagnostic system (doctor's clinical judgment and experience) with an immunological detection system (ELISpot assay). This substitution transfers the diagnostic function from human cognitive processing to a standardized laboratory test that objectively measures immune responses to AQP-4 polypeptides, eliminating variability in diagnostic accuracy based on individual doctor ability.
2Reliability
If AQP-4 antibody detection is used as core supporting condition, then the sensitivity and specificity of NMO diagnosis are improved, but the complexity of detection procedures and requirements increase
Solution Approach 1:
The patent segments the complex AQP-4 antibody detection into manageable components: the AQP-4 protein is divided into multiple polypeptide fragments (23-36, 135-155, and other regions), each tested separately in the ELISpot assay. This segmentation allows the complex detection to be performed through a series of simpler, standardized steps using commercially available reagents, making the procedure more operationally feasible while maintaining high diagnostic reliability.
Solution Approach 2:
The patent changes the detection parameter from direct AQP-4 antibody measurement to indirect measurement via detection of IL-4 secreting T cells that respond to AQP-4 polypeptides. This parameter change transforms the detection into a functional immune response assay that can be performed using established ELISpot methodology, improving ease of operation while maintaining or enhancing diagnostic reliability through the specificity of T cell responses.
3Measurement precision
If polypeptide fragments with strong T-cell immunogenicity are used in ELISpot, then the sensitivity of NMO detection is improved to 85%, but the complexity of antigen preparation and selection increases
Solution Approach 1:
The patent applies preliminary action by pre-identifying and pre-characterizing the immunogenic polypeptide fragments of AQP-4 (specifically regions 23-36 and 135-155) before clinical application. These fragments have been预先 selected based on their strong T-cell immunogenicity established in prior research. This preliminary characterization allows the diagnostic kit to use standardized, pre-prepared antigens rather than requiring complex antigen selection and preparation in each diagnostic setting, thereby achieving high sensitivity (85%) while maintaining ease of manufacture and clinical implementation.
Applied Scientific Principles
This section explains which scientific principles are used to turn an abstract innovation direction into a practical engineering solution.
Function Achieved in This Case
The kit achieves a high sensitivity of 85% and specificity of 95% in diagnosing NMO, effectively assisting in both diagnosis and differential diagnosis compared to existing methods.
Implementation Method 1
The Enzyme-linked Immunospot (ELISpot) technique established in 1983 is with high sensitivity and extensive application, currently as one of the most important detection means for immunodetection of antigenic specificity immunoreaction
Implementation Method 2
the IL-4 detection antibody with biotin labeling
Implementation Method 3
The Enzyme-linked Immunospot (ELISpot) technique established in 1983 is with high sensitivity and extensive application, currently as one of the most important detection means for immunodetection of antigenic specificity immunoreaction
Data Source
AI summary
An ELISpot diagnosis kit for NMO and its application are characterized in that, the polypeptide fragment specific to NMO effector T-cell is obtained through topological conformation analysis of aquaporin-4 (AQP-4), followed by the structural analyses of the related polypeptides after combination and rearrangement so as to screen out the brand-new polypeptide fragment suitable for NMO disease diagnosis. In the ELISpot experiment, by utilizing the obtained polypeptide fragment, stimulate the effector T-cell in the NMO disease to secrete IL-4, proving the feasibility and scientific value of that polypeptide fragment in the NMO diagnosis. This method is with strong specificity, high sensitivity and easy operations, and it can be developed into the diagnosis kit for the diagnosis and differential diagnosis of NMO in the clinical examination, laying the foundation for the early discovery and treatment of NMO.