Biochemical reaction methods and reagents including intrinsically modified regions
Intrinsically disordered region (IDR) macromolecules and polypeptides enhance biochemical reactions by inducing phase separation and molecular colocalization, addressing inefficiencies in existing methods and improving reaction efficiency without external crowding agents.
Patent Information
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Filing Date
- 2020-11-11
- Publication Date
- 2026-04-03
AI Technical Summary
Existing biochemical reactions, particularly in vitro and in vivo settings, face inefficiencies due to the need for cofactors like macromolecule crowding agents, which can have drawbacks, and there is a need for alternative means to enhance reaction efficiency without relying on exogenous crowding agents.
The introduction of intrinsically disordered region (IDR) macromolecules or polypeptides into the reaction system, inducing liquid-liquid demixing and forming phase-separated aqueous compartments, enhanced by polyvalent metal ions and ATP, to colocalize reaction molecules for increased efficiency.
This approach significantly enhances the efficiency of biochemical reactions by promoting molecular colocalization and phase separation, outperforming reactions without IDRs and reducing the need for exogenous crowding agents.
Smart Images

Figure 0007840266000052 
Figure 0007840266000053 
Figure 0007840266000054
Abstract
Description
[Technical Field]
[0001] The present invention relates to a method for carrying out biochemical reactions in an aqueous in vitro reaction system. This method comprises a macromolecule, particularly a polypeptide, containing one or more functionally intrinsically disordered regions (IDRs). The present invention also relates to IDR-macromolecules, including IDR-polypeptides, which comprise a macromolecule or polypeptide containing one or more functional IDRs or a tagged amino acid sequence derived therefrom. Such functional IDRs can enhance the efficiency of biochemical reactions. The present invention relates to a kit comprising any such macromolecule and polypeptide. The present invention further relates to a method for providing reagents that can stimulate or enhance liquid-liquid demixing in solution, thereby increasing the efficiency of biochemical reactions, using any such macromolecule and polypeptide, including combinations with polyvalent metal ions. [Background technology]
[0002] The performance of biochemical reactions, particularly in vitro biochemical reactions, is fundamentally important in biological sciences. Many biochemical reactions may need to be performed outside the laboratory, for example, at a point of care or in the field. In these situations, it may be impossible to control biochemical reactions in the precise manner provided by the laboratory environment. Improving the efficiency of biochemical reactions performed in these situations would be valuable. In fact, it is sometimes desirable to increase the efficiency of biochemical reactions regardless of the precise setting, including in vitro and in vivo biochemical reactions. This invention addresses these problems.
[0003] Many biochemical reactions require the use of cofactors to help increase their efficiency. One specific example of such cofactors is macromolecule crowding agents. Crowding agents are essential for carrying out many biochemical reactions. A notable example is the recombinase polymerase amplification (RPA) system for amplifying nucleic acids. The use of crowding agents has been considered essential for increasing the efficiency of RPA. However, crowding agents can have drawbacks. Therefore, alternative means for increasing the efficiency of biochemical reactions, including RPA, and alternative means for eliminating the need for added / exogenous crowding agents would be useful. Furthermore, reagents that add to or synergistically interact with the functional effects of crowding agents would be useful in increasing the efficiency of biochemical reactions. This invention also addresses these issues. [Overview of the Initiative]
[0004] The present invention provides a method for carrying out a biochemical reaction in an aqueous in vitro reaction system, wherein the biochemical reaction depends on the function of at least one reaction macromolecule, optionally at least one reaction polypeptide, and the method comprises introducing at least one IDR macromolecule into the in vitro reaction system under conditions suitable for carrying out the reaction, wherein the at least one IDR macromolecule comprises one or more functionally intrinsically disordered regions (IDRs), and the introduction of at least one IDR macromolecule into the in vitro reaction system enhances the efficiency of the biochemical reaction, preferably the at least one IDR macromolecule is at least one type of IDR polypeptide.
[0005] In the above method, the biochemical reaction may depend on the function of at least one IDR macromolecule, and optionally at least one IDR polypeptide. When introduced into the in vitro reaction system, at least one IDR macromolecule or at least one IDR polypeptide performs its reaction function in the biochemical reaction, thereby increasing the efficiency of the reaction.
[0006] Any of the methods described herein may further include maintaining an IDR macromolecule or IDR polypeptide in the system to induce liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments in the system by the IDR macromolecule or IDR polypeptide, thereby increasing the efficiency of the biochemical reaction in the system.
[0007] Any of the methods described herein may further include maintaining IDR macromolecules or IDR polypeptides in the system to colocalize the molecules necessary for carrying out the reaction with IDR macromolecules or IDR polypeptides in multiple phase-separated aqueous compartments, or to further stimulate or enhance the colocalization of molecules necessary for carrying out the reaction with IDR macromolecules or IDR polypeptides in multiple phase-separated aqueous compartments, thereby increasing the efficiency of the biochemical reaction in the system.
[0008] In any of the methods described herein, the multiple phase-separated aqueous compartments may be multiple detectable phase-separated aqueous particles.
[0009] In a further embodiment, the present invention provides a method for carrying out a biochemical reaction in an aqueous in vitro reaction system, wherein the biochemical reaction depends on the function of at least one reaction macromolecule, optionally at least one reaction polypeptide, and the method comprises introducing at least one polypeptide tagged with an amino acid sequence comprising or derived from one or more functionally intrinsically disordered regions (IDRs) (IDR-polypeptides) into an in vitro reaction system under conditions suitable for carrying out the reaction, and maintaining the IDR-polypeptides in the system to cause liquid-liquid demixing and the formation of a plurality of phase-separated aqueous compartments, preferably detectable phase-separated aqueous particles, in order to colocalize molecules necessary for carrying out the reaction with the IDR-polypeptides in the compartments, thereby increasing the efficiency of the biochemical reaction in the system.
[0010] Optionally, in the method according to this additional aspect, the biochemical reaction depends on the function of at least one reaction polypeptide, the reaction polypeptide is at least one IDR-polypeptide, and when introduced into the system, at least one IDR-polypeptide performs its reaction function in the biochemical reaction and enhances the efficiency of the reaction in the system.
[0011] In any of the methods according to this additional aspect, the conditions suitable for performing the reaction may further include providing multivalent metal ions to the IDR-polypeptide, thereby further stimulating or enhancing liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR-polypeptide, thereby further enhancing the efficiency of the biochemical reaction in the system. Optionally, the multivalent metal ions are provided at a concentration of about 22 mM or higher, preferably the multivalent metal ions are provided at a concentration of about 22 mM to 50 mM. The multivalent metal ions may be divalent metal ions, optionally Mg 2+ , Mn 2+ , Ca 2+ , Co 2+ or Ni 2+ , preferably Mg 2+ , Mn 2+ or Ca 2+ , more preferably Mg 2+ may be.
[0012] In any of the methods according to this additional aspect, the conditions suitable for performing the reaction may include providing ATP to the IDR-polypeptide in an in vitro reaction system, thereby further simulating or enhancing liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR-polypeptide, thereby further enhancing the efficiency of the biochemical reaction in the system. ATP is provided in the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0013] In any of these additional embodiments of the method, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR polypeptide, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction, causing them to colocalize with the IDR polypeptide in a plurality of phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, optionally, the polyvalent metal ions are provided at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0014] In any of these additional embodiments of the method, suitable conditions for carrying out the reaction may further include providing ATP to the IDR-polypeptide in an in vitro reaction system to further stimulate or enhance the molecules necessary for carrying out the reaction, thereby colocalizing them with the IDR-polypeptide in a plurality of phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, wherein the ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0015] In any of these additional embodiments of the method, the efficiency of the reaction in the system may be enhanced by the IDR-polypeptide compared to the efficiency of the reaction in the system after the introduction of at least one polypeptide under the same reaction conditions, except that at least one polypeptide contains one or more functional IDRs or is not tagged with an amino acid sequence derived therefrom.
[0016] The present invention also provides a method for carrying out a biochemical reaction in an aqueous in vitro reaction system, wherein the biochemical reaction depends on the function of at least one reaction macromolecule, optionally at least one reaction polypeptide, and the method is i. Introducing a molecule containing at least one IDR macromolecule into a system under conditions suitable for carrying out the reaction, wherein at least one IDR macromolecule contains one or more functionally intrinsically disordered regions (IDRs), preferably at least one IDR macromolecule is at least one IDR polypeptide. ii. Maintaining IDR macromolecules or IDR polypeptides within a system to induce liquid-liquid demixing within the system, wherein the liquid-liquid demixing is caused by the IDR macromolecules or IDR polypeptides, forming and maintaining multiple phase-separated aqueous compartments within the system. iii. Maintaining IDR macromolecules or IDR polypeptides in the system so that the molecules necessary for carrying out the reaction colocalize with the IDR macromolecules or IDR polypeptides within the compartment, iv. A biochemical reaction is carried out within a compartment, wherein the efficiency of the biochemical reaction in the system is enhanced by the presence of at least one IDR macromolecule.
[0017] In the above method, the biochemical reaction may depend on the function of at least one IDR macromolecule and optionally at least one IDR polypeptide. When introduced into the in vitro reaction system, at least one IDR macromolecule or at least one IDR polypeptide performs its reaction function in the biochemical reaction, increasing the efficiency of the reaction. Multiple phase-separated aqueous compartments may be multiple detectable phase-separated aqueous particles.
[0018] In a further embodiment, the present invention provides a method for carrying out a biochemical reaction in an aqueous in vitro reaction system, wherein the biochemical reaction depends on the function of at least one reaction macromolecule, optionally at least one reaction polypeptide, and the method is i. Introducing a molecule containing one or more functionally intrinsically disordered regions (IDRs) (IDR-polypeptides) or at least one polypeptide tagged with an amino acid sequence derived therefrom into the system under conditions suitable for carrying out the reaction, ii. Maintaining IDR-polypeptides in the system to induce liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments, preferably detectable phase-separated aqueous particles, wherein the liquid-liquid demixing is caused by the IDR-polypeptides and maintained. iii. Maintaining the IDR polypeptide in the system so that the molecules necessary for the reaction to carry out colocalize with the IDR polypeptide within the compartment, iv. A biochemical reaction is carried out within a compartment, wherein the efficiency of the biochemical reaction in the system is enhanced by the presence of at least one IDR polypeptide.
[0019] Optionally, in this further embodiment of the method, the biochemical reaction depends on the function of at least one reaction polypeptide, which is at least one IDR-polypeptide, and when introduced into the system, the at least one IDR-polypeptide performs its reaction function in the biochemical reaction, thereby increasing the efficiency of the reaction in the system.
[0020] In any of these further embodiments of the method, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR-polypeptide to further stimulate or enhance liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR-polypeptide, thereby further increasing the efficiency of the biochemical reaction in the system, optionally, the polyvalent metal ions are provided at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0021] In any of these further embodiments of the method, suitable conditions for carrying out the reaction may include providing ATP to the IDR-polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR-polypeptide, thereby further increasing the efficiency of the biochemical reaction in the system, wherein the ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0022] In any of these further embodiments, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR polypeptide, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction, causing them to colocalize with the IDR polypeptide in a plurality of phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, optionally, the polyvalent metal ions are provided at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0023] In any of these further embodiments, suitable conditions for carrying out the reaction may further include providing ATP to an IDR macromolecule or IDR polypeptide in an in vitro reaction system to further stimulate or enhance the molecules necessary for carrying out the reaction, thereby colocalizing them with the IDR polypeptide in a plurality of phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, wherein the ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0024] In any of these further embodiments, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR-polypeptide to further stimulate or enhance the molecules necessary for carrying out the reaction, thereby colocalizing them with IDR-macromolecules or IDR-polypeptides in a plurality of phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, optionally, the polyvalent metal ions are provided at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0025] In any of these further embodiments, the efficiency of the reaction in the system may be enhanced by the IDR-polypeptide compared to the efficiency of the reaction in the system after the introduction of at least one polypeptide under the same reaction conditions, except that at least one polypeptide contains one or more functional IDRs or is not tagged with an amino acid sequence comprising them.
[0026] In any of the above methods, the method may be a biochemical reaction for synthesizing nucleic acid molecules in an in vitro reaction system. (a) To provide at least one nucleic acid primer, (b) Providing a target nucleic acid molecule comprising at least one target strand, wherein at least one nucleic acid primer is brought into contact with the target strand, thereby forming a double-stranded structure, (c) To provide an IDR macromolecule as an IDR polypeptide, wherein the IDR polypeptide is a polymerase or one or more polypeptide cofactors. (d) Proceeding with a reaction that, by means of extending the 3' end of at least one nucleic acid primer using polymerase and dNTPs in the presence of optionally one or more polypeptide cofactors, thereby generating a double-stranded nucleic acid, wherein the first strand contains the sequence of the target strand and the second strand contains a sequence complementary thereto.
[0027] Alternatively, in any of the above methods, the method may be biochemical for amplifying a single-stranded target nucleic acid molecule or a double-stranded target nucleic acid molecule in an in vitro reaction system, preferably the target nucleic acid molecule being a DNA molecule.
[0028] The method may be a biochemical reaction for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system. (a) To provide first and second nucleic acid primers, (b) Providing a double-stranded target nucleic acid molecule comprising a first strand and a second strand, and contacting the first and second nucleic acid primers with the target nucleic acid molecule to form a first double-stranded structure having the first strand and a second double-stranded structure having the second strand, (c) To provide an IDR macromolecule as an IDR polypeptide, wherein the IDR polypeptide is a polymerase or one or more protein cofactors. (d) Allow the reaction to proceed, thereby using polymerase and dNTPs to extend the 3' ends of the first and second nucleic acid primers in the presence of one or more protein cofactors to generate the first and second double-stranded nucleic acids. (e) Repeating steps (b) to (d) until a desired amplification is reached.
[0029] In the above method for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the method may be a recombinase polymerase amplification (RPA) process for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system. (a) To provide a recombinase agent, optionally a recombinase-loaded protein, a single-strand stabilizer, a polymerase, first and second nucleic acid primers, a double-stranded target nucleic acid comprising the first and second strands, and optionally an exonuclease, such as exonuclease III. (b) Contacting the recombinase agent with the first and second nucleic acid primers and optionally with the recombinase-loaded protein to form the first and second nuclear protein primers, which include a single-stranded region at their 3' ends, (c) Contacting the first and second nuclear protein primers with the target nucleic acid molecule to form a first double-stranded structure having a first chain and a second double-stranded structure having a second chain, (d) Allowing the reaction to proceed, thereby extending the 3' ends of the first and second nucleoprotein primers using polymerase and dNTPs to produce the first and second double-stranded nucleic acids and the first and second substituted nucleic acid strands, wherein the single-stranded stabilizer stabilizes and allows the first and second substituted strands to proceed. (e) The reaction is continued by repeating steps (b) to (d) until a desired amplification is reached, A recombinase agent and / or a recombinase-loaded protein and / or a single-chain stabilizer and / or polymerase is provided as an IDR polypeptide.
[0030] In the RPA process described above, which amplifies double-stranded target nucleic acid molecules in an in vitro reaction system, the recombinase agents include UvsX, T4 UvsX, T6 UvsX, RB18 UvsX, E. coli phage wV7 UvsX, Shigella phage CB8 UvsX, Shigella phage Shfl2 UvsX, E. coli phage AR1 UvsX, phage vB_EcoM_G4507 UvsX, Shigella phage SHFML-11 UvsX, and Escherichia phage vB_EcoM_DalCa The recombinase agent is selected from the group consisting of UvsX, E. coli RecA, E. coli RadA, E. coli RadB, E. coli Rad51, or any functional analogues, homologs, or derivatives thereof, and any combination thereof, and preferably UvsX, more preferably Escherichia phage vB_EcoM_DalCa UvsX.
[0031] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the method may include a recombinase-loaded protein, the recombinase-loaded protein being selected from the group consisting of UvsY, E. coli RecO, E. coli RecR, or any functional analogue, homolog, or derivative thereof, and any combination thereof, preferably the recombinase-loaded protein is UvsY, more preferably Escherichia phage STO UvsY.
[0032] In any of the above RPA processes for amplifying double-stranded target nucleic acid molecules in an in vitro reaction system, the polymerase may be a eukaryotic polymerase selected from the group consisting of pol-α, pol-β, pol-δ, pol-ε or any functional analogue, homolog or derivative thereof, and any combination thereof. The polymerase may be Bacillus stearothermophilus polymerase I large fragment, Bacillus subtilis Pol I large fragment (Bsu polymerase), Listeria monocytogenes DNA polymerase I, Staphylococcus aureus DNA polymerase I (saw polymerase), or Escherichia coli DNA polymerase I. The polymerase is a prokaryotic polymerase selected from the group consisting of Klenow fragments, Escherichia coli (E. coli) DNA polymerase I, Escherichia coli (E. coli) DNA polymerase II, Escherichia coli (E. coli) DNA polymerase III, Escherichia coli (E. coli) DNA polymerase IV, Escherichia coli (E. coli) DNA polymerase V, or any functional analogues, homologs or derivatives thereof, and any combination thereof. Preferably, the polymerase is Staphylococcus aureus (S. aureus) DNA polymerase I (saw polymerase) or Bacillus subtilis Pol I large fragment (Bsu polymerase). The polymerase may be a bacteriophage polymerase selected from the group consisting of bacteriophage T4 gp43 DNA polymerase, T7 DNA polymerase and Phi-29 DNA polymerase, or any functional analogues, homologs or derivatives thereof, and any combination thereof.
[0033] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the single-strand stabilizer may be selected from the group consisting of Gp32, Escherichia coli (E. coli) SSB protein, phage T4 Gp32 protein, phage Rb69 Gp32, phage vB_EcoM_NBG1 Gp32, or any functional analogues, homologs, or derivatives thereof, and any combination thereof, preferably the single-strand stabilizer is Gp32 or phage vB_EcoM_NBG1 Gp32.
