Hsp90a Polypeptide Fragment for Wound Healing
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Current wound healing technologies, including growth factor therapies and skin substitutes, have shown disappointing clinical outcomes and are not cost-effective in addressing chronic wounds, particularly in promoting cell migration and wound closure, leading to prolonged healing times and associated morbidity and financial burdens.
Innovation Solution
A topical wound healing composition comprising a polypeptide compound with an hsp90a polypeptide chain, specifically a fragment of 115 or 54 amino acid units, is applied to the skin to stimulate keratinocyte and dermal cell migration, utilizing a pharmaceutical medium such as an aqueous solution or cream, to enhance wound healing by mimicking the natural process of re-epithelialization.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Productivity
If full-length hsp90α protein is used to promote wound healing, then wound closure efficiency is improved, but production cost and complexity increase due to costly extraction methods
Solution Approach 1:
The patent extracts and utilizes only the essential functional fragment of the hsp90α protein (amino acid sequence EEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEE) that is responsible for promoting keratinocyte migration and wound closure, rather than using the entire full-length protein. This fragment contains the critical amino acid residues needed for biological activity while eliminating unnecessary portions, thereby reducing production cost and complexity while maintaining wound healing efficacy.
Solution Approach 2:
The patent segments the full-length hsp90α protein into a smaller functional fragment comprising 54 amino acid units. This segmentation allows for more efficient production through recombinant DNA technology while preserving the essential wound healing function. The segmented fragment can be produced more easily and cost-effectively compared to extracting the complete protein from natural sources.
2Productivity
If growth factor therapy is used to treat chronic wounds, then cell proliferation is promoted, but clinical outcomes are disappointing and few growth factors have received FDA approval
Solution Approach 1:
The patent addresses the limitations of growth factor therapy by using heat shock protein 90α fragment, which works through a different mechanism (promoting cell migration rather than just proliferation). This alternative approach converts the limitation of growth factor therapy into a benefit by using a protein that acts through migration promotion, which is identified as a critical rate-limiting step in wound healing that was previously overlooked.
Solution Approach 2:
The hsp90α fragment acts as an intermediary that promotes wound healing by facilitating keratinocyte migration into the wound bed. Unlike growth factors that directly stimulate proliferation, this fragment mediates the healing process by enabling cells to migrate effectively, thereby providing a more reliable clinical outcome for chronic wound treatment.
3Adaptability or versatility
If non-growth factor proteins are used for wound healing, then treatment options are expanded, but complicated sequential application of several agents is required
Solution Approach 1:
The patent demonstrates that a single hsp90α fragment protein performs multiple functions in wound healing: it promotes keratinocyte migration, stimulates dermal cell movement, and facilitates overall wound closure. This multi-functionality eliminates the need for complicated sequential application of several different agents, as one protein accomplishes what previously required multiple treatments.
Applied Scientific Principles
This section explains which scientific principles are used to turn an abstract innovation direction into a practical engineering solution.
Function Achieved in This Case
The polypeptide composition significantly accelerates wound closure by promoting cell migration, even under conditions inhibitory to natural wound healing, such as high TGFβ presence, demonstrating efficacy comparable to full-length hsp90α protein while reducing the need for extensive protein length and costly extraction methods, thus offering a more effective and economical solution.
Implementation Method 1
stimulate keratinocyte and dermal cell migration... Human keratinocytes (HKCs) laterally migrate across the wound bed from the cut edge to eventually close the wound
Data Source
Figure 1
Figure 2A~2F
Figure 3A~3E
AI summary
A wound healing composition has a class of polypeptide compounds having a polypeptide chain with 5 to 120 amino acid units per chain. The composition includes a pharmaceutical medium to carry the polypeptide compound, such as an aqueous solution, suspension, dispersion, salve, ointment, gel, cream, lotion, spray or paste. Additionally, a method of applying a wound healing composition comprising a class of polypeptide compounds having a polypeptide chain with 5 to 120 amino acid units per chain in a concentration of from about 1 μg/ml to about 100 μg/ml for a time sufficient to heal the wound is disclosed.