Polypeptide Coating for Feeder-Free Pluripotent Stem Cell Culture
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Current methods for culturing pluripotent stem cells face challenges in maintaining undifferentiated states and promoting high growth activity, particularly due to the use of heterogeneous animal-derived feeder cells which can introduce foreign substances, and existing recombinant and synthetic peptides exhibit low adsorbability to culture vessels, limiting their versatility and effectiveness.
Innovation Solution
A culture method using a polypeptide with specific amino acid sequences, including CSYYQSC and RGD, and a second domain like PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN, adsorbed onto a cell culture surface, in a medium with low 2-mercaptoethanol concentration, to support pluripotent stem cell growth without feeder cells, ensuring undifferentiated maintenance and high growth activity.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Duration of action of stationary object
If heterogeneous animal-derived feeder cells are used for culturing pluripotent stem cells, then the cells can be maintained undifferentiated for long periods, but foreign substances such as animal-derived antigenic substances may be mixed into the culture solution
Solution Approach 1:
The patent extracts and eliminates the harmful foreign substances (animal-derived components) from the culture system by replacing feeder cells with a feeder-cell-free system consisting of a specialized medium and extracellular matrix coating, thereby removing the source of contamination while preserving the essential culture function
Solution Approach 2:
The patent introduces an intermediary system comprising a defined medium with specific growth factors (bFGF, TGF-β1) and an extracellular matrix coating that mediates the adhesion and maintenance of pluripotent stem cells without requiring animal-derived feeder cells, thus eliminating foreign substance contamination
2Object-affected harmful factors
If recombinant or synthetic peptides with partial vitronectin sequences are used as cell-adhesive materials, then antigenic substances are avoided, but the peptides exhibit low adsorbability to culture vessels requiring chemical bonding
Solution Approach 1:
The patent changes the physical-chemical parameters of the peptide by optimizing its amino acid sequence composition and molecular weight range (1,000-10,000 Da) to achieve sufficient adsorbability to culture vessels through simple physical adsorption rather than chemical bonding, while maintaining the non-antigenic property
Solution Approach 2:
The patent creates a composite culture system combining a defined medium with specific growth factors and a specially designed peptide coating that together provide both cell adhesion and undifferentiated maintenance functions without requiring complex chemical bonding procedures
3Object-affected harmful factors
If undifferentiated pluripotent stem cells are cultured without feeder cells, then foreign substance contamination is avoided, but the cells require complex culture conditions with specific extracellular matrix coatings and growth factors
Solution Approach 1:
The patent applies local quality by providing specific functional properties at different locations in the culture system: the extracellular matrix coating provides adhesion function on the culture vessel surface, while the defined medium provides growth and undifferentiated maintenance factors in the culture solution, creating a spatially organized functional system
Applied Scientific Principles
This section explains which scientific principles are used to turn an abstract innovation direction into a practical engineering solution.
Function Achieved in This Case
The method effectively keeps pluripotent stem cells undifferentiated and induces high growth activity, providing a serum-free, feeder-cell-free culture solution with improved adsorbability and safety for medical applications.
Implementation Method 1
A culture method using a polypeptide with specific amino acid sequences, including CSYYQSC and RGD, and a second domain like PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN, adsorbed onto a cell culture surface
Data Source
AI summary
A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 μM in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.