[0034] In any one of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, only a recombinase agent may be provided as the IDR polypeptide, or only a recombinase-loaded protein may be provided as the IDR polypeptide, or only a single-strand stabilizer may be provided as the IDR polypeptide, or only a polymerase may be provided as the IDR polypeptide, or only an exonuclease may be provided as the IDR polypeptide.
[0035] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, one or more functional IDRs of the IDR-polypeptide may be tagged to the IDR-polypeptide as an amino acid sequence containing or derived from one or more IDRs, such that the IDR-polypeptide is a genetically engineered fusion protein, and one or more functional IDRs are located at the C-terminus of the IDR-polypeptide, the N-terminus of the IDR-polypeptide, or both the C-terminus and N-terminus of the IDR-polypeptide, or at any amino acid position along the length of the polypeptide.
[0036] In any one of the methods described above, one or more functional IDRs of an IDR macromolecule or IDR polypeptide can be characterized as amino acid sequences that score greater than 0.5 when analyzed by the MetaDisorder algorithm.
[0037] In any one of the above methods, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may include or be derived from an amino acid sequence containing one or more repeats of the tripeptide sequence RGG. In any such method, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may include or be derived from an amino acid sequence further containing one or more repeats of the dipeptide sequence FG. In any such method, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may include or be derived from an amino acid sequence further containing at least one aromatic amino acid residue consisting of tyrosine or phenylalanine.
[0038] In any one of the above methods, one or more functional IDRs of an IDR macromolecule or IDR polypeptide are i.(YNPQGGYQQ) n (Sequence code 19), (wherein n is a positive integer between 1 and 10, and n can be any n = 1, 2, or 3), or ii. (YSPTSPS) n (Sequence code 124), (wherein n is a positive integer between 1 and 10, and n can be any n = 1, 2, or 3), or iii. (FSPTSPT) n (Sequence code 125), (wherein n is a positive integer from 1 to 10, and n can be any n = 1, 2, or 3), or iv. (YSPTSP-A / N / G) n (Sequence code 126), (wherein n is a positive integer from 1 to 10, and n can be any n = 1, 2, or 3), or v.(YSPGSPA) n The amino acid sequence (SEQ ID NO: 127), (wherein n is a positive integer from 1 to 10, and n can be any n = 1, 2, or 3) may be included in or derived from this sequence.
[0039] In any one of the above methods, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may contain or be derived from a glutamine-rich amino acid sequence, optionally containing at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 consecutive glutamine residues. In any such method, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may contain or be derived from an amino acid sequence containing one or more repeats of the tripeptide sequence QQQ. In any such method, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may be (QQQPQY) n The formula contains or is derived from the amino acid sequence of (SEQ ID NO: 128), where n is a positive integer between 1 and 10, and n can be any n = 1, 2, or 3.
[0040] In any one of the above methods, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may contain or be derived from the sequence of at least five consecutive amino acids of SEQ ID NO: 1.
[0041] In any one of the above methods, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may contain or be derived from the amino acid sequence of at least five consecutive amino acids of SEQ ID NO: 9.
[0042] In any one of the above methods, one or more functional IDRs of an IDR macromolecule or IDR polypeptide may include an amino acid sequence comprising one or more aromatic tyrosine residues and one or more phenylalanine residues that can participate in aromatic cation-π interactions with polyvalent metal ions, preferably divalent metal ions.
[0043] In any one of the above methods, one or more functional IDRs of the IDR macromolecule or IDR polypeptide may include an amino acid sequence comprising one or more arginine residues that can participate in guanidine-metal interactions with polyvalent metal ions, preferably divalent metal ions.
[0044] In any one of the above methods, the IDR macromolecule or IDR polypeptide may contain or consist of any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or contain or consist of a functional variant amino acid sequence of SEQ ID NOs: 1 to 43, for example, a macromolecule or polypeptide tagged with an amino acid sequence having 80% or more identity with any one of SEQ ID NOs: 1 to 43.
[0045] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the IDR polypeptide may be a single-strand stabilizer having Gp32 and one of the amino acid sequences of SEQ ID NOs. 65 to 88, or the IDR polypeptide may be an IDR polypeptide having an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 65 to 88.
[0046] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the IDR polypeptide is either UvsX and a recombinase agent having one of the amino acid sequences of SEQ ID NOs. 44-59, or the IDR polypeptide is an IDR polypeptide having an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 44-59.
[0047] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the IDR polypeptide is UvsY and may be a recombinase-loaded protein having one of the amino acid sequences of SEQ ID NOs. 60-64, or the IDR polypeptide may have an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 60-64.
[0048] In any one of the above methods, the method may further include providing a polyvalent metal ion to an IDR macromolecule or IDR polypeptide in an in vitro reaction system, thereby further stimulating or enhancing liquid-liquid demixing in the in vitro reaction system, thereby further increasing the efficiency of the biochemical reaction in the system, the polyvalent metal ion further stimulating or enhancing the formation of multiple phase-separated aqueous compartments in the system, thereby further increasing the efficiency of the biochemical reaction in the system, preferably the polyvalent metal ion further stimulating or enhancing the formation of multiple detectable phase-separated aqueous particles, optionally the polyvalent metal ion is provided at a concentration of about 22 mM or higher, preferably the polyvalent metal ion is provided at a concentration of about 22 mM to 50 mM. In any such method, the polyvalent metal ion is a divalent metal ion, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ It is possible.
[0049] In any one of the above methods, suitable conditions for carrying out the reaction may further include providing ATP to the IDR macromolecule or IDR polypeptide in the in vitro reaction system, thereby further stimulating or enhancing the liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR macromolecule or IDR polypeptide, thereby further increasing the efficiency of the biochemical reaction in the system, wherein the ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0050] In any one of the above methods, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR-polypeptide, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction, causing them to colocalize with IDR-macromolecules or IDR-polypeptides in multiple phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, optionally providing the polyvalent metal ions at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0051] In any one of the above methods, suitable conditions for carrying out the reaction may further include providing ATP to an IDR macromolecule or IDR polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction and colocalizing them with the IDR polypeptide in multiple phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, wherein ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0052] In any one of the above methods, the biochemical reaction may be carried out in a solid-phase reaction system including a surface. In any such method, the biochemical reaction may be a method for amplifying a single-stranded or double-stranded target nucleic acid molecule in the above in vitro reaction system, wherein at least one nucleic acid primer and / or an IDR macromolecule and / or one or more polypeptide cofactors are bound to the surface.
[0053] In any of the above RPA processes for amplifying a double-stranded target nucleic acid molecule in an in vitro reaction system, the reaction may be carried out in a solid-phase reaction system including a surface, wherein a recombinase agent and / or a recombinase-loaded protein and / or a single-strand stabilizer and / or polymerase and / or exonuclease and / or a first nucleic acid primer and / or a second nucleic acid primer are bound to the surface, preferably (i) the first nucleic acid primer or the second nucleic acid primer is bound to the surface, or (ii) both the first and second nucleic acid primers are bound to the surface.
[0054] In any of the above methods carried out in a solid-phase reaction system including a surface, the surface may be planar or microbeads, preferably comprising a polymer material such as silicon, glass, a gel-based material and / or polystyrene, and more preferably comprising microbeads comprising a polymer material such as polystyrene. In any such method, the surface may be bonded to a substrate, preferably the surface is planar and / or the substrate comprises glass. The surface, e.g., a flat surface and / or the substrate, may be provided as a flow cell.
[0055] The present invention provides a method for carrying out biochemical reactions in cultured host cells by introducing at least one of the above-mentioned IDR macromolecules or at least one of the above-mentioned IDR polypeptides into cultured host cells, or by expressing at least one of the above-mentioned IDR polypeptides in cultured host cells, in order to increase the efficiency of biochemical reactions in cultured host cells.
[0056] Any of the above methods for performing in vitro biochemical reactions may include biochemical reactions that occur in cultured cells, such as by introducing at least one IDR macromolecule or at least one IDR polypeptide into cultured host cells, or by expressing at least one IDR polypeptide in cultured host cells, in order to increase the efficiency of the biochemical reactions in the cultured host cells.
[0057] A biochemical reaction can be any reaction that results in the manipulation of nucleic acid molecules within a cultured host cell, or a change in nucleic acid molecules within a cultured host cell, such as a change in the structure of a nucleic acid molecule, such as a change in the nucleotide sequence of a nucleic acid molecule. A biochemical reaction can be any reaction that results in the synthesis of nucleic acid molecules within a cultured host cell. A biochemical reaction can be any reaction that results in the expression of polypeptides from nucleic acid molecules. A biochemical reaction may also be any reaction that results in the editing of nucleic acid sequences within a cultured host cell, for example, IDR polypeptides are CRISPR polypeptides such as Cas polypeptides containing Cas9 polypeptide. A biochemical reaction can be any reaction that results in the cleavage of nucleic acids within a cultured host cell. A biochemical reaction can be any reaction that results in homologous recombination of nucleic acids within a cultured host cell. A biochemical reaction can be a metabolic reaction within a cultured host cell that produces one or more biological products of interest within the cultured host cell, or that produces one or more biological products of interest that are secreted from the cultured host cell or otherwise released from the cultured host cell into the culture medium.
[0058] In any one of the above methods, increasing the efficiency of a biochemical reaction may involve increasing the efficiency of a reaction using at least one IDR macromolecule or at least one IDR polypeptide compared to the efficiency of a reaction carried out under the same conditions, provided that the at least one macromolecule or at least one polypeptide does not contain or is not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the reaction is carried out in the absence of exogenously added crowding agents.
[0059] In any of the above RPA processes, increasing or enhancing the efficiency or performance of the RPA biochemical reaction may include increasing the amount of amplified product obtained in an RPA reaction using at least one IDR polypeptide compared to the amount of amplified product obtained by carrying out the reaction under the same conditions, provided that the at least one polypeptide in question is not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the reaction is carried out in the absence of exogenously added crowding agents.
[0060] In any of the above methods, which involves introducing at least one IDR macromolecule or IDR polypeptide into an in vitro reaction system, the efficiency of the reaction in the system is enhanced by the IDR macromolecule or IDR polypeptide compared to the efficiency of the reaction in the system after the introduction of at least one macromolecule or polypeptide under the same reaction conditions, except that the at least one macromolecule or polypeptide does not contain one or more functionally intrinsically disordered regions (IDRs).
[0061] In any of the above methods, which involves introducing at least one polypeptide (IDR-polypeptide) tagged with an amino acid sequence comprising at least one functionally intrinsically disordered region (IDR) into an in vitro reaction system, the efficiency of the reaction in the system is enhanced by the IDR-polypeptide compared to the efficiency of the reaction in the system after the introduction of at least one polypeptide under the same reaction conditions, except that the at least one polypeptide does not contain one or more functional IDRs or tagged with an amino acid sequence comprising one or more IDRs.
[0062] The present invention also provides non-synthetic IDR macromolecules comprising macromolecules and tagged amino acid sequences, wherein the tagged amino acid sequence comprises or comprises one or more functionally intrinsically disordered regions (IDRs), and the IDR macromolecules can induce liquid-liquid demixing in aqueous in vitro reaction systems. Any such IDR macromolecule can induce liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments in the system, preferably multiple detectable phase-separated aqueous particles. Any such liquid-liquid demixing induced by any such non-synthetic IDR macromolecule in an in vitro reaction system can thereby increase the efficiency of biochemical reactions.
[0063] Any one of the above IDR macromolecules may be a non-naturally occurring, artificial, or genetically modified IDR macromolecule or IDR polypeptide comprising a macromolecule or polypeptide and a tag amino acid sequence. In the case of an IDR polypeptide, the tag amino acid sequence may be located at the C-terminus of the polypeptide, the N-terminus of the polypeptide, or both the C-terminus and N-terminus of the polypeptide, or at any amino acid position along the length of the polypeptide.
[0064] In either of the above IDR macromolecules or IDR polypeptides, one or more functional IDRs in the tag amino acid sequence are functional IDRs as described in any of the above methods.
[0065] In either of the above IDR macromolecules or IDR polypeptides, the tag sequence is a polyvalent metal cation, preferably a divalent metal cation, more preferably Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Ions, and more preferably Mg 2+ Mn 2+ or Ca 2+ , and more preferably Mg 2+ It contains amino acid residues that can be involved in aromatic cation-π interactions.
[0066] In any of the above IDR macromolecules or IDR polypeptides, the IDR macromolecule or IDR polypeptide contains or comprises one of the amino acid sequences of SEQ ID NOs: 1 to 43, or contains or comprises a macromolecule or polypeptide tagged with an amino acid sequence having 80% or more identity with one of SEQ ID NOs: 1 to 43, or a functional variant amino acid sequence of SEQ ID NOs: 1 to 43.
[0067] In any of the above IDR-polypeptides, a polypeptide tagged with a sequence containing or derived from one or more functional IDRs may be an enzyme, such as a helicase, gyrase, recombinase, such as an RPA recombinase agent, a nuclease, such as an exonuclease and endonuclease, a ligase, a glycolyase, a methylase, a methyltransferase, a glucosyltransferase, a polymerase, a kinase, a phosphatase, or a gene editing enzyme such as a Cas9 enzyme; or a cofactor, such as an RPA recombinase loading protein and an RPA single-chain stabilizer. A polypeptide tagged with a sequence containing or derived from one or more functional IDRs may be a ligase, optionally an RB69 ligase, such as RB69 ligase-His2 (SEQ ID NO: 112). A polypeptide tagged with a sequence containing one or more functional IDRs, or a sequence derived therefrom, may be an RPA single-chain stabilizer, preferably Gp32, and optionally the IDR polypeptide may have one of the amino acid sequences of SEQ ID NOs. 65-88 and SEQ ID NO. 120, or the IDR polypeptide may have an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 65-88 and SEQ ID NO. 120. A polypeptide tagged with a sequence containing one or more functional IDRs, or a sequence derived therefrom, may be an RPA recombinase agent, preferably UvsX, and optionally the IDR polypeptide may have one of the amino acid sequences of SEQ ID NOs. 44-59, or the IDR polypeptide may have an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 44-59. A polypeptide tagged with a sequence containing one or more functional IDRs, or a sequence consisting of one or more functional IDRs, may be an RPA recombinase-loaded protein, preferably UvsY, and optionally, the IDR polypeptide may have one of the amino acid sequences of SEQ ID NOs. 60 to 64, or the IDR polypeptide may have an amino acid sequence that is 80% or more identical to its functional variant, for example, one of SEQ ID NOs. 60 to 64.
[0068] The present invention also provides an isolated nucleic acid molecule comprising a first nucleic acid sequence encoding any of the above-described IDR polypeptides, and optionally comprising a second nucleic acid sequence encoding a promoter, wherein the first nucleic acid sequence is operably ligated to the second nucleic acid sequence. The present invention also provides a recombinant polynucleotide expression vector comprising any such nucleic acid molecule. The present invention also provides a host cell comprising any such nucleic acid molecule or any such recombinant polynucleotide expression vector. The present invention also provides a growth medium and a cell culture comprising any population of such host cells.
[0069] The present invention also provides a kit comprising either a non-naturally derived IDR macromolecule or IDR polypeptide as described above. Any such kit may further comprise additional RPA components comprising an RPA recombinase agent and / or an RPA recombinase-loaded protein and / or a polymerase and / or first and second nucleic acid primers and / or an exonuclease and / or a buffer and / or a polyvalent metal ion source, preferably a divalent metal cation. In any such kit, all components may be provided in lyophilized form.
[0070] The present invention also provides a method for stimulating or enhancing liquid-liquid demixing in a solution, the method comprising providing a solution containing any of the above IDR macromolecules or any of the above IDR polypeptides, and contacting the IDR macromolecule or IDR polypeptide in the solution with a polyvalent metal ion, wherein the liquid-liquid demixing in the solution is then stimulated or enhanced. The present invention also provides a further method for stimulating or enhancing liquid-liquid demixing caused by an IDR macromolecule or IDR polypeptide in an aqueous in vitro reaction system, the method comprising providing any one of the above IDR macromolecules or any one of the above IDR polypeptides to the system, providing a polyvalent metal ion to the system, and enabling the IDR macromolecule or IDR polypeptide to contact the polyvalent metal ion, wherein the liquid-liquid demixing caused by an IDR macromolecule or IDR polypeptide in the solution is then stimulated or enhanced. In any such method, the liquid-liquid demixing may result in the formation of a plurality of phase-separated aqueous compartments in the solution, preferably a plurality of detectable phase-separated aqueous particles. In any such manner, polyvalent metal ions are divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ This is possible. In any such further way, polyvalent metal ions may be involved in aromatic cation-π interactions with amino acid residues in one or more functional IDR amino acid sequences, thereby promoting liquid-liquid demixing.
[0071] In any such further method, conditions suitable for performing the reaction may further include providing ATP to the IDR-macromolecule or IDR-polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the liquid-liquid demixing and formation of multiple phase-separated aqueous compartments caused by the IDR-macromolecule or IDR-polypeptide, thereby further increasing the efficiency of biochemical reactions within the system. ATP is provided to the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0072] In any such further method, conditions suitable for performing the reaction may further include providing a multivalent metal ion to the IDR-polypeptide, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction and co-localizing with the IDR-macromolecule or IDR-polypeptide within multiple phase-separated aqueous compartments, thereby further increasing the efficiency of biochemical reactions within the system. Optionally, the multivalent metal ion is provided at a concentration of about 22 mM or higher; preferably, the multivalent metal ion is provided at a concentration of about 22 mM to 50 mM. The multivalent metal ion may be a divalent metal ion, optionally Mg 2+ 、Mn 2+ 、Ca 2+ 、Co 2+ or Ni 2+ 、preferably Mg 2+ 、Mn 2+ or Ca 2+ 、more preferably Mg 2+ and may be.
