Scorpion-Derived Kv1.3 Blockers for Selective Channel Inhibition
Find Innovative SolutionsGenerate Solutions
Solution Overview
Problem
Current Kv1.3 blockers lack specificity and potency, and there is a need for alternative blockers with improved selectivity and stability for therapeutic applications in inflammatory disorders, autoimmune diseases, and metabolic conditions.
Innovation Solution
Development of ion channel blockers derived from the scorpion Parabuthus transvaalicus, specifically the sequences PaT1 (QMDMRCSASVECKQKCLKAIGSIFGKCMNKKCKCYPR) and variants with up to 9 amino acid substitutions, insertions, or deletions, which exhibit high selectivity and potency for Kv1.3 channels.
Engineering Contradictions & Design Principles
Engineering Contradiction Analysis
1Reliability
If conventional Kv1.3 blockers are used, then some inhibitory effect is achieved, but selectivity and potency are insufficient
Solution Approach 1:
The patent applies parameter changes by modifying the amino acid sequence of the Kv1.3 blocker peptide at specific positions (positions 1-5, 7-11, 13-15, 17-23, 25, 28-31, 33, and 35-37) to optimize both selectivity and potency. By systematically varying amino acid residues at these critical positions, the invention achieves enhanced binding affinity and channel blocking efficiency while maintaining high selectivity for Kv1.3 over other potassium channels.
Solution Approach 2:
The patent segments the peptide sequence into distinct functional regions by identifying and optimizing specific amino acid positions that contribute to different aspects of channel blocking. The segmentation of the peptide into N-terminal, central, and C-terminal functional zones allows independent optimization of each region's contribution to selectivity and potency, resolving the contradiction between these two parameters.
2Manufacturing precision
If peptide sequences are modified to improve potency, then binding affinity increases, but stability may be compromised
Solution Approach 1:
The patent applies local quality by making targeted modifications at specific amino acid positions while maintaining the integrity of other regions. By localizing sequence variations to specific positions (1-5, 7-11, 13-15, 17-23, 25, 28-31, 33, and 35-37) that are critical for potency, while preserving stable structural motifs in other regions, the invention achieves enhanced binding affinity without compromising overall peptide stability.
Solution Approach 2:
The patent creates composite peptide sequences that combine conserved stable regions with optimized potent regions. The resulting peptide molecules exhibit a composite structure where certain amino acid sequences provide structural stability while other sequences provide high binding affinity, effectively resolving the contradiction between stability and potency.
Data Source
AI summary
The present invention provides novel blockers of the potassium channel Kv1.3, polynucleotides encoding them, and methods of making and using them.