GC1 Mimetic Polypeptide Disrupts GC1-Trx1 Complex Formation
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
There is a need for compositions and methods to inhibit the interaction and complex formation between soluble guanylyl cyclase (GC1) and thioredoxin 1 (Trx1), as their interaction disrupts NO signaling pathways and contributes to aberrant cellular proliferation and altered vasodilation, particularly under oxidative stress conditions.
Innovation Solution
A polypeptide construct comprising amino acid residues 581-635 of GC1, specifically SVFAGVVGGKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFT, is used, which can be further conjugated with a cell-penetrating peptide (CPP) to disrupt the GC1/Trx1 complex, thereby blocking their interaction and modulating NO signaling pathways.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Reliability
If GC1 and Trx1 form a complex under oxidative stress, then caspase-3 activity is inhibited and cellular proliferation increases, but this leads to aberrant cellular proliferation and tumor growth
Solution Approach 1:
The patent extracts the C-terminal region (amino acid residues 581-635) of GC1 as a separate polypeptide that can disrupt the GC1/Trx1 complex formation. This extracted region acts as a competitive inhibitor that binds to Trx1, preventing the formation of the pathological GC1/Trx1 complex while restoring caspase-3 activity and reducing aberrant cellular proliferation.
2Reliability
If GC1/Trx1 complex forms in blood vessels under oxidative stress, then vasodilation is altered, but this contributes to dysregulated blood pressure
Solution Approach 1:
The patent uses the extracted C-terminal polypeptide of GC1 to disrupt the GC1/Trx1 complex in blood vessels, thereby restoring proper vasodilation regulation and preventing blood pressure dysregulation caused by oxidative stress-induced complex formation.
3Reliability
If SNO-GC1 initiates transnitrosation cascades using oTrx1 as nitrosothiol relay, then NO signaling is disrupted, but this leads to loss of cellular function
Solution Approach 1:
The patent employs the C-terminal polypeptide of GC1 as an intermediary that competes with Trx1 for binding to GC1, thereby blocking the transnitrosation cascade initiated by SNO-GC1. This prevents the disruption of NO signaling pathways while avoiding the harmful effects of uncontrolled transnitrosation.
Applied Scientific Principles
This section explains which scientific principles are used to turn an abstract innovation direction into a practical engineering solution.
Function Achieved in This Case
The polypeptide construct effectively inhibits the GC1/Trx1 complex formation, reducing NO-stimulated GC1 activity and enhancing caspase-3 activity, providing a therapeutic approach to prevent or treat diseases characterized by aberrant cellular proliferation, such as cancer, by disrupting the transnitrosation cascades initiated by SNO-GC1 and oTrx1.
Implementation Method 1
GC1 and Trx1 physically interact under conditions of oxidative stress to form a GC1/Trx1 complex
Implementation Method 2
Under oxidative stress, the NO-cGMP pathway is disrupted by S-nitrosation of GC1 (i.e., addition of a NO group to a cysteine of GC1)
Implementation Method 3
Caspase-3, which is known as an executioner caspase, plays a critical role in the process of apoptosis, inducing cell death
Data Source
AI summary
The present disclosure relates, in part, to soluble guanylyl cyclase (GC1) mimetic polypeptides comprising amino acid residues 581-635 of the α-subunit of soluble guanylyl cyclase (GC1), or a fragment thereof, and at least one cell penetrating peptide (CPP). The present disclosure further relates to methods of treating, preventing, and/or ameliorating a disease or disorder in a subject, including but not limited to cancer, hypertension, hypotension, and cardiac dysfunction. In certain embodiments, the methods comprising administering to the subject the polypeptide of the present disclosure.