[0073] In any such further method, conditions suitable for performing the reaction may further include providing ATP to the IDR-macromolecule or IDR-polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction and co-localizing with the IDR-polypeptide within multiple phase-separated aqueous compartments, thereby further increasing the efficiency of biochemical reactions within the system. ATP is provided to the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0074] The present invention also provides for the use of polyvalent metal ions in stimulating or enhancing liquid-liquid demixing in a solution, wherein the demixing is mediated by any one of the IDR-macromolecules or any one of the IDR-polypeptides. The present invention also provides for the use of polyvalent metal ions in stimulating or enhancing liquid-liquid demixing in an aqueous in vitro reaction system caused by an IDR-macromolecule or IDR-polypeptide introduced into the system, wherein the IDR-macromolecule or IDR-polypeptide is any one of the above IDR-macromolecules or any one of the above IDR-polypeptides. In any such use, the liquid-liquid demixing can result in the formation of multiple phase-separated aqueous compartments, preferably multiple detectable phase-separated aqueous particles in the solution, caused by the IDR-macromolecule or IDR-polypeptide. In any such use, the polyvalent metal ions can be divalent metal ions, optionally Mg 2+ , Mn 2+ , Ca 2+ , Co 2+ or Ni 2+ , preferably Mg 2+ , Mn 2+ or Ca 2+ , more preferably Mg 2+ . In any such use, the polyvalent metal ions can be involved in aromatic cation-π interactions with amino acid residues in one or more functional IDR amino acid sequences, thereby promoting liquid-liquid demixing.
[0075] In any such use, conditions suitable for performing the reaction may further include providing ATP to the IDR-macromolecule or IDR-polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments caused by the IDR-macromolecule or IDR-polypeptide, thereby further increasing the efficiency of biochemical reactions within the system, and the ATP is provided in the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0076] In any such use, suitable conditions for carrying out the reaction may further include providing polyvalent metal ions to the IDR-polypeptide, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction, causing them to colocalize with the IDR-macromolecule or IDR-polypeptide in multiple phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, optionally, the polyvalent metal ions are provided at a concentration of about 22 mM or higher, preferably at a concentration of about 22 mM to 50 mM. The polyvalent metal ions may also be divalent metal ions, optionally Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Preferably Mg 2+ Mn 2+ or Ca 2+ , more preferably Mg 2+ That's fine.
[0077] In any such use, suitable conditions for carrying out the reaction may further include providing ATP to an IDR macromolecule or IDR polypeptide in an in vitro reaction system, thereby further stimulating or enhancing the molecules necessary for carrying out the reaction to colocalize with the IDR polypeptide in multiple phase-separated aqueous compartments, thereby further increasing the efficiency of the biochemical reaction in the system, wherein ATP is provided into the system at a concentration of 1 mM to 3.5 mM, optionally 1 mM to 2 mM, preferably 1 mM.
[0078] The present invention also provides any one of the above-mentioned non-naturally derived IDR macromolecules or any one of the above-mentioned IDR polypeptides for use in therapy, as a drug, as a pharmaceutical product, for use in a diagnostic method, or as a diagnostic agent.
[0079] The present invention also provides a method for producing any one of the above-described non-naturally occurring IDR macromolecules or any one of the above-described IDR polypeptides, comprising providing a macromolecule, optionally a polypeptide, and tagging the macromolecule or polypeptide with one or more functional intrinsically disordered region polypeptide sequences. The tagging may be performed by any means described and defined herein. The one or more functional intrinsically disordered region polypeptide sequences may be any of the same as those described and defined herein. The macromolecule or polypeptide may be any suitable macromolecule or polypeptide, including any macromolecule or polypeptide described and defined herein.
[0080] Either of the above-mentioned IDR macromolecules or IDR polypeptides may enhance the efficiency of a biochemical reaction. Enhancing the efficiency of a biochemical reaction may include increasing the efficiency of the reaction using the IDR macromolecule or IDR polypeptide compared to the efficiency of the reaction obtained by carrying out the reaction under the same conditions, provided that the relevant macromolecule or polypeptide does not contain or is not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the reaction is carried out in the absence of exogenously added crowding agents.
[0081] Either the above-mentioned IDR macromolecule or IDR polypeptide may enhance the efficiency of the biochemical reaction in recombinase polymerase amplification (RPA) reactions. Increasing the efficiency or performance of the RPA biochemical reaction may include increasing the amount of amplification product obtained in an RPA reaction using an IDR polypeptide compared to the amount of amplification product obtained by carrying out the reaction under the same conditions, provided that the polypeptide in question does not contain or is not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the RPA reaction is carried out in the absence of exogenously added crowding agents.
[0082] The present invention also relates to a method for determining the nucleotide sequence of one or more target polynucleotide molecules, (i) A step of performing the above method for amplifying one or more target polynucleotide molecules to obtain a population containing multiple copies of one or more target polynucleotide molecules, (ii) A step of performing one or more nucleic acid sequencing reactions on a population containing multiple copies of a target polynucleotide molecule, Preferably, the method provides a method comprising the step of carrying out a solid-phase reaction system including a surface.
[0083] The present invention also provides the use of any one of the above IDR macromolecules or any one of the above IDR polypeptides in a method for determining the nucleotide sequence of one or more target polynucleotide molecules, preferably the method being as described above.
[0084] The present invention also provides polypeptides or isolated polypeptides having 80% or more identity with, for example, any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or any functional variant amino acid sequence of any one of SEQ ID NOs: 1 to 43. Any such polypeptide can be conjugated / tagged to a macromolecule or polypeptide to form an IDR-tagged macromolecule or IDR-tagged polypeptide as further described herein. The tagged macromolecule or polypeptide may be a macromolecule or polypeptide required to carry out a biochemical reaction in an aqueous reaction system. When maintained in an aqueous reaction system under conditions for carrying out a biochemical reaction, any such IDR-tagged macromolecule or IDR-tagged polypeptide can cause liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments in the system, preferably multiple detectable phase-separated aqueous particles, caused by any one of the amino acid sequences of SEQ ID NOs: 1 to 43 or any functional variant thereof, thereby increasing the efficiency of the biochemical reaction in the system. When maintained within an aqueous reaction system under conditions for biochemical reactions, any such IDR-tagged macromolecule or IDR-tagged polypeptide colocalizes the molecules necessary for carrying out the reaction with the IDR-macromolecule or IDR-polypeptide within multiple phase-separated aqueous compartments, thereby increasing the efficiency of the biochemical reaction within the system.
[0085] The aqueous reaction system can be an aqueous in vitro reaction system.
[0086] The present invention also provides isolated nucleic acid molecules comprising a nucleic acid sequence that comprises or consists of any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or a functional variant amino acid sequence of SEQ ID NOs: 1 to 43, for example, a nucleic acid sequence that has 80% or more identity with any one of SEQ ID NOs: 1 to 43.
[0087] The present invention also provides the use of an IDR moiety, which is a polypeptide comprising or derived from one or more functionally intrinsically modified regions (IDRs), in the production of an IDR-tagged macromolecule or IDR-tagged polypeptide, in which the IDR moiety is bound / tagged to a macromolecule or polypeptide, wherein the tagged macromolecule or polypeptide is a macromolecule or polypeptide required to carry out a biochemical reaction in an aqueous reaction system, and when maintained in the aqueous reaction system under conditions for carrying out the biochemical reaction, the IDR-tagged macromolecule or IDR-tagged polypeptide causes liquid-liquid demixing caused by the IDR moiety, resulting in the formation of multiple phase-separated aqueous compartments, preferably multiple detectable phase-separated aqueous particles, thereby increasing the efficiency of the biochemical reaction in the system. When maintained in the aqueous reaction system under conditions for carrying out the biochemical reaction, any such IDR-tagged macromolecule or IDR-tagged polypeptide colocalizes the molecules required to carry out the reaction with the IDR-tagged macromolecule or IDR-tagged polypeptide in multiple phase-separated aqueous compartments, thereby increasing the efficiency of the biochemical reaction in the system.
[0088] Preferably, the IDR portion is bound to / tagged to the polypeptide, thereby producing an IDR-tagged polypeptide, which is preferably produced as a recombinant gene fusion protein.
[0089] Preferably, the IDR portion is a polypeptide containing or derived from any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or a polypeptide containing or derived from any one of the functional variant amino acid sequences of SEQ ID NOs: 1 to 43, for example, having 80% or more identity with any one of SEQ ID NOs: 1 to 43.
[0090] Any of the above IDR-tagged macromolecules or IDR-tagged polypeptides may be defined as non-natural, artificial, or genetically modified macromolecules or polypeptides.
[0091] Any of the above-described IDR-tagged macromolecules or IDR-tagged polypeptides may further possess one or more characteristic properties of any IDR-tagged macromolecules or IDR-tagged polypeptides described herein and defined herein.
[0092] The aqueous reaction system can be an aqueous in vitro reaction system.
[0093] The present invention further provides IDR-tagged macromolecules or IDR-tagged polypeptides obtained according to any of the above uses.
[0094] The present invention also provides a method for producing an IDR-tagged macromolecule or IDR-tagged polypeptide, comprising providing a macromolecule or polypeptide and attaching / tagging an IDR moiety thereto, wherein the IDR moiety is a polypeptide comprising or comprising one or more functionally intrinsically modified regions (IDRs), wherein the tagged macromolecule or polypeptide is a macromolecule or polypeptide necessary for carrying out a biochemical reaction in an aqueous reaction system, and when maintained in the aqueous reaction system under conditions for carrying out the biochemical reaction, the IDR-tagged macromolecule or IDR-tagged polypeptide causes liquid-liquid demixing caused by the IDR moiety, resulting in the formation of multiple phase-separated aqueous compartments, preferably multiple detectable phase-separated aqueous particles, thereby increasing the efficiency of the biochemical reaction in the system. When maintained in the aqueous reaction system under conditions for carrying out the biochemical reaction, any such IDR-tagged macromolecule or IDR-tagged polypeptide colocalizes the molecules necessary for carrying out the reaction with the IDR-tagged macromolecule or IDR-tagged polypeptide in multiple phase-separated aqueous compartments, thereby increasing the efficiency of the biochemical reaction in the system.
[0095] Preferably, the method comprises providing a polypeptide and attaching / tagging an IDR moiety thereto to produce an IDR-tagged polypeptide, which is preferably produced as a recombinant gene fusion protein.
[0096] Preferably, the IDR portion is a polypeptide containing or derived from any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or a polypeptide containing or derived from any one of the functional variant amino acid sequences of SEQ ID NOs: 1 to 43, for example, having 80% or more identity with any one of SEQ ID NOs: 1 to 43.
[0097] Any of the above IDR-tagged macromolecules or IDR-tagged polypeptides may be defined as non-natural, artificial, or genetically modified macromolecules or polypeptides.
[0098] Any of the above-described IDR-tagged macromolecules or IDR-tagged polypeptides may further possess one or more characteristic properties of any IDR-tagged macromolecules or IDR-tagged polypeptides described herein and defined herein.
[0099] The aqueous reaction system can be an aqueous in vitro reaction system.
[0100] The present invention further provides IDR-tagged macromolecules or IDR-tagged polypeptides obtained by any of the above methods. [Brief explanation of the drawing]
[0101] [Figure 1] This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HIS2) at various template nucleic acid concentrations. [Figure 2] This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HIS5) at various template nucleic acid concentrations. [Figure 3] This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HRP1) at various template nucleic acid concentrations. [Figure 4]This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-Sup1) at various template nucleic acid concentrations. [Figure 5] Real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-Sup2) at various template nucleic acid concentrations are shown. The experiments shown in Figures 5A, 5B, 5C, and 5D use Gp32 fusion proteins with one, two, three, and four Sup2 IDR repeats, respectively. [Figure 6] This shows real-time recombinase polymerase amplification traces using an IDR-tagged Gp32 fusion protein (Gp32-HIS5) at various MgOAc concentrations. [Figure 7] This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HIS2) at various phosphocreatine concentrations. [Figure 8] This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HRP1) at various KOAc concentrations. [Figure 9] This shows real-time recombinase polymerase amplification traces using Gp32 tagged with seven histidine residues (for protein purification purposes, i.e., without IDR tagging) compared to an IDR-tagged Gp32 fusion protein (Gp32-Sup1), either in the presence or absence of a crowding agent (PEG). [Figure 10]This study demonstrates the effect of polyvalent metal cations on the promotion of phase separation (particle formation) mediated by IDR amino acid sequence tagging in the absence of crowding agents. IDR amino acid sequences were tagged to the Gp32 protein to create Gp32-HIS2 fusion proteins (Figure 10A), Gp32-HRP1 fusion proteins (Figure 10B), Gp32-Sup1 fusion proteins (Figure 10C), and Gp32-Fib fusion proteins (Figure 10D). In each case, the effects of representative concentrations of divalent metal cations, namely magnesium (MgOAc), manganese (MgCl2), and calcium (CaCl2), were tested. [Figure 11] This study demonstrates the effect of polyvalent metal cations on the promotion of phase separation (particle formation) mediated by IDR amino acid sequence tagging in the absence of crowding agents. IDR amino acid sequences were tagged to Gp32 proteins to create Gp32-Fib fusion proteins (Figure 11A), Gp32-Sup1 fusion proteins (Figure 11B), Gp32-HIS2 fusion proteins (Figure 11C), Gp32-HRP1 fusion proteins (Figure 11D), and Gp32-HIS5 fusion proteins (Figure 11E). In each case, the effects of representative concentrations of divalent metal cations, namely magnesium (MgOAc), manganese (MgCl2), and calcium (CaCl2), were tested. [Figure 12] This study demonstrates the effect of a divalent metal cation, namely magnesium (MgOAc), on its ability to promote phase separation (particle formation) of the IDR-tagged Gp32 fusion protein (Gp32-HRP1) in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent. [Figure 13] This study demonstrates the effect of a divalent metal cation, namely magnesium (MgOAc), on the ability of IDR-tagged Gp32 fusion protein (Gp32-HIS2) to promote phase separation (particle formation) in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent. [Figure 14]In exemplary in vitro biochemical reaction environments in the absence of crowding agents, we demonstrate the effect of various concentrations of divalent metal cations, namely magnesium (MgOAc), on the ability of IDR-tagged Gp32 fusion protein (Gp32-HRP1) to promote phase separation (particle formation). [Figure 15] In exemplary in vitro biochemical reaction environments in the absence of crowding agents, the effects of various concentrations of divalent metal cations, namely magnesium (MgOAc), on the ability of IDR-tagged Gp32 fusion protein (Gp32-HIS2) to promote phase separation (particle formation) are demonstrated. [Figure 16] In an exemplary in vitro biochemical reaction environment in the absence of a crowding agent, we demonstrate the effect of adding a divalent metal cation, namely magnesium (MgOAc), on the ability of the IDR-tagged Gp32 fusion protein (Gp32-HRP1) to promote phase separation. Phase separation is demonstrated by the formation of an opaque solution after the addition of MgOAc due to particle formation (Figure 16A), and particle formation is further demonstrated by particle pelletization (Figure 16B). The RPA protein component has been demonstrated to associate with the particles, as revealed by SDS-PAGE analysis of the pelletized material. [Figure 17] This shows real-time recombinase polymerase amplification traces using a native Gp32 fusion protein, either in the presence or absence of a crowding agent. The experiments reveal that Gp32, which is not tagged with an amino acid sequence containing an intrinsically disordered region (IDR), cannot mediate amplification in the absence of a crowding agent. [Figure 18A] This is a schematic diagram of the reaction system configured for real-time amplification using dual-primer beads. [Figure 18B] This is a schematic diagram illustrating the amplification product in a real-time reaction. [Figure 18C] This is a schematic diagram illustrating the evaluation of amplification characteristics in the endpoint reaction. [Figure 18D]This shows real-time recombinase polymerase amplification traces using IDR-tagged Gp32 fusion protein (Gp32-HIS2) with primers bound to a solid surface or with primers released in solution. [Figure 18E] This shows the endpoint recombinase polymerase amplification trace using an IDR-tagged Gp32 fusion protein (Gp32-HIS2) with primers bound to a solid surface. [Figure 18F] This shows the endpoint recombinase polymerase amplification trace using an IDR-tagged Gp32 fusion protein (Gp32-HIS2) with primers bound to a solid surface. [Figure 19] The following shows fault profiles generated using the MetaDisorder software program for Gp32 (Figure 19A), UvsY (Figure 19B), and UvsX (Figure 19C). [Figure 20] This study demonstrates the effect of various concentrations of divalent metal cations, namely magnesium (MgCl2), on the ability of IDR-tagged RB69 ligase fusion protein (RB69 ligase-HIS2) to promote phase separation (particle formation) in exemplary in vitro biochemical reaction environments in the absence of crowding agents. [Figure 21] This demonstrates the ligase activity of the IDR-tagged RB69 ligase fusion protein (RB69 ligase-HIS2) in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent. [Figure 22] This figure shows the ligase activity performance of IDR-tagged RB69 ligase fusion protein (RB69 ligase-HIS2) in an exemplary in vitro biochemical reaction environment in the absence of crowding agents, compared to untagged RB69 ligase and T4 DNA ligase. [Figure 23] This figure shows the ligase activity performance of IDR-tagged RB69 ligase fusion protein (RB69 ligase-HIS2) in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent, compared to NEBNext Ultra II linked master mix. [Figure 24] This study demonstrates the effect of ATP on the ability of IDR-tagged RB69 ligase fusion protein (RB69 ligase-HIS2) to promote phase separation (particle formation) in an exemplary in vitro biochemical reaction environment in the absence of crowding agents. [Figure 25] The images show bright-field and fluorescence images of representative sections of a FlexWell™ chamber, where 0, 5, 10, 20, 40, or 80 copies of the single-stranded UP1-UP2'-TF1L template were annealed per bead at 50°C for 1 hour, and then amplified by recombinase polymerase amplification using IDR-tagged Gp32 fusion protein (Gp32-Hrp1) with primers conjugated to a solid surface in the absence of a crowding agent such as PEG. Amplification was detected by nicking the amplicon with Nt. Nick extension was performed with BbvCI and aminoallyl-dUTP-XX-ATTO-594. No fluorescence was observed in beads without added template, while fluorescence was observed in beads annealed with gradually increasing amounts of template. This indicates that amplification occurred on the solid surface of the beads in the absence of a crowding agent. [Figure 26A] Bright-field and fluorescence images demonstrating the formation of phase-separated aqueous particles mediated by the IDR-tagged Gp32 fusion protein (Gp32-Hrp1) are shown. [Figure 26B] This plot demonstrates the improved efficiency of the reaction (vacuum cell cleavage rate by Cas12a) during the formation of phase-separated aqueous particles mediated by Gp32-Hrp1. [Modes for carrying out the invention]
[0102] Recombinase polymerase amplification is a technique for amplifying nucleic acid molecules. This system utilizes, among other things, a recombinase enzyme, preferably a recombinase-loaded protein. These protein components form a complex with the amplification primer. After binding to the target nucleic acid molecule to be amplified, the complex "scans" the target molecule and "searches" for complementary regions between the target and primer sequences. Once complementary regions are found, the complex facilitates the binding of the primer to the target sequence. The polymerase enzyme can then extend the primer to produce a copy of the target sequence. The use of a recombinase complex offers a key difference from other nucleic acid amplification methods such as PCR. In RPA, since the recombinase complex provides a completely enzyme-based solution to the primer binding problem, melting and annealing steps driven by thermal cycling are unnecessary. Therefore, RPA is an isothermal technique. The absence of the need for extreme thermal cycling means that RPA has many apparent advantages over techniques such as PCR.
[0103] A well-documented requirement in RPA is the presence of a "crowding agent," also known in the art as a "macromolecular crowding agent." These agents are well-known in the art and have meanings understood in the art. Crowding agents will be discussed in more detail herein. One of the most commonly used crowding agents in RPA is polyethylene glycol (PEG), but other crowding agents can also be used. Prior to the present invention, the use of a crowding agent was considered an essential requirement in RPA.
[0104] The inventors have surprisingly discovered that it is possible to circumvent important requirements previously recognized for crowding agents in the RPA method. This invention is based on this discovery.
[0105] The inventors have surprisingly discovered that by "tagging" macromolecules such as protein components required in the RPA method with amino acid sequences containing or consisting of one or more functional "intrinsically disordered regions" (IDRs), IDR amino acid sequence tags can promote efficient RPA in the complete absence of crowding agents. Thus, the RPA system can achieve efficient amplification without relying on crowding agents, and therefore the complexity of the RPA reaction can be reduced.
[0106] The inventors also surprisingly discovered that the amplification efficiency in the RPA method, including IDR-tagged macromolecular components, in the absence of a crowding agent, can correlate with the functional ability of the IDR amino acid tag sequence to promote liquid-liquid demixing resulting in phase separation in the biochemical reaction system. Phase separation can be evaluated by the formation of phase-separated aqueous compartments, particularly spherical aqueous spheres or phase-separated aqueous particles, in the biochemical reaction environment, which are suitable for detection by standard methods, including microscopic observation, as further described herein.
[0107] Furthermore, the inventors have also surprisingly discovered that the provision of IDR-tagged macromolecular components and crowding agents can provide additive and even synergistic effects with respect to amplification efficiency in the RPA method.
[0108] Furthermore, the inventors have surprisingly discovered that the amplification efficiency in the RPA method, which includes IDR amino acid-tagged macromolecules in the absence of a crowding agent, can correlate with the concentration of polyvalent metal cations introduced into the biochemical reaction environment. Therefore, polyvalent metal cations can further stimulate or enhance liquid-liquid demixing caused by IDR macromolecules or IDR polypeptides, thereby further increasing the reaction efficiency.
[0109] The inventors have also, surprisingly, discovered that certain concentrations of ATP can further stimulate or enhance liquid-liquid demixing caused by IDR macromolecules or IDR polypeptides, thereby further increasing the reaction efficiency, as further described herein.
[0110] Based on these remarkable discoveries, the present invention provides methods and reagents for increasing the efficiency of enzyme-based in vitro biochemical reactions, including RPA reactions, as further described herein.
[0111] The IDR amino acid sequences and IDR reagents described and defined herein have broad applicability as useful reagents applied to any suitable macromolecular component of biochemical reactions such as polypeptides, thereby promoting liquid-liquid demixing and phase separation in biochemical reaction environments without relying on macromolecular crowding agents, particularly when IDR amino acid sequences are used in combination with polyvalent metal cations. The present invention further encompasses the use of polyvalent metal cations, such as divalent metal cations, or any functional equivalent thereof, in promoting IDR amino acid sequence-mediated phase separation in biochemical reaction environments without relying on macromolecular crowding agents.
[0112] Accordingly, the present invention provides IDR-based methods, macromolecules, polypeptides, nucleic acids, vectors, host cells, and uses as described and defined herein.
[0113] The elements of the present invention will be described below in order.
[0114] Biochemical reactions As described above, the inventors have surprisingly discovered that it is possible to avoid the need for crowding agents, which were previously considered essential components of RPA and other reactions. As described in detail herein, this can be achieved by binding / tagging / tagging amino acid sequences containing one or more functionally intrinsically disordered regions (IDRs) to the protein components required for the RPA reaction. The inventors have also surprisingly shown that functionally intrinsically disordered regions bound to ligase enzymes can enhance the efficiency of the ligase reaction. The inventors have shown that the degree of phase separation induced by the IDR amino acid sequence can correlate with the efficiency of the reaction in the absence of crowding agents, e.g., amplification, and can be enhanced by polyvalent metal cations. Based on these surprising observations, it is likely that such IDR amino acid sequences associated with macromolecules or protein components of biochemical reactions can improve the efficiency of the reaction in in vitro or in vivo biochemical reaction environments, particularly in the absence of added / exogenous crowding agents.
[0115] Accordingly, the present invention encompasses the use of any of the IDR amino acid sequences described and defined herein, applicable to any suitable macromolecule or polypeptide component of an in vitro or in vivo biochemical reaction, and thus provides an IDR reagent that can promote liquid-liquid demixing in a biochemical reaction environment and increase the efficiency of the biochemical reaction. Such liquid-liquid demixing in a biochemical reaction environment can result in phase separation of the biochemical reaction environment. Such liquid-liquid demixing in a biochemical reaction environment can result in, induce, or promote phase separation that results in the formation of a phase-separated aqueous compartment containing detectable phase-separated aqueous particles in the biochemical reaction environment, as further described herein. Such IDR reagents or IDR-based reagents described and defined herein may be interchangeably referred to to describe one or more of the following: IDR macromolecules or IDR-tagged macromolecules, or IDR polypeptides or IDR-tagged polypeptides.
[0116] In any one of the methods, processes, or uses described herein, or in any one of the non-naturally derived IDR macromolecules, IDR fusion macromolecules, or isolated nucleic acid molecules encoding them, recombinant polynucleotide expression vectors, or host cells described herein, increasing or enhancing the efficiency or performance of a biochemical reaction may include increasing the efficiency of the reaction using one or more of the IDR-based macromolecules or polypeptides described herein, compared to the efficiency obtained by carrying out the reaction under the same conditions, provided that the macromolecules or polypeptides in question do not contain or are not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the reaction is carried out in the absence of exogenously added crowding agents.
[0117] Improving or enhancing the efficiency or performance of a biochemical reaction should be understood according to generally accepted concepts. For example, the reaction efficiency in an RPA reaction or any other nucleic acid amplification reaction may be understood as providing an equivalent total population of amplicons using a relatively small amount of starting target nucleic acid, or providing a relatively fast detection time or a relatively fast amplification rate using the same amount of starting target nucleic acid.
[0118] Improving or enhancing the efficiency or performance of an RPA biochemical reaction may involve increasing the amount of amplified product obtained in an RPA reaction using one or more IDR-based macromolecules or polypeptides described herein, compared to the amount of amplified product obtained by carrying out the reaction under the same conditions, provided that the relevant macromolecules or polypeptides do not contain or are not tagged with one or more functionally intrinsically disordered region polypeptide sequences, and optionally, the reaction is carried out in the absence of exogenously added crowding agents.
[0119] Improving the efficiency of biochemical reactions in reaction systems, such as in vitro reaction systems, may involve increasing any measurable parameters of the reaction in the system over a specified period, such as the reaction rate over a period, the amount of substrate consumed over a period, or the amount of product produced over a period.
[0120] Improving the efficiency of biochemical reactions in reaction systems, such as in vitro reaction systems, may involve increasing the parameters of the reaction within detectable phase-separated compartments, such as detectable phase-separated aqueous particles. This can be indirectly inferred, for example, by measuring the parameters of the reaction and correlating them with the formation of detectable phase-separated aqueous particles and / or the detectable co-localization and increase of reaction molecules into the detectable phase-separated aqueous particles.
[0121] Simple bioinformatics methods and phase separation assays are described herein that can be used to demonstrate whether any IDR amino acid sequence can function in the required manner to promote liquid-liquid demixing and phase separation in a desired biochemical reaction environment when used with a given macromolecule or protein and contained within a desired in vitro biochemical reaction environment. Furthermore, the compatibility of any given cofactor, in particular polyvalent, such as divalent metal cations, can be demonstrated in these assays in a very simple manner.
[0122] Accordingly, the present invention provides IDR reagents described and defined herein that can be usefully applied to any given desired in vitro or in vivo biochemical reaction environment.
[0123] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out any in vitro or in vivo biochemical reaction, such as any reaction described herein.
[0124] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out nucleic acid synthesis reactions.
[0125] Any of the IDR amino acid sequences described and defined herein can be used with any macromolecule or protein component necessary to carry out nucleic acid synthesis reactions, which synthesize new nucleic acid molecules by extending primer nucleic acid molecules using polymerase.
[0126] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out nucleic acid amplification reactions. Nucleic acid amplification reactions may be reactions involving thermal cycling. Nucleic acid amplification reactions may also be isothermal amplification reactions. Nucleic acid amplification reactions may be polymerase chain reaction (PCR), polymerase spiral reaction (PSR), loop-mediated isothermal amplification (LAMP), nucleic acid sequence-based amplification (NASBA), self-reliant sequence replication (3SR), rolling circle amplification (RCA), strand substitution amplification (SDA), multiple substitution amplification (MDA), ligase chain reaction (LCR), helicase-dependent amplification (HDA), branched amplification (RAM), recombinase polymerase amplification (RPA), transcription-mediated amplification (TMA), or nicking enzyme amplification (NEAR).
[0127] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out a gene editing reaction.
[0128] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component required to carry out a CRISPR reaction.
[0129] Any IDR amino acid sequence described and defined herein may be used with any macromolecule or protein component necessary for carrying out a prime-edit gene editing reaction, and a Cas enzyme, such as a CRISPR enzyme like Cas9, is provided in complex with at least a reverse transcriptase, and optionally further in complex with a prime-edit guide RNA (pegRNA), and any component of the prime-edit complex may be provided tagged with one or more functional intrinsically disordered region (IDR) polypeptide sequences, for example, a CRISPR enzyme tagged with one or more functional IDR polypeptide sequences, or a reverse transcriptase tagged with one or more functional IDR polypeptide sequences.
[0130] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out the linking reaction.
[0131] Any of the IDR amino acid sequences described and defined herein can be used with any macromolecule or protein component necessary for carrying out the exonuclease reaction.
[0132] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out endonuclease reactions, transcription reactions, DNA methylation reactions, DNA glycosylation reactions, antibody-antigen reactions, or drug-targeted reactions.
[0133] Any IDR amino acid sequence described and defined herein can be used with any macromolecule or protein component necessary for carrying out reactions involving protein-protein interactions.
[0134] The methods for carrying out in vitro biochemical reactions used herein are intended to include biochemical reactions carried out directly in solution within a reaction vessel, such as the RPA reaction described further herein.
[0135] The methods for carrying out in vitro biochemical reactions used herein also include biochemical reactions carried out in cultured cells, such as by expressing the IDR reagents described herein in cultured host cells in order to enhance the efficiency of the biochemical reactions within the cultured host cells.
[0136] The methods for carrying out in vitro biochemical reactions used herein include introducing the IDR reagent described herein into cultured host cells or expressing the IDR reagent described herein in cultured host cells to enhance the efficiency of the biochemical reactions within the cultured host cells, wherein the biochemical reactions are any reactions that result in the manipulation of nucleic acid molecules within the cultured host cells, or in the alteration of the structure of nucleic acid molecules, such as changes in the nucleotide sequence of nucleic acid molecules.
[0137] The methods for carrying out in vitro biochemical reactions used herein include biochemical reactions carried out in cultured cells by introducing the IDR reagent described herein into cultured host cells or by expressing the IDR reagent described herein in cultured host cells in order to increase the efficiency of the biochemical reactions within the cultured host cells, wherein the biochemical reactions are any reactions that result in the synthesis of nucleic acid molecules within the cultured host cells.
[0138] The methods for carrying out in vitro biochemical reactions used herein include introducing the IDR reagent described herein into cultured host cells or expressing the IDR reagent described herein in cultured host cells to enhance the efficiency of the biochemical reactions within the cultured host cells, wherein the biochemical reaction is any reaction resulting in the expression of polypeptides from nucleic acid molecules.
[0139] The methods for carrying out in vitro biochemical reactions used herein include introducing the IDR reagent described herein into cultured host cells or expressing the IDR reagent described herein in cultured host cells to enhance the efficiency of the biochemical reactions within the cultured host cells, wherein the biochemical reactions are any reactions resulting in editing of nucleic acid sequences within the cultured host cells (e.g., the IDR polypeptide is a CRISPR polypeptide such as a Cas polypeptide containing a Cas9 polypeptide, or the IDR polypeptide is a polypeptide that forms a complex with a CRISPR polypeptide, for example, the IDR polypeptide being a reverse transcriptase), cleavage of nucleic acids within the cultured host cells, and homologous recombination of nucleic acids within the cultured host cells.
[0140] The methods for carrying out in vitro biochemical reactions used herein include biochemical reactions carried out in cultured cells by introducing the IDR reagent described herein into cultured host cells or by expressing the IDR reagent described herein in cultured host cells in order to enhance the efficiency of biochemical reactions within the cultured host cells, wherein the biochemical reactions are metabolic reactions within cultured host cells for producing one or more biological products of interest within the cultured host cells, or for producing one or more biological products of interest that are secreted from the cultured host cells or otherwise released from the cultured host cells into the culture medium.
[0141] The present invention is also intended to encompass biochemical reactions carried out ex vivo, for example, by expressing the IDR reagents defined herein in cells of tissue cultures or any other suitable complex biological systems developed in vitro. Accordingly, any reference to a method for carrying out a biochemical reaction in an aqueous in vitro reaction system used herein using any of the IDR reagents described herein may be alternatively defined as a method for carrying out a biochemical reaction in an aqueous ex vivo reaction system using any of the IDR reagents described herein.
[0142] The present invention also provides methods, reagents, and techniques for increasing the efficiency of biochemical reactions in vivo. Accordingly, any reference to a method for carrying out a biochemical reaction in an aqueous in vitro reaction system used herein using any of the IDR reagents described herein may be alternatively defined as a method for carrying out a biochemical reaction in an aqueous in vivo reaction system using any of the IDR reagents described herein.
[0143] The present invention provides any non-naturally derived IDR macromolecule or IDR polypeptide described herein or defined herein, for use in therapy, as a therapeutic agent, as a drug, as a pharmaceutical product, or as a diagnostic agent.
[0144] The present invention provides any non-naturally derived IDR macromolecule or IDR polypeptide described or defined herein for use in methods of treating the human or animal body by therapeutic means.
[0145] The present invention provides any non-naturally derived IDR macromolecule or IDR polypeptide described herein or defined herein, for use in diagnostic methods performed on the human or animal body.
[0146] The present invention provides any non-naturally derived IDR macromolecule or IDR polypeptide described herein or defined herein for use in the manufacture of drugs for treating the body of a human or animal by therapeutic means.
[0147] The present invention provides any non-naturally derived IDR macromolecule or IDR polypeptide described herein or defined herein for use in the manufacture of diagnostic agents for diagnostic methods performed on the human or animal body.
[0148] The present invention provides a method for treating a human or animal, comprising administering a therapeutically effective amount of any non-naturally derived IDR macromolecule or IDR polypeptide described or defined herein to a human or animal in need thereof.
[0149] In any of the above methods, reagents, and techniques for increasing the efficiency of biochemical reactions, non-naturally occurring IDR macromolecules or IDR polypeptides can promote liquid-liquid demixing. This liquid-liquid demixing can promote the formation of phase-separated aqueous compartments in the solution, which may contain detectable phase-separated aqueous particles. Thus, the liquid-liquid demixing or the formation of the detectable phase-separated compartments or particles increases the efficiency of biochemical reactions induced by IDR macromolecules or IDR polypeptides.
[0150] Methods for carrying out in vitro biochemical reactions as used herein include any biochemical reaction carried out in vitro in a reaction vessel or in cultured host cells by introducing an IDR reagent described herein into a solution or introducing or expressing an IDR reagent in cultured host cells to promote liquid-liquid demixing in the solution or in cultured host cells. In any such biochemical reaction, liquid-liquid demixing in the solution or in cultured host cells, as described and defined herein, promotes phase separation in the solution or in cultured host cells.
[0151] Any such biochemical reaction may be performed to evaluate the effectiveness of any IDR amino acid sequence described and defined herein in promoting liquid-liquid demixing in solution or cultured host cells and / or promoting phase separation in solution or cultured host cells.
[0152] Any such biochemical reaction may be performed to evaluate the efficacy of a test agent, such as a drug, polypeptide, or any other molecule, preferably in which the test agent interacts with the IDR amino acid sequence, in stimulating or enhancing liquid-liquid demixing mediated by the IDR amino acid sequence in solution or cultured host cells, and / or stimulating or enhancing phase separation mediated by the IDR amino acid sequence in solution or cultured host cells.
[0153] Any such biochemical reaction may be performed to evaluate the efficacy of a test agent, such as a drug, polypeptide, or any other molecule, preferably interacting with the IDR amino acid sequence, in the inhibition of liquid-liquid demixing mediated by the IDR amino acid sequence in solution or cultured host cells and / or the inhibition of phase separation mediated by the IDR amino acid sequence in solution or cultured host cells.
[0154] Any method described herein for carrying out in vitro, in vivo, or ex vivo biochemical reactions may exclude methods for cloning humans.
[0155] Any method described herein for carrying out in vitro, in vivo, or ex vivo biochemical reactions may exclude methods for altering the genetic identity of the human germline.
[0156] Any method described herein for carrying out in vitro, in vivo, or ex vivo biochemical reactions may exclude methods involving the use of human embryos or pluripotent human cells.
[0157] Any host cell described herein may exclude human embryos, or totipotent human cells, or human germline cells.
[0158] While some embodiments of the present invention include in vivo use, other embodiments of the present invention include exclusion of in vivo use. Accordingly, any of the methods, uses, or methods herein for carrying out a biochemical reaction in an aqueous reaction system may exclude an in vivo aqueous reaction system.
[0159] While some embodiments of the present invention include ex vivo use, other embodiments of the present invention include exclusion of ex vivo use. Accordingly, any of the methods, uses, or methods herein for carrying out biochemical reactions in an aqueous reaction system may exclude an ex vivo aqueous reaction system.
[0160] In any of the methods, methods, uses, or IDR reagents described herein, the efficiency of the reaction in system may be enhanced by the IDR macromolecule or IDR polypeptide, compared to the efficiency of the reaction in system after the introduction of at least one macromolecule or polypeptide under the same reaction conditions, except that at least one macromolecule or polypeptide does not contain one or more functionally intrinsically disordered regions (IDRs).
[0161] In any of the methods, methods, uses, or IDR reagents described herein, in which at least one macromolecule or at least one polypeptide is tagged with an amino acid sequence comprising one or more functional intrinsically disordered regions (IDRs) (IDR-tagged macromolecule or IDR-tagged polypeptide), the efficiency of the reaction in the system may be increased by the IDR-tagged macromolecule or IDR-tagged polypeptide, compared to the efficiency of the reaction in the system after the introduction of at least one macromolecule or polypeptide under the same reaction conditions, except that at least one macromolecule or polypeptide is not tagged with an amino acid sequence comprising one or more functional IDRs.
[0162] Therefore, whether an IDR macromolecule or IDR polypeptide, or an IDR-tagged macromolecule or IDR-tagged polypeptide, can enhance the efficiency of a reaction in a system can be very easily demonstrated by comparing the reaction efficiencies of the macromolecule or polypeptide, with or without one or more functional IDRs. Those skilled in the art can perform simple comparative tests to demonstrate the relevant functional capabilities. Exemplary test assays are further described herein.
[0163] Similarly, whether an IDR macromolecule or IDR polypeptide, or an IDR-tagged macromolecule or IDR-tagged polypeptide, can colocalize the molecules necessary for carrying out a reaction with the IDR macromolecule or IDR polypeptide, or an IDR-tagged macromolecule or IDR-tagged polypeptide, in multiple phase-separated aqueous compartments, or whether it can further stimulate or enhance the colocalization of the molecules necessary for carrying out a reaction in multiple phase-separated aqueous compartments, thereby increasing the efficiency of the biochemical reaction in the system, can be demonstrated very simply by comparing colocalization with or without one or more functional IDRs. Again, those skilled in the art can perform simple comparative tests to demonstrate the relevant functional capabilities. Exemplary test assays are further described herein.
[0164] Similarly, whether providing polyvalent metal ions to IDR macromolecules or IDR polypeptides, or to IDR-tagged macromolecules or IDR-tagged polypeptides, further stimulates or enhances liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments, thereby further increasing the efficiency of biochemical reactions in the system, can be very easily demonstrated by comparing liquid-liquid demixing with or without the provision of polyvalent metal ions. Again, those skilled in the art can perform simple comparative tests to demonstrate the relevant functional capabilities. Exemplary test assays are further described herein.
[0165] Similarly, providing ATP to an IDR macromolecule or IDR polypeptide, or an IDR-tagged macromolecule or IDR-tagged polypeptide, may further stimulate or enhance liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments, thereby increasing the efficiency of biochemical reactions in the system. This can be very easily demonstrated by comparing liquid-liquid demixing with or without ATP. Providing ATP to an IDR macromolecule or IDR polypeptide, or an IDR-tagged macromolecule or IDR-tagged polypeptide, may further stimulate or enhance the colocalization of molecules necessary for carrying out reactions in multiple phase-separated aqueous compartments, thereby increasing the efficiency of biochemical reactions in the system. This can also be very easily demonstrated by comparing colocalization with or without ATP. Again, those skilled in the art can perform simple comparative tests to demonstrate the relevant functional capabilities. Exemplary test assays are further described herein.
[0166] By reference to the ability to induce the formation of phase-separated aqueous particles, assays for demonstrating the ability to induce liquid-liquid demixing are described herein (see, for example, “Phase Separation Assay Methods” as described herein). The same assays can be used to demonstrate the ability to induce the co-localization of molecules necessary for the carry out of a reaction within the phase-separated aqueous compartment (particles). By reference to the ability to enhance the efficiency of the RPA method, assays for demonstrating the ability to enhance the efficiency of a reaction are described herein (see, for example, “RPA Assay Methods” as described herein). Such assays can be used to evaluate the ability of an amino acid sequence consisting of or containing one or more functionally intrinsically disordered regions (IDRs) to enhance the efficiency of a reaction, and / or the ability of divalent metal ions to further enhance the efficiency of a reaction, and / or the ability of ATP to further enhance the efficiency of a reaction.
[0167] Using simple assays such as those described herein, a person skilled in the art can determine an improvement in reaction efficiency of 5% or more, which may be 10% or more, 15% or more, 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, or 100% or more.
[0168] Crowding agent Crowding agents are typically macromolecules such as proteins or synthetic block polymers. Crowding agents are considered inherently biochemically inactive, meaning they do not contribute to specific interactions or catalytic activity.
[0169] Crowding agents are widely hypothesized to affect biological / biochemical systems, whether in vitro or in vivo, through their physical occupancy of volume in solution, thus causing steric hindrance and a reduction in available open solvent space. This excluded volume mechanism appears to increase the effective concentration of other macromolecules, particularly influencing changes in dissociation constants and promoting the association of interacting macromolecules, such as multiple proteins, that assemble into specific organizing complexes. The magnitude of the crowding effect depends, in particular, on the molecular weight of the molecules involved, and is generally much stronger with larger molecules. Therefore, macromolecule crowding is generally the effect that large molecules have on the properties of other large molecules.
[0170] Furthermore, it has been widely reported that crowding agents can facilitate the formation of biological / biochemical systems having a preferred phase in which reactants separate themselves into micron-sized phase-separated particles. This effect substantially arises from the volume exclusion effect on the dissociation constant of macromolecular complexes, which become relatively "confined" because they cannot readily diffuse into the bulk solvent, which is largely occupied by volume. Additionally and / or alternatively, some crowding agents, such as block-chain polymers like polyethylene glycol, may exhibit covariant properties that affect the overall structure of bulk water, typically resulting in a decrease in water density. Such changes in bulk solvent properties can also have complex effects on other macromolecules and their aggregates whose surfaces must interact with water. This also facilitates the separation of these other macromolecules into other phases, leading to a significant concentration of biological components and, consequently, depletion of the crowding agent, which primarily occupies the bulk solvent phase.
[0171] In either scenario, the effect of individual or combined crowding agents in stimulating the condensation of macromolecular phases into different condensates, whether by simple volume occupation or solvent modification, appears to act through a "repulsive" rather than "attractive" mechanism from the perspective of the condensate components. In other words, from the perspective of the highly concentrated components of the condensate, the crowding agent acts to create a bulk phase environment that cannot be easily penetrated by diffusion, and / or its bulk solvent properties are modified to exhibit a net enthalpy disadvantage for dispersion. Thus, this specification refers to the effect of high concentrations of crowding agents, typically exceeding 1% w / v, stimulating phase separation by functioning through a "disruptive" or "repulsive" mechanism, only when this phenomenon occurs because the condensate components cannot be easily dispersed as they would be in the absence of the crowding agent. However, at the same time, considering their generally inert properties, for example, crowding agents do not directly and significantly interact with specific molecular side chains, or exert their effects in a direct manner, and therefore have little or no direct weakening effect on other specific molecules in the system.
[0172] In standard RPA reactions, polyethylene glycol (PEG) can significantly influence recombination / DNA synthesis. PEG can affect, for example, the number of entry / extension cycles that occur when RecA combines with Gp32. PEG can stimulate amplification reactions in several different ways. PEG and other similar crowding agents may affect the cooperativity of Gp32 and recombinase, the processing capacity of polymerase, and the hybridization rate and behavior of oligonucleotides in solution. The chain length of polyethylene glycol may affect the results. PEG may also increase the stability of recombinase-loaded filaments, and this improved persistence may enhance the effectiveness of RPA.
[0173] To exert its effect in an in vitro biochemical reaction environment, the added crowding agent is typically present at a concentration where steric exclusion / confinement is expected to occur, typically exceeding approximately 1% by volume or weight of the reactants.
[0174] In a typical RPA reaction, the crowding agent is present at a concentration of approximately 1% to 12% by volume or weight of the reactants.
[0175] The terms “macromolecular crowding agents” or more simply “crowding agents” are very well recognized and understood terms in the art. This is evident from the literature in which these terms are widely used. For example, Kuznetsova, I., M. et al. (Macromolecular Crowding Can Do to a Protein, 2014, Int. J. Mol. Sci., 15, pp 23090-23140) present a review article that claims to cover more than 320 papers and proposes to represent one of the most comprehensive summaries of current knowledge in the field. The term "crowding agent" is used extensively throughout the text to emphasize its ubiquitous use (see also Mixed Macromolecular Crowding: A Protein and Solvent Perspective, Biswas, S. et al., 2018, ACS Omega, 3(4), pp4316-4330 and Common Crowding Agents Have Only a Small Effect on Protein-Protein Interactions, Phillip Y. et al., 2009, Biophysical Journal, 97 pp875-885).
[0176] Compounds or macromolecules can be identified as crowding agents by means known in the art. For example, a crowding agent can be identified by its experimentally determined and calculated hydrodynamic radius (Kuznetsova et al., above). A crowding agent can also be identified by sol-gel glass mounting analysis (Kuznetsova et al., above).
[0177] The following compounds are examples of known crowding agents: synthetic block polymers, polyethylene glycol (PEG), PEG1450, PEG2050, PEG3000, PEG4600, PEG6000, PEG8000, PEG10000, PEG20000, PEG35000, PEG compounds with molecular weights of 15,000-20,000 (also known as Carbowax 20M), dextran, dextran 6, dextran 40, dextran 70, dextran 670, dextrans sulfate 10, dextrans sulfate 500, Ficoll, Ficoll 70, Ficoll 400, poly(4-styrene sulfonate sodium) (PSS), bovine pancreatic trypsin inhibitor (BPTI), ribonuclease A, lysozyme, β-lactoglobulin, hemoglobin, bovine serum albumin (BSA).
[0178] In any one of the methods, processes, and uses of the present invention (including any one of the RPA methods, methods, and uses of the present invention), the methods, processes, and uses may be carried out in the absence of a crowding agent.
[0179] In any one of the methods, processes, and uses of the present invention (including any one of the RPA methods, methods, and uses of the present invention), the methods, processes, and uses may be carried out in the presence of a crowding agent.
[0180] In any one of the methods, processes, and uses of the present invention (including any one of the RPA methods, methods, and uses of the present invention), the methods, processes, and uses may be carried out in the presence of a crowding agent, the crowding agent provided at a concentration that provides an enhanced improvement in the efficiency of the biochemical reaction provided by the IDR macromolecule or IDR polypeptide.
[0181] In any one of the methods, processes, and uses of the present invention (including the RPA method, method, and use of the present invention), the method, process, and use may be carried out in the presence of a crowding agent, the crowding agent provided at a concentration that provides an additional effect on the efficiency of the biochemical reaction provided by the IDR macromolecule or IDR polypeptide.
[0182] In any one of the methods, processes, and uses of the present invention (including any one of the RPA methods, methods, and uses of the present invention), the methods, processes, and uses may be carried out in the presence of a crowding agent, the crowding agent provided at a concentration that provides a synergistic effect on the efficiency of the biochemical reaction provided by the IDR macromolecule or IDR polypeptide.
[0183] In any one of the methods, processes, and uses of the present invention (including any one of the RPA methods, methods, and uses of the present invention), the methods, processes, and uses may be carried out in the presence of a crowding agent, and the introduction of an IDR macromolecule or IDR polypeptide into the biochemical reaction system reduces the concentration of the crowding agent that would be required to achieve the same improvement in the efficiency of the biochemical reaction in the absence of the introduction of the IDR macromolecule or IDR polypeptide into the biochemical reaction system.
[0184] In any of the above methods, processes, and uses that may be carried out in the presence of a crowding agent, the crowding agent may be present at a concentration lower than the concentration at which its normal biological effect (steric exclusion / confinement effect) occurs.
[0185] In any of the above methods, processes, and uses that may be carried out in the presence of a crowding agent, the crowding agent may be present in concentrations of about 3% by volume or weight of the reactants, about 2% by volume or weight of the reactants, about 1% by volume or weight of the reactants, and about 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% by volume or weight of the reactants.
[0186] Any suitable crowding agent may be used when used in any one of the methods, processes, and uses of the present invention, including the RPA reaction method. Examples of suitable crowding agents are provided herein.
[0187] Macromolecules or polypeptides containing intrinsically disordered regions (IDRs) The methods, processes, and reagents of the present invention include an "IDR-macromolecule" containing an "IDR-tagged macromolecule" as described herein. The methods, processes, and reagents of the present invention include an "IDR-polypeptide" containing an "IDR-tagged polypeptide" as described herein. Any such IDR-macromolecule, IDR-tagged macromolecule, IDR-polypeptide, or IDR-tagged polypeptide may be referred to herein interchangeably with IDR reagent or IDR-based reagent.
[0188] As used herein, IDR-macromolecules or IDR-polypeptides or IDR-tagged macromolecules or IDR-tagged polypeptides are any macromolecules, polypeptides, or proteins containing one or more functionally intrinsically disordered regions (IDRs).
[0189] As used herein, IDR-macromolecules or IDR-polypeptides or IDR-tagged macromolecules or IDR-tagged polypeptides are any macromolecules, polypeptides, or proteins comprising one or more functionally intrinsically disordered regions (IDRs) or an amino acid sequence containing such IDRs.
[0190] Therefore, IDR macromolecules or IDR polypeptides may, as referred to herein, consequently refer to macromolecules or polypeptides comprising an amino acid sequence consisting of one or more functionally intrinsically disordered regions, or macromolecules or polypeptides comprising an amino acid sequence containing one or more functionally intrinsically disordered regions.
[0191] Furthermore, an IDR-tagged macromolecule containing one or more functional intrinsically disordered regions (IDRs) may be a macromolecule of interest tagged with an amino acid sequence consisting of or containing one or more functional intrinsically disordered regions (IDRs), as referred to herein. Such an IDR-tagged macromolecule is also an IDR reagent described herein. An IDR-tagged polypeptide containing one or more functional intrinsically disordered regions (IDRs) may be a polypeptide of interest tagged with an amino acid sequence consisting of or containing one or more functional intrinsically disordered regions (IDRs), as referred to herein. Such an IDR-tagged polypeptide is also an IDR reagent described herein.
[0192] An IDR-tagged macromolecule or IDR-tagged polypeptide is any macromolecule, polypeptide, or protein that is “tagged” with an amino acid sequence comprising or containing one or more functional intrinsically disordered regions (IDRs), as used herein.
[0193] Therefore, IDR-tagged macromolecules or IDR-tagged polypeptides may, as referred to herein, refer to macromolecules or polypeptides tagged with an amino acid sequence consisting of one or more functionally intrinsically disordered regions, or to macromolecules or polypeptides tagged with an amino acid sequence containing one or more functionally intrinsically disordered regions.
[0194] A tagged amino acid sequence consisting of or containing one or more functionally intrinsically disordered regions (IDRs) is not naturally or normally found in the macromolecule, polypeptide, or protein tagged at the tagged position. Therefore, a tagged amino acid sequence consisting of or containing one or more functionally intrinsically disordered regions (IDRs) can be considered an exogenous amino acid sequence compared to the macromolecule, polypeptide, or protein tagged with it. Therefore, a tagged macromolecule, polypeptide, or protein can be considered a non-naturally derived, artificial, or genetically modified macromolecule, polypeptide, or protein.
[0195] The mechanisms by which amino acid sequences can be "tagged" onto polypeptides and other macromolecules are further described herein.
[0196] Any one or more functionally intrinsically disordered regions (IDRs), including one or more of the specific IDR amino acid tag sequences disclosed herein, or any one or more functional variants, analogs, homologs, or derivatives thereof, can be tagged to macromolecules, polypeptides, or proteins.
[0197] For use in the present invention, both the intrinsically disordered region polypeptide sequence and its domain must be “functional.” The term “functional” means that any IDR amino acid sequence must possess one of the functional properties further outlined herein.
[0198] The term "intrinsically disordered region" is a technically understood term commonly used in this field. For a comprehensive review, see Classification of Intrinsically Disordered Regions and Proteins, van der Lee et al., 2014, Chem. Rev. 114, pp. 6589-6631.
[0199] The present invention provides, in particular, a method for carrying out a biochemical reaction in an aqueous in vitro reaction system, wherein the biochemical reaction depends on the function of at least one reaction macromolecule, optionally at least one reaction polypeptide, and the method comprises introducing at least one IDR macromolecule into an in vitro reaction system under conditions suitable for carrying out the reaction, wherein the at least one IDR macromolecule comprises one or more functional intrinsically disordered regions (IDRs), and the efficiency of the biochemical reaction is enhanced by the at least one IDR macromolecule upon introduction of the at least one IDR macromolecule into the in vitro reaction system. The efficiency of the biochemical reaction is enhanced by one or more functional IDRs of the IDR macromolecule. In any such method, the at least one IDR macromolecule may be at least one IDR polypeptide. In any such method, the IDR macromolecule or IDR polypeptide comprising one or more functional intrinsically disordered regions (IDRs) may not be a “reaction macromolecule” or “reaction polypeptide” on which the biochemical reaction depends on its function. Therefore, in any such manner, the IDR macromolecule or IDR polypeptide may not have a biochemical role inherent to the biochemical reaction itself. Nevertheless, its introduction into the reaction system leads to an improvement in the efficiency of the biochemical reaction.
[0200] A method for carrying out a biochemical reaction in an in vitro reaction system may be one in which the biochemical reaction depends on the function of at least one IDR macromolecule, and upon its introduction into the in vitro reaction system, at least one IDR macromolecule carries out its reaction function in the biochemical reaction, thereby increasing the efficiency of the reaction. In any such method, at least one IDR macromolecule may be at least one IDR polypeptide. In any such method, the IDR macromolecule or IDR polypeptide has an intrinsic biochemical role in the biochemical reaction itself. Thus, at least one IDR macromolecule or IDR polypeptide containing one or more functional intrinsically disordered regions (IDRs) is a “reaction macromolecule” or “reaction polypeptide” whose function depends on the biochemical reaction.
[0201] At least one IDR macromolecule or IDR polypeptide contains one or more functionally intrinsically disordered regions or an amino acid sequence derived therefrom. The IDR macromolecule or IDR polypeptide is introduced into a biochemical reaction system under conditions suitable for carrying out the biochemical reaction. Due to the presence of one or more functionally intrinsically disordered regions, the IDR macromolecule or IDR polypeptide enhances the efficiency of the reaction.
[0202] By increasing the efficiency of the reaction, it means that the reaction efficiency is improved compared to the reaction efficiency that would be observed if the IDR macromolecule or IDR polypeptide were provided without an amino acid sequence containing or derived from one or more functional intrinsically disordered regions. Such improvement can be readily demonstrated by comparative tests of reaction macromolecules or polypeptides with and without IDR amino acid sequences.
[0203] In any one of the methods of the present invention, one or more functionally intrinsically modified regions of an IDR macromolecule or IDR polypeptide promote / induce liquid-liquid demixing in the reaction system, resulting in phase separation. The functional ability to promote liquid-liquid demixing resulting in phase separation in the reaction system can be readily demonstrated, for example, by performing the phase separation assay described herein. Such liquid-liquid demixing promotes phase separation, which can result in the formation of phase-separated compartments in the reaction system, such as particles detectable under microscopic observation, as will be further detailed herein.
[0204] IDR macromolecules or IDR polypeptides may or may not have catalytic activity. For example, IDR polypeptides may have catalytic activity such as polymerase enzymes used in recombinase polymerase amplification reactions, as further described herein. IDR polypeptides may not have catalytic activity such as single-chain stabilizers used in recombinase polymerase amplification reactions, such as Gp32, as further described herein.
[0205] As further discussed herein, whether or not an IDR-macromolecule or IDR-polypeptide has catalytic activity, the IDR-macromolecule or IDR-polypeptide can have a function that is required for a biochemical reaction or affects the biochemical reaction such that the biochemical reaction cannot proceed or proceeds with reduced efficiency when the IDR-macromolecule or IDR-polypeptide is absent from the biochemical reaction system. Alternatively, as further discussed herein, the IDR-macromolecule or IDR-polypeptide may not have a function that is required for the biochemical reaction itself or affects the biochemical reaction itself. Nevertheless, due to the IDR amino acid sequence, the introduction of an IDR-macromolecule or IDR-polypeptide into a biochemical reaction system results in an improvement in the efficiency of the biochemical reaction as compared to the efficiency observed in the absence of the IDR-macromolecule or IDR-polypeptide or in the presence of the same macromolecule or polypeptide that does not have the IDR amino acid sequence.
[0206] Structural properties of IDR polypeptides The presence of IDRs in an amino acid sequence can be readily determined by structural analysis. A number of bioinformatics-based platforms are available for predicting the presence of IDRs within polypeptides and proteins. These include ELM, MiniMotif, SLiMPrints, phylo-HMM, DiliMot, SLiMFinder, Phospho.ELM, PhosphoSite, PHOSIDA, ScanSite, NetPhorest, NetworKIN, PhosphoNET, IDEAL, MoRFpred, ANCHOR, Pfam, FFPred, DisProt, D 2 P 2 , and MetaDisorder. Any of these methods can be used to identify IDR amino acid sequences. If desired, such IDR amino acid sequences can be tested to evaluate their functional properties as further described herein.
[0207] A preferred bioinformatics-based platform for identifying IDR amino acid sequences is the MetaDisorder software program (MetaDisorder: a metaserver for predicting protein intrinsic disorder, Kozlowski, L.P. et al., BMC Bioinformatics, 2012, 13(1):111).
[0208] The MetaDisorder program is freely available online (http: / / genesilico.pl / metadisorder / ). To use this program, simply paste the amino acid sequence of interest into an Internet browser window, and the program will start. As explained in the online documentation, any amino acid region having a score greater than 0.5 in the software package is considered to contain an intrinsically disordered region.
[0209] Using the MetaDisorder software platform, the inventors identified several amino acid sequences containing one or more intrinsically disordered regions. These are shown in Table 1.
[0210] Thus, in any one of a method, a process, or a use, or in any one of an IDR-macromolecule, an IDR fusion macromolecule, or an isolated nucleic acid molecule encoding the same, a recombinant polynucleotide expression vector, or a host cell that is not of natural origin, one or more functional IDRs of an IDR-macromolecule or an IDR-polypeptide can be characterized as an amino acid sequence having a score greater than 0.5 when analyzed by the algorithm MetaDisorder. The amino acid sequence can be an amino acid sequence that shows a score greater than 0.5 when analyzed by the method of Kozlowski, L.P. et al., BMC Bioinformatics, 2012, 13(1):111 by the MetaDisorder algorithm accordion.
[0211] The present invention provides and relates to preferred IDR amino acid sequences comprising or consisting of any one of the amino acid sequences of SEQ ID NOs: 1 to 43 (Table 1) and its variants. In all cases, the variant of any one of the amino acid sequences of SEQ ID NOs: 1 to 43 is a functional variant that retains the IDR functional properties, as further described herein.
[0212] Furthermore, as further described herein, an IDR macromolecule or IDR polypeptide may include or consist of an amino acid sequence containing or derived from any one of the amino acid sequences of SEQ ID NOs: 1 to 43, or a macromolecule or polypeptide tagged with an amino acid sequence containing or derived from a functional variant amino acid sequence of SEQ ID NOs: 1 to 43.
[0213] Functional variants may have at least 80% sequence identity compared to the IDR amino acid sequences described herein (Table 1). Functional variants may have at least 81% sequence identity, or 82% sequence identity, or 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity compared to the IDR amino acid sequences described herein (Table 1).
[0214] For the purposes of the present invention, in order to determine the percentage of identity between any one amino acid sequence of sequence numbers 1 to 43 and a functional variant of any one amino acid sequence of sequence numbers 1 to 43, the two amino acid sequences are aligned for optimal comparison purposes (for example, a gap can be introduced in the first sequence for optimal alignment with the second sequence). Then, the nucleotide residues at the nucleotide positions are compared. If a position in the first sequence is occupied by the same nucleotide residue as the corresponding position in the second sequence, then the nucleotides are identical at that position. The percentage of identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., identity % = number of identical positions / total number of positions in the reference sequence × 100).
[0215] Typically, sequence comparison is performed over the entire length of the reference sequence. For example, if a person skilled in the art wants to determine whether a given ("variant") sequence is 80% identical to sequence number 2, then sequence number 2 would be the reference sequence. For example, to evaluate whether the variant sequence is at least 80% identical to sequence number 2 (an example of a reference sequence), a person skilled in the art would perform an alignment over the length of sequence number 2 and identify how many positions in the test sequence were identical to the positions in sequence number 2. If at least 80% of the positions are identical, then the test sequence is at least 80% identical to sequence number 2. If the sequence is shorter than sequence number 2, any gaps or missing positions should be considered non-identical positions.
[0216] Those skilled in the art are aware of the different computer programs available for determining homology or identity between two sequences. For example, the comparison of sequences and the determination of the percentage of identity between two sequences can be achieved using mathematical algorithms. The percentage of identity between two amino acid or nucleic acid sequences can be determined, for example, using either the Blosum 62 matrix or the PAM 250 matrix, and gap weights of 16, 14, 12, 10, 8, 6, or 4 and length weights of 1, 2, 3, 4, 5, or 6, using the Needleman and Wunsch (1970) algorithm incorporated into the GAP program in the Accelrys GCG software package (available at http: / / www.accelrys.com / products / gcg / ).
[0217] A functional variant of any one amino acid sequence of SEQ ID NOs. 1 to 43 may differ from any one amino acid sequence of SEQ ID NOs. 1 to 43 by having fewer amino acids (i.e., the functional variant is shorter) or by having more amino acids (i.e., the functional variant is longer) compared to any one amino acid sequence of SEQ ID NOs. 1 to 43. Therefore, a functional variant may contain one or more amino acid deletions and / or one or more insertions compared to the reference amino acid sequence. The number of amino acids in a functional variant amino acid sequence that differs from the reference sequence may be 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, or 20 or more.
[0218] A functional variant of any one of the amino acid sequences of Sequence IDs 1-43 may include, for example, conserved amino acid substitutions of amino acid residues shown in the sequences listed in Table 1. Conservative substitutions can be made, for example, according to the following table which describes generally accepted amino acid groupings. Thus, a functional variant may include conserved amino acid substitutions compared to the reference amino acid sequence. The number of amino acids in a functional variant amino acid sequence that is a conserved amino acid substitution compared to the reference sequence may be 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, 15 or more, 16 or more, 17 or more, 18 or more, 19 or more, or 20 or more. [Table 1]
[0219] Whether a given variant retains IDR functional properties can be easily demonstrated, for example, by the methods further described herein. Table 1 [Table 2-1]
Table 2-2
Table 2-3
Table 2-4
Table 2-5
Table 2-6
Table 2-7
Table 2-8
Table 2-9
Table 2-10
[0220] Similar substitutions can be made in the case of amino acids such as basic, acidic, or polar, etc. Non-homologous substitutions can also occur, i.e., from one class of residues to another class of residues, or alternatively, with the inclusion of non-natural amino acids such as ornithine, diaminobutyric acid ornithine, norleucine ornithine, pyrrolylalanine, thienylalanine, naphthylalanine, and phenylglycine.
[0221] The specific IDR amino acid sequences disclosed herein (see Table 1) can be broadly categorized into four groups. Some IDR sequences can be classified into two or more groups. The RGG / RG group includes IDR sequences that are FG / YG rich. This group includes fib, hnrpnA1, DDX, HRP1, and Sup. The Poly Q group includes IDR sequences that are Q / N rich. This group includes PCF11, Ent-1, HRP1, Sup, His4, His8, and His10. The Poly P group includes sequences that are P rich. This group includes His4, His9, and His10. The Poly H group includes sequences that are H rich. This group includes His1-11. Some important features of IDR amino acid sequences are that they exhibit cation-π and π-π interactions and can form amide and salt bridges. The important features and important intermolecular / intramolecular interactions of preferred IDR amino acid sequences are shown in Tables 2 to 20 below. Table 2 [Table 3] Table 3 [Table 4] Table 4 [Table 5] Table 5 [Table 6] Table 6 [Table 7] Table 7 Table 8 Table 8 Table 9 Table 9 Table 10 Table 10 Table 11 Table 11 Table 12 Table 12 Table 13 Table 13 Table 14 Table 14 Table 15 Table 15 Table 16 Table 16 Table 17 Table 17 [Table 18] Table 18 [Table 19] Table 19 [Table 20] Table 20 [Table 21]
[0222] IDR-Macromolecule or IDR-Polypeptide Functional Characteristics The IDR-tagged macromolecules or polypeptides described herein, or the IDR-macromolecules or IDR-polypeptides, must consist of or have an amino acid sequence containing one or more functional IDRs used in the methods of the present invention. Whether such an IDR amino acid sequence or domain is functional can be verified by common methods, such as those described herein.
[0223] particle formation The inventors have surprisingly discovered that IDR-tagged polypeptides or IDR-polypeptides can form particles in suitable solutions. This is thought to occur through liquid-liquid demixing, which results in fluid phase separation within the solution mixture mediated by the IDR amino acid sequence.
[0224] The formation of particles mediated by the IDR amino acid sequence is further described in the following examples. The particles have a spheroidal appearance and can be described as "small spheres," "spherical foci," or "particles."
[0225] The terms “particle,” “sphere,” or “spherical focus” as used herein are intended to be synonymous and can be used interchangeably. Conditions and methods that enable the observation and detection of particles are described herein, including the following examples.
[0226] In the examples described herein, particle formation was observed to occur in simple systems containing only solutions of IDR-tagged polypeptides and divalent metal cations. Particle formation was also found to occur in more complex mixtures containing the components necessary for RPA, with one of the RPA protein components (Gp32) being IDR-tagged. In these situations, the reactive components were found to co-localize strongly with the particles; for example, the particles were found to be densely packed in oligonucleotides, as detected by a fluorescently labeled probe bound to them, and to contain all other RPA reactive protein components.
[0227] Particle detection and monitoring can be performed using any suitable method, as well as the methods described in the following examples. Illustrative methods include microscopy, light scattering, flow cytometry, and microfluidics.
[0228] The particles can be detected using microscopy, such as differential interference contrast or fluorescence microscopy, and observed directly at high magnification. With the help of a computer, microscopic images can be automatically acquired and analyzed. Furthermore, microscopy can enable continuous or frequent monitoring of at least a portion of a mixture containing the particles.
[0229] Particles can be detected using flow cytometry. In flow cytometry, one or more light beams, for example, each of a single wavelength, are directed towards a hydrodynamically focused flow of fluid. Suspended particles passing through the beam scatter the light, and fluorescent chemicals found within or bound to the particles may be excited. The scattered light and / or fluorescence are analyzed by a detector in the instrument, from which information about particle size and fluorescence can be determined. Modern flow cytometers can analyze thousands of particles per second in "real time" and can actively separate and isolate particles with specific characteristics.
[0230] The particles can be detected using cytometry methods, devices, and systems, such as those disclosed in U.S. Patent Application Publication No. 2009 / 0079963, U.S. Patent Application Publication No. 2010 / 0179068, and International Patent Application Publication No. WO2009 / 112594.
[0231] The particles can be detected using microfluidics, devices, and systems. For example, particles can be detected using a lab-on-a-chip device or system (see, for example, U.S. Patent Application Publication No. 2009 / 0326903 and U.S. Patent Application Publication No. 2009 / 0297733).
[0232] The particles can be between approximately any two sizes selected from a range of about 0.5 to 20 μm, e.g., 0.5, 1, 1.5, 2, 2.5, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 18, and 20 μm (e.g., sizes of about 1 to 10 μm).
[0233] The particle concentration may be approximately 10 to 5000 particles / nl, and can be detected between any two numbers of particles selected from, for example, 10, 20, 50, 100, 200, 500, 1000, 2000, and 5000 particles / nl (e.g., approximately 100 to 500 particles / nl). The particle concentration may be approximately 200 to 400 particles per nanoliter.
[0234] Such phase-separated particles may be smaller than approximately 0.5 μm in size. Phase-separated particles, including those smaller than approximately 0.5 μm, can be detected by a change in the turbidity of the solution. The change in turbidity can be measured by standard means and can typically be quantified according to formazin turbidity units (FTU) or formazin turbidimetry units (FNU). Other methods include size exclusion chromatography, including multi-angle light scattering (SEC-MALS).
[0235] Experimental determination of IDR function The IDR macromolecules or IDR polypeptides described herein, or IDR-tagged macromolecules or IDR-tagged polypeptides, can be determined to have a functional intrinsically disordered region (IDR) amino acid sequence and / or domain thereof, and can therefore be used in the methods and reagents of the present invention, for example, by using the phase separation assay or RPA assay described below.
[0236] Therefore, an IDR macromolecule, IDR polypeptide, or IDR-tagged macromolecule or IDR-tagged polypeptide is a macromolecule or polypeptide that contains, or is tagged with, an amino acid sequence consisting of one or more functional intrinsically disordered regions, or is tagged with an amino acid sequence containing one or more functional intrinsically disordered regions. In all cases, the functional intrinsically disordered region can be determined to be functional in the phase separation assay and / or RPA assay as described below.
[0237] Phase separation assay method Phase separation assay methods are, 1. To tag one or more intrinsically disordered region amino acid sequences in a polypeptide in order to produce an IDR-polypeptide fusion protein, preferably by tagging the recombinant phage vB EcoM NBG1 Gp32 protein in order to produce a Gp32-IDR fusion protein, and to provide a purified IDR-polypeptide fusion protein. 2. Adding the IDR-polypeptide fusion protein to a certain volume of water to a final concentration of 1000 ng / μl, wherein the final volume of the mixture is 50 μl, and preferably adding a divalent metal cation to a final concentration of 2 mM or more, more preferably the divalent metal cation is Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ Therefore, adding, 3. Vortex the mixture, then pulse centrifuge the mixture, 4. Transfer 10 μl of the supernatant of the mixture to a hemocytometer slide. 5. To view the hemocytometer slide at 400x magnification under a microscope, 6. Observe the formation of particles in the mixture, 7. If no particles are present in the mixture, repeat steps 1-6 and gradually increase the concentration of divalent metal cations until the formation of particles in the mixture is observed. The number of particles formed in an enlarged area of 8.218 μm × 175 μm is counted at a magnification of 400x, 9. (i) When 10 or more particles are counted within the enlarged region, preferably 50 or more particles are counted within the enlarged region, more preferably 100 or more particles are counted within the enlarged region, it is demonstrated that an amino acid sequence consisting of or containing one or more intrinsically disordered regions (IDRs) is functional, or (ii) If the concentration of divalent metal cations increases to 100 mM or more and no particles are observed to form within the enlarged region, or if fewer than 10 particles are counted within the enlarged region, it must be demonstrated that the amino acid sequence consisting of or containing one or more intrinsically altered regions (IDRs) is non-functional. This method includes [something].
[0238] In the above method, if it is desirable to investigate the effect of providing divalent metal cations on particle formation, step 2 may include adding divalent metal cations to any desired final concentration. Thus, the effects of different concentrations of divalent metal cations can be investigated.
[0239] In the above method, if it is desirable to investigate the effect of providing ATP on particle formation, step 2 may include adding ATP to any desired final concentration. Thus, the effects of different concentrations of ATP can be investigated. ATP may be provided at concentrations such as 1 mM to 3.5 mM, or 1 mM to 2 mM.
[0240] Step 2 may include adding a detectable nucleic acid molecule, and Step 8 may include counting the number of particles by a detection means. For example, Step 2 may include adding a probe having a nucleic acid sequence set in Sequence ID No. 104 labeled with FAM (fluorescein), and Step 8 may include detecting the particles by fluorescence. The detectable nucleic acid molecule can be added to any suitable final concentration, such as 0.5 μM.
[0241] Therefore, the above assay can be used to investigate reaction efficiency, the ability to induce liquid-liquid demixing, and the ability to colocalize molecules within multiple phase-separated aqueous compartments (particles).
[0242] In the above method, the divalent metal cation is Mg 2+ In this case, the cation source is preferably MgOAc. If the divalent metal cation is Ca 2+ In this case, the cation source is preferably CaCl2. If the divalent metal cation is Mn 2+ In this case, the cation source is preferably MnCl2.
[0243] RPA assay method The RPA assay method is 1. To produce a Gp32-IDR fusion protein, one or more intrinsically disordered region polypeptide sequences are tagged to a Gp32 protein, preferably recombinant phage vB EcoM NBG1 Gp32 protein, and a purified Gp32-IDR fusion protein is provided. 2. To generate a reaction signal that includes the following, a. Tris-HCl pH 8.3, 25 mM b. KOAc, 7.5mM, c. DTT, 1mM, d. ATP, 2.5 mM, e. Phosphocreatine, 20 mM, f. Creatine kinase, 1 μM, g.dNTPs, 1mM, h. Purified Gp32-IDR fusion protein, 20 μM, i. Purified UvsX, 4.8 μM j. Purified UvsY, 8.6 μM k. Staphylococcus aureus DNA polymerase 1 (SAU), 0.135 μM l. Exonuclease III, 0.27 μM m. Forward primer, 0.4 μM n. Reverse primer, 0.4 μM o. Probe, 0.12 μM 3. The recombinase polymerase amplification reaction is initiated by adding 33 mM MgOAc and 10 copies of the template nucleic acid to the reaction mixture. 4. Incubate the reaction mixture at 39°C using a fluorometer while magnetically mixing with bearing balls. 5. (i) If a twofold or greater increase in the amplified product is detectable within 15 minutes by a measurable increase in fluorescence compared to baseline in a template-dependent manner, then it is demonstrated that one or more intrinsically disordered region polypeptide sequences are functional, or (ii) If the amplification product is not detected by fluorescence after 15 minutes, it must be demonstrated that one or more intrinsically disordered region polypeptide sequences are non-functional, This method includes [something].
[0244] In the above method, the forward primer sequence is CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (SEQ ID NO: 98), the reverse primer sequence is CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99), the probe sequence is CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, BHQ is a black hole quencher, and the template is Listeria monocytogenes genomic DNA.
[0245] Alternatively, step 5 of the RPA assay method described above may include demonstrating that one or more intrinsically disordered region polypeptide sequences are functional if a five-fold or greater increase in the amplified product is detectable within 15 minutes by a measurable increase in fluorescence compared to baseline in a template-dependent manner, or if a ten-fold or greater increase is detectable, or if an increase of 20-fold or greater, or 30-fold or greater, or 40-fold or greater, or 50-fold or greater, or 100-fold or greater, or 150-fold or greater, or 200-fold or greater, or 250-fold or greater, or 300-fold or greater, or 350-fold or greater, or 400-fold or greater, or 450-fold or greater, or if an increase of 500-fold or greater, 1000-fold or greater, 2000-fold or greater, 3000-fold or greater, 4000-fold or greater, or 5000-fold or greater is detectable. An increase in amplification product beyond baseline means an increase in amplification product compared to the amount obtained by carrying out the reaction under the same conditions, except that the Gp32 protein is not tagged with one or more intrinsically disordered region polypeptide sequences.
[0246] In the above method, if it is desirable to investigate the effect of providing divalent metal cations on the reaction efficiency, step 3 may include adding divalent metal cations to any desired final concentration. Thus, the effects of different concentrations of divalent metal cations can be investigated.
[0247] In the above method, if it is desirable to investigate the effect of providing ATP on the reaction efficiency, step 2 may include adding ATP to any desired final concentration. Thus, the effects of different concentrations of ATP can be investigated. ATP may be provided at concentrations such as, for example, 1 mM to 3.5 mM, or for example, 1 mM to 2 mM.
[0248] Tagging macromolecules and polypeptides with IDR amino acid sequences The methods, techniques, and reagents of the present invention include, in particular, IDR-tagged macromolecules and IDR-tagged polypeptides, wherein the IDR-tagged macromolecule or IDR-tagged polypeptide is a macromolecule or polypeptide of interest tagged with an amino acid sequence comprising or containing one or more intrinsically disordered regions (IDRs) (which may be referred to herein as IDR moieties).
[0249] The terms “tag” or “tagging” should be understood in their broadest sense. These terms should be understood to mean that an IDR portion, i.e., an amino acid sequence consisting of or containing one or more functional IDRs, is bound, tethered, attached, or otherwise associated with a macromolecule or polypeptide of interest in any appropriate manner.
[0250] The most preferred means of tagging the IDR portion to the target polypeptide is by constructing a recombinant gene fusion protein, in which the target polypeptide is genetically engineered at the nucleotide level so that the expressed protein, upon transcription and translation, contains the target polypeptide along with the IDR portion.
[0251] If desired, a linker may be placed between the target polypeptide and the IDR moiety. For example, flexible, rigid, and cleavable linkers are well known in the art and are widely used in the production of fusion proteins (see, e.g., Fusion Protein Linkers: Property, Design and Functionality, Chen, X., et al. 2013, Adv. Drug Deliv. Rev., 15, 65(10), pp1357-1369).
[0252] Standard methods for gene manipulation, as well as methods for protein expression and purification, are well known in the art (see, for example, Sambrook et al., 2001, Molecular Cloning: a Laboratory Manual, 3rd edition, Cold Spring Harbour Laboratory Press, and Current Protocols in Molecular Biology, Greene Publishing and Wiley-Interscience, New York (1995)).
[0253] Other means by which the IDR portion can be tagged to the target macromolecule or polypeptide are by one or more covalent or affinity interactions.
[0254] The IDR moiety can tag the polypeptide in any suitable orientation, such as at the N-terminus or C-terminus of the polypeptide of interest, or the polypeptide of interest may contain the IDR moiety at both its N-terminus and C-terminus, or at any amino acid position along the length of the polypeptide.
[0255] Peptides / oligopeptides / polypeptides / proteins can be conjugated by binding to / tethering to other macromolecules, including other peptides / oligopeptides / polypeptides / proteins, using methods well known in this art.
[0256] One such method is "click chemistry." The term "click chemistry" is typically used to describe the reaction of an azide with an alkyne that yields a 1,5-disubstituted 1,2,3-triazole in the presence of a copper catalyst. Click chemistry makes it possible to conjugate peptides / oligopeptides / polypeptides / proteins to other peptides / oligopeptides / polypeptides / proteins, as well as a wide range of other macromolecules, including carbohydrates, nucleic acids, polymers, drugs, aptamers, hydrogels, etc. This method is also called "CuAAC" (Cu-catalyzed alkyne azide cycloaddition) (see, for example, "The 'Click' Reaction: A General Toolbox for the Synthesis of Peptide Conjugates," Tang, W. et al., 2014, Chem. Soc. Rev., 43, pp. 7013-7039).
[0257] Many other linker / crosslinking agent chemistry techniques are available to conjugate peptides / oligopeptides / polypeptides / proteins to other macromolecules such as maleimides that react with amines, sulfhydryl reactive groups, or succinimidyl esters (often called NHS esters) that act as crosslinking agents. For example, succinimidyl can be used to form covalent bonds between proteins or peptides and plastic materials.
[0258] Standard chemicals commonly used to create conjugates between polypeptides and non-polypeptide molecules, such as those used to create antibody-drug conjugates, can be used. Many of these techniques are well known in this field.
[0259] Affinity-based interactions can also be used. For example, an amino acid sequence consisting of or containing one or more functionally intrinsically disordered regions can be bound to / tethered to a macromolecule or polypeptide of interest by affinity-based interactions such as streptavidin-biotin or receptor-ligand interactions.
[0260] IDR amino acid sequence function and polyvalent metal cations When an IDR macromolecule or IDR polypeptide described and defined herein is used in an in vitro biochemical reaction, the in vitro biochemical reaction buffer preferably contains a polyvalent metal cation, preferably a divalent metal cation.
[0261] The presence of polyvalent / divalent metal cations in the reaction buffer helps to promote and enhance liquid-liquid demixing, which results in phase separation in an in vitro biochemical reaction environment mediated / induced by IDR macromolecules or IDR polypeptides.
[0262] The functional ability of divalent metal cations to enhance phase separation in in vitro biochemical reaction environments mediated / induced by IDR macromolecules or IDR polypeptides can be readily demonstrated by techniques disclosed and defined herein. In particular, such functional ability can be demonstrated by the ability of polyvalent / divalent metal cations to induce the formation of spherical foci or particles in an IDR-dependent manner in an in vitro biochemical reaction environment, as determined, for example, by the assays described herein, as further described and defined herein.
[0263] The use of divalent metal cations is preferred in promoting / enhancing IDR-dependent liquid-liquid demixing resulting in phase separation. However, any functional equivalent of any polyvalent or divalent metal cation is conceivable. The functional equivalents of polyvalent / divalent metal cations described herein are any agents that can substitute for divalent metal cations in promoting IDR-dependent liquid-liquid demixing resulting in phase separation in an in vitro biochemical reaction environment, as determined, for example, by the assay described herein.
[0264] Any suitable polyvalent / divalent metal cation can be used as a single agent or in combination with other agents, optionally in the presence of a chelating agent, such as ethylenediaminetetraacetic acid (EDTA), ethylene glycol-bis(β-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA), or nitroacetic acid (NTA).
[0265] Divalent metal cations include Mg 2+ Mn 2+ Ca 2+ Co 2+ Ni 2+ or Cu 2+ These cations may be used individually or in combination. Preferably, they are used individually. A preferred divalent metal cation is Mg 2+ Mn 2+ and Ca 2+ That is the case.
[0266] The specific polyvalent / divalent metal cations and their concentrations used to achieve optimal results in facilitating IDR-mediated phase separation in an in vitro biochemical reaction environment may depend on the specific intrinsically disordered region amino acid sequence used to tag the macromolecule or polypeptide of interest. The optimal polyvalent / divalent metal cations and their optimal concentrations can be empirically verified using routine testing. Phase separation assays further described herein may be used for this purpose.
[0267] The preferred concentration ranges for polyvalent / divalent metal cations are approximately 300 μM to 100 mM, 300 μM to 50 mM, 400 μM to 50 mM, 400 μM to 20 mM, 400 μM to 30 mM, 500 μM to 10 mM, 500 μM to 25 mM, and 1 mM to 35 mM.
[0268] The in vitro biochemical reaction buffer is Mg 2+ It may contain ions. The preferred concentration range is about 300 μM to about 100 mM, more preferably about 400 μM to about 50 mM, even more preferably about 500 μM to about 40 mM, and even more preferably about 25 mM to about 35 mM, for example, 33 mM. Preferably, the buffer contains MgOAc at the indicated concentrations.
[0269] In vitro biochemical reaction buffer is Ca 2+It may contain ions. The preferred concentration range is about 300 μM to about 100 mM, more preferably about 400 μM to about 50 mM, even more preferably about 1 mM to about 40 mM, and even more preferably about 25 mM to about 35 mM, for example, 33 mM. Preferably, the buffer contains CaCl2 at the indicated concentrations.
[0270] In vitro biochemical reaction buffer buffer is Mn 2+ It may contain ions. The preferred concentration range is about 300 μM to about 50 mM, more preferably about 400 μM to about 50 mM, even more preferably about 500 μM to about 40 mM, and even more preferably about 25 mM to about 35 mM, for example, 33 mM. Preferably, the buffer contains MnCl2 at the indicated concentrations.
[0271] Recombinase polymerase amplification (RPA) Recombinase polymerase amplification (RPA) is a method for isothermal amplification of nucleic acids. Generally, in the first step of RPA, a recombinase agent is contacted with first and second nucleic acid primers and a recombinase-loaded protein to form first and second nucleoprotein primers. Generally, in the second step, the first and second nucleoprotein primers are contacted with a double-stranded template nucleic acid to form a first double-stranded structure on the first portion of the first strand of the template nucleic acid and a second double-stranded structure on the second portion of the second strand of the template nucleic acid, so that the 3' ends of the first and second nucleic acid primers are oriented toward each other on a given nucleic acid molecule. Generally, in the third step, the 3' ends of the first and second nucleoprotein primers are extended by polymerase to produce first and second double-stranded nucleic acids and first and second substituted single-stranded nucleic acids. Single-strand stabilizers are used to stabilize the first and second substituted single-stranded nucleic acids. In general, the second and third steps can be repeated until the desired amplification is reached.
[0272] The RPA method is widely disclosed, for example, in U.S. Patent Nos. 7,270,981, 7,399,590, 7,666,598, 7,435,561, and International Patent Application Publication WO2010 / 141940. For a more comprehensive recent review, see Review: a comprehensive summary of a decade development of the recombinase polymerase amplification, Li, J. et al., 2019, Analyst, 144, pp31-67).
[0273] Recombinase agent The RPA method, which includes the method of the present invention, uses a recombinase agent.
[0274] Any one or more IDR polypeptides of the present invention can be bound to / tethered to / tagged by any recombinase agent.
[0275] Recombinases are molecules, typically enzymes, that can coat single-stranded nucleic acids, typically DNA (ssDNA), to form nucleoprotein filaments. Such filaments can then "scan" double-stranded nucleic acid molecules, typically DNA (dsDNA), for regions of sequence homology / complementarity. Where complementary sequences are located, the nucleoprotein filament chain (containing the recombinase) penetrates the double-stranded nucleic acid molecule, forming a short hybrid and substitutional strand bubble known as a D-loop.
[0276] Any suitable recombinase agent can be used in the RPA method described herein and can be tagged with any of the IDR amino acid sequences described herein.
[0277] Recombinase agents may be derived from prokaryotes, eukaryotes, or viruses.
[0278] The recombinase agent may be RecA, UvsX, RadA, RadB, Rad51, or any functional variant, analog, homolog, or derivative of any of these proteins.
[0279] Any combination of these proteins can be used.
[0280] Suitable recombinase agents include the E. coli RecA protein, the T4 UvsX protein, or any homologous protein or protein complex from any phylum.
[0281] Eukaryotic RecA homologs are generally named Rad51 after the first member of this group identified. Other non-homologous recombinases, such as RecT or RecO, may be used instead of RecA.
[0282] Exemplary recombinase agents include RecA and UvsX, as well as their fragments or variants and combinations thereof. RecA and UvsX proteins can be obtained from any species. RecA and UvsX fragments or variant proteins can also be produced using available RecA and UvsX proteins and nucleic acid sequences, as well as molecular biology techniques. Exemplary UVsX proteins include those derived from myoviridae phages such as T4, T2, T6, Rb69, Aeh1, KVP40, Acinetobacter phage 133, Aeromonas phage 65, cyanophage P-SSM2, cyanophage PSSM4, cyanophage S-PM2, Rb14, Rb32, Aeromonas phage 25, Vibrio phage nt-1, phi-1, Rb16, Rb43, phage 31, phage 44RR2.81, RB49, phage Rb3, and phage LZ2. Further exemplary recombinase agents include archaeal RADA and RADB proteins, as well as eukaryotic (e.g., plant, mammalian, and fungal) Rad51 proteins (e.g., RAD51, RAD51B, RAD51C, RAD51D, DMC1, XRCC2, XRCC3, and recA).
[0283] The recombinase agents are preferably UvsX, T4 UvsX, T6 UvsX, RB18 UvsX, Escherichia coli phage wV7 UvsX, Shigella phage CB8 UvsX, Shigella phage Shfl2 UvsX, Escherichia coli phage AR1 UvsX, Escherichia phage vB_EcoM_G4507 UvsX, Shigella phage SHFML-11 UvsX, and Escherichia coli phage vB_EcoM_DalCa The recombinase agents are UvsX, E. coli RecA, E. coli RadA, E. coli RadB, E. coli Rad51, or any functional variant, analog, homolog or derivative thereof, or any combination thereof. A particularly preferred recombinase agent is Escherichia phage vB_EcoM_DalCa UvsX.
[0284] Recombinase agents may also contain C-terminal deletions of acidic residues to improve their activity.
[0285] Any functional variant, analogue, homologue, or derivative of the above-described recombinase agents may function as a recombinase agent itself, and these functional variants, analogues, homologues, or derivatives are also intended to be used as recombinase agents in the manner described and defined herein.
[0286] For example, a small peptide derived from RecA has been shown to retain several aspects of RecA's recombinant properties. This peptide contains residues 193–212 of *E. coli* RecA and can mediate single-stranded oligonucleotide pairing.
[0287] The recombinase agent (e.g., UvsX) may be a mutant recombinase agent or a hybrid recombinase agent. Mutant forms of UvsX are described in U.S. Patent No. 8,071,308. A mutant UvsX may be Rb69 UvsX having at least one mutation in the Rb69 UvsX amino acid sequence, the mutation being selected from the group consisting of (a) an amino acid other than histidine at position 64, serine at position 64, the addition of one or more glutamic acid residues at the C-terminus, the addition of one or more aspartic acid residues at the C-terminus, and a combination thereof.
[0288] A mutant UvsX may be a T6 UvsX having at least one mutation in the T6 UvsX amino acid sequence, the mutation being selected from the group consisting of (a) a non-histidine amino acid at position 66, (b) serine at position 66, (c) addition of one or more glutamate residues at the C-terminus, (d) addition of one or more aspartate residues at the C-terminus, and (e) a combination thereof. When a hybrid recombinase agent is used, the hybrid protein may be a UvsX protein containing, for example, at least one region containing an amino acid sequence derived from a different UvsX species. The region may be, for example, the DNA-binding loop-2 region of UvsX.
[0289] If desired, the recombinase agent may be a temperature-sensitive (hereinafter referred to as "ts") recombinase agent. When using a ts recombinase agent, the RPA reaction can be initiated at one temperature (acceptable temperature) and terminated at another temperature (unacceptable temperature). Acceptable temperature combinations may be, for example, 25°C / 30°C, 30°C / 37°C, 37°C / 42°C, etc. The ts protein may be reversible. The activity of a reversible ts protein is restored when transitioning from an unacceptable temperature to an acceptable temperature.
[0290] Any recombinase agent concentration can be used, but preferred recombinase concentrations may be in the range of, for example, 0.2 to 12 μM, 6 to 12 μM, 4 to 12 μM, and 4 to 6 μM, preferably about 5 μM, and more preferably about 4.8 μM.
[0291] Recombinases generally require the presence of ATP, ATPγS, or other nucleoside triphosphates or their analogues. Recombinases are preferably used in a reaction environment where target site regeneration can occur immediately after the D-loop stimulated synthesis round. A completed recombination event with recombinase degradation avoids stalling or highly inefficient linear amplification of ssDNA caused by unilateral vibrational synthesis from one end to the other.
[0292] Table 21 below shows exemplary UvsX recombinase agents tagged with amino acid tag sequences containing intrinsically disordered regions. Table 21 [Table 22-1] [Table 22-2] [Table 22-3] [Table 22-4] [Table 22-5] [Table 22-6] [Table 22-7] [Table 22-8]
[0293] Recombinase-loaded protein The RPA method comprising the present invention may further include / use a recombinase-loaded protein.
[0294] Any suitable recombinase-loaded protein may be used in the RPA method described herein.
[0295] Any one or more IDR polypeptides of the present invention can be bound to / tethered to / tagged to any recombinase-loaded protein.
[0296] Recombinase-loaded proteins may originate from prokaryotes, viruses, or eukaryotes. Examples of recombinase-loaded proteins include *E. coli*RecO, *E. coli*RecR, *UvsY*, and their variants or fragments, or combinations thereof. Exemplary UVsY proteins include those derived from myoviridae phages such as T4, T2, T6, Rb69, Aeh1, KVP40, Acinetobacter phage 133, Aeromonas phage 65, cyanophage P-SSM2, cyanophage PSSM4, cyanophage S-PM2, Rb14, Rb32, Aeromonas phage 25, Vibrio phage nt-1, phi-1, Rb16, Rb43, phage 31, phage 44RR2.8t, Rb49, phage Rb3, and phage LZ2.
[0297] Preferred recombinase-loaded proteins are UvsY, E. coli RecO, E. coli RecR, or any functional variant, analog, homolog, or derivative of any of these proteins. Particularly preferred is the UvsY recombinase-loaded protein Escherichia phage STOUvsY.
[0298] Any combination of these proteins may be used.
[0299] The preferred concentrations of these proteins are 0.1–24 μM, 6–24 μM, 4–24 μM, and 4–12 μM, preferably about 10 μM, and more preferably about 8.6 μM. The recombinase-loaded proteins may be present at a micromolar concentration of about 0.5 to about 2 times that of the recombinase agent.
[0300] Table 22 below shows exemplary UvsY recombinase-loaded proteins tagged with amino acid tag sequences containing intrinsically disordered regions. Table 22 [Table 23]
[0301] Single-chain stabilizer The RPA method, including the method of the present invention, uses a single-strand stabilizer.
[0302] Any suitable single-strand stabilizer (single-strand DNA binding protein) may be used in the RPA method described herein.
[0303] Any one or more IDR polypeptides of the present invention can be bound to / tethered to / tagged with any single-chain stabilizer.
[0304] Single-strand stabilizers are used to stabilize nucleic acids during various exchange reactions that occur in RPA reactions. In particular, single-strand stabilizers are used to stabilize recombinase / ssDNA nucleoprotein filaments.
[0305] Single-strand stabilizers can be derived from or obtained from any species, such as prokaryotes, viruses, or eukaryotes.
[0306] Single-strand stabilizers include single-strand DNA binding proteins derived from Escherichia coli (E. coli), as well as those derived from myoviridae phages such as T4, T2, T6, Rb69, Aeh1, KVP40, Acinetobacter phage 133, Aeromonas phage 65, cyanophage P-SSM2, cyanophage PSSM4, cyanophage S-PM2, Rb14, Rb32, Aeromonas phage 25, Vibrio phage nt-1, phi-1, Rb16, Rb43, phage 31, phage 44RR2.81, Rb49, phage Rb3, and phage LZ2. Further examples of single-strand stabilizers include A. denitrificans Alide_2047, Burkholderia thailandensis BthaB_33951, Prevotella pollens HMPREF 9144_0124, and eukaryotic single-strand DNA binding protein replication protein A.
[0307] Preferred single-strand stabilizers are selected from the group consisting of Gp32, Escherichia coli (E. coli) SSB protein, phage T4 Gp32 protein, phage Rb69 Gp32, phage vB_EcoM_NBG1 Gp32, or derivatives thereof, and any combination thereof. Particularly preferred single-strand stabilizers are Gp32, and especially phage vB_EcoM_NBG1 Gp32.
[0308] Any combination of these proteins may be used.
[0309] One preferred concentration of the single-chain stabilizer is about 5–30 μM, for example, about 8.6 μM, preferably about 15–25 μM, and more preferably about 20 μM.
[0310] Table 23 below shows exemplary Gp32 single-chain stabilizers tagged with amino acid tag sequences that include intrinsically disordered regions. Table 23 [Table 24-1] [Table 24-2] [Table 24-3] [Table 24-4] [Table 24-5] [Table 24-6] [Table 24-7] [Table 24-8] [Table 24-9] [Table 24-10]
[0311] polymerase The RPA method, including the one described in the present invention, uses polymerase.
[0312] Any suitable polymerase can be used in the method described herein.
[0313] Any one or more IDR polypeptides of the present invention can be bound / tethered / tagged to any suitable polymerase.
[0314] DNA polymerase is preferably used for DNA synthesis or amplification.
[0315] One advantage of the RPA reaction is that there are no restrictions on the type of polymerase that can be used. For example, eukaryotic, prokaryotic, and bacteriophage polymerases can be used.
[0316] DNA polymerase can be a eukaryotic polymerase. Examples of eukaryotic polymerases that can be used include pol-α, pol-β, pol-δ, pol-ε or any functional variant, analogue, homolog or derivative thereof, and any combination thereof.
[0317] DNA polymerase can be a prokaryotic polymerase. Examples of prokaryotic polymerases that may be used include Escherichia coli (E. coli) DNA polymerase I Klenow fragment, Escherichia coli (E. coli) DNA polymerase I, Escherichia coli (E. coli) DNA polymerase II, Escherichia coli (E. coli) DNA polymerase III, Escherichia coli (E. coli) DNA polymerase IV, Escherichia coli (E. coli) DNA polymerase V, Bacillus stearothennophilus polymerase I large fragment, Bacillus subtilis Pol I large fragment (Bsu polymerase), Listeria monocytogenes DNA polymerase I, Staphylococcus aureus DNA polymerase 1 (Sau), or any functional variants, analogs, homologs or derivatives thereof, and any combination thereof.
[0318] DNA polymerases can be bacteriophage polymerases. Examples of bacteriophage polymerases that may be used in the methods described herein include Phi-29 DNA polymerase, T7 DNA polymerase, bacteriophage T4 gp43 DNA polymerase, or any functional variants, analogs, homologs or derivatives thereof, and any combination thereof.
[0319] DNA polymerases typically possess strand substitution properties.
[0320] DNA polymerases can catalyze DNA synthesis by using the free 3'-hydroxyl group of the entry strand to incorporate new nucleotides. Some polymerases can catalyze synthesis using the 3'-hydroxyl group of the entry strand, while simultaneously substituting the other strand as synthesis occurs. For example, E. coli polymerase II or III can be used to extend the entry D-loop. Furthermore, E. coli polymerase V, which is commonly used in E. coli SOS lesion target mutations, can be used. All of these polymerases can be made highly processable through β-dimer clamping and interactions and cooperation with single-stranded DNA-binding proteins (SSBs) and other components. Other polymerases from prokaryotes, viruses, and eukaryotes can also be used to extend the entry strand.
[0321] Many DNA polymerases possess 3'-5' exonuclease activity, and some also possess 5'-3' exonuclease activity, which is undesirable in RPA reactions because it gradually leads to the digestion of one DNA strand as the polymerase advances rather than substituting.
[0322] 3'-5' exonucleases have potential advantages and obvious disadvantages. On the one hand, 3'-5' exonuclease activity can increase the fidelity of replication reactions and prevent polymerase stalling at misincorporation sites. High-fidelity amplification is desirable for many DNA applications. 3'-5' exonuclease activity may also be suitable for amplifying larger DNA fragments where stalling due to misincorporation can inhibit effective amplification.
[0323] Despite these obvious advantages of 3'-5' exonuclease activity, there are some drawbacks. Free oligonucleotides can undergo end-dependent degradation when polymerases with 3'-5' exonuclease are used.
[0324] Reaction noise can be reduced by utilizing polymerases lacking 3'-5' exonuclease activity. This suggests that mispriming may be due to oligonucleotides shortened by the polymerase's 3'-5' exonuclease activity. Consequently, 3'-5' exonuclease editing activity, pyrolinization, or any other similar editing activity can be sources of noise. This can be significantly suppressed by using saturated amounts of relatively cooperative Gp32 protein with some polymerases, such as Krenow fragments. Nevertheless, polymerases lacking 3'-5' exonuclease activity for use in the methods described herein may be provided.
[0325] DNA polymerase can be present at concentrations ranging from 10,000 units / ml to 10 units / ml, for example, from 5,000 units / ml to 500 units / ml.
[0326] Supplement RPA reactions, including those of the present invention, may further utilize auxiliary agents.
[0327] Any one or more IDR polypeptides of the present invention can be bound to / tethered to / tagged with any adjutant.
[0328] These adjuvants include single-chain binding proteins, helicases, topoisomerases, resolubilases, and any combination thereof. Such agents may have unwinding, relaxation, and separation activities with respect to nucleic acids, respectively.
[0329] Auxiliaries may also include RuvA, RuvB, RuvC, RecG, PriA, PriB, PriC, DnaT, DnaB, DnaC, DnaG, DnaX clamp loaders, polymerase core complexes, DNA ligases, and sliding clamps, as well as any combination thereof. Sliding clamps may be Escherichia coli (E. coli) β-dimer sliding clamps, eukaryotic PCNA sliding clamps, or T4 sliding clamps gp45, or combinations thereof. Further auxiliaries may include DNA polymerase III holoenzyme complexes consisting of β-Clamp, DnaX Clamp Loader, and Polymerase Core Complex. These latter auxiliaries enable the execution of both preceding and succeeding RPA.
[0330] The RPA reaction can be carried out using one or more additional enzymes that can promote the efficient degradation of the recombinase agent / dsDNA complex after the initiation of DNA synthesis. These enzymes may include those that can stimulate 3'-to-5' degradation and those that can support 5'-to-3' degradation.
[0331] Such additional enzymes include several polymerases that can substitute RecA in the 3'-5' direction and stimulate the 3'-5' degradation of the recombinase agent / dsDNA complex. These DNA polymerases include homologous polymerases of *E. coli* PolV and other species. Amplification efficiency can be improved by including *E. coli* PolV or any functional variant, analog, homolog, or derivative thereof.
[0332] Other enzymes include a class of enzymes called helicases, which can be used to promote the degradation of RecA from dsDNA. These promote degradation in both the 5'-to-3' and 3'-to-5' directions. An ideal helicase complex for stimulating the degradation of RecA from intermediates consists of the E. coli proteins RuvA and RuvB. The RuvAB complex promotes branching movement, dissociating the RecA protein and allowing for the recycling of RecA. Incorporation of RuvAB into the RPA mixture can promote the dissociation of RecA from dsDNA after strand exchange and substitution, enabling the synthesis of a new replication template from the same site. Furthermore, the RuvAB complex can work in conjunction with RuvC to ultimately cleave and degrade Holliday junctions. By adding RuvC to the RPA reaction mixture, complex structures such as Holliday junctions formed at the entry site can be degraded.
[0333] Other enzymes include the E. coli (E. coli) RecG protein, which can stimulate the breakdown of branched structures.
[0334] Other enzymes useful in the RPA reaction mixture are those that enable the continuous generation of RecA nucleoprotein filaments in the presence of ATP and a single-strand stabilizer. Therefore, RecO and RecR, as well as optionally RecF proteins, can be used.
[0335] Exonuclease enzymes are often included in RPA reaction mixtures. They are included for the efficient handling of cleavable probes. An example of a commonly used exonuclease enzyme is exonuclease III. Any of the IDR polypeptides of the present invention can be bound / tethered / tagged to any exonuclease.
[0336] Primer The polymerase-mediated extension (RPA) method uses polymerase to generate copies of a template nucleic acid molecule. Therefore, the RPA method, including the method of the present invention, uses a primer to initiate extension by polymerase.
[0337] Most nucleic acid polymerases require a free 3'-hydroxyl moiety on the terminal sugar of a short stretch of double-stranded nucleic acid adjacent to the new synthesis site for integration. This stretch of double-stranded nucleic acid is typically formed on a template by a short oligonucleotide, which typically has a complementary sequence called a primer, acting as the initiation site for the polymerase synthesis reaction. In some cases, 3' modifications such as sulfidyl can be utilized to stimulate the synthesis reaction. The primer nucleic acid, which base-pairs with the template and is extended by the polymerase, can be RNA or DNA. Typically, for in vitro reactions, primers are supplied as short, often chemically synthesized, single-stranded DNA (or modified DNA or RNA), and are usually called oligonucleotide primers. Primers are often specific sequences, but random primers can also be used. Primers target complementary sequences by their specific base-pairing ability. The formation of the hybrid between the oligonucleotide primer and the target nucleic acid is typically achieved by two incubations in solution under conditions of salt, pH, and temperature that allow for spontaneous annealing.
[0338] Primers used in RPA may have a single-stranded region for hybridization to target DNA in the presence of a recombinase agent. The single-stranded region may be, for example, approximately 10, 15, 20, 25, 30, 40, and 50 bases in length. Longer regions, such as approximately 75, 100, 150, or more, may theoretically be used. The selection of the single-stranded region depends on the complexity of the starting nucleic acid; for example, the human genome may require longer primers, while plasmids may require much shorter ones.
[0339] The preferred primer length is approximately 30 to 50 bases. For example, 30 to 45 bases, 30 to 40 bases, 30 to 35 bases, 35 to 40 bases, 40 to 45 bases, and 45 to 50 bases. While the primer lengths listed above are indicated, recombinases and / or single-strand binding proteins with an optimal primer length of less than 30 bases are also possible and conceivable.
[0340] The primers used in RPA are preferably DNA, but PNA and RNA are also suitable for use as primers. It should be noted that in natural DNA replication, DNA polymerase elongates genomic DNA through elongation from RNA primers.
[0341] Primers can be synthesized according to standard techniques. The chemistry of the modified base and / or linker skeleton may be desirable and may be functional in some cases. Furthermore, oligonucleotides can be modified at either the 5' or 3' end with groups that serve various purposes, such as fluorescent groups, quenchers, protecting (blocking) groups (reversible or irreversible), magnetic tags, proteins, etc. In some cases, single-stranded oligonucleotides may be used for chain entry, and in other cases, only partially single-stranded nucleic acids may be used, with the 5' stretch sequence of the entry nucleic acid already hybridized to the oligonucleotide.
[0342] Primers may contain a 5' region that is not homologous to the target nucleic acid. It should be noted that amplification can be achieved even if the primer is not perfectly complementary to the target nucleic acid. Primers may be incomplementary by having additional sequences at their 5' ends. These additional sequences may be, for example, sequences for restriction endonuclease recognition sites or sequences complementary to the sequencing primer. Restriction endonuclease recognition sites may be useful for subsequent cleavage of the amplified sequence. The use of restriction endonucleases that cleave the nucleic acid outside the restriction endonuclease recognition site is also possible. Sequences complementary to sequencing primers may allow for rapid DNA sequencing of the amplification product using commercially available primers or sequencing instruments.
[0343] Software for designing oligonucleotides for use in in vitro DNA synthesis reactions is well-established, particularly for use in PCR. Considerations for the RPA method are similar, including optimizing the melting temperature of the oligonucleotide, avoiding hairpin formation within the oligonucleotide, and selecting for complementarity with other oligonucleotides present in a given reaction. Therefore, designing oligonucleotide primer pairs is crucial to avoid undesirable side reactions.
[0344] In addition to optimizing oligonucleotide sequence design, there are further approaches to reduce or eliminate primer dimer formation. As described elsewhere in this specification, reaction noise can be reduced by utilizing polymerases lacking 3'-5' exonuclease activity. This suggests that mispriming may be due to oligonucleotides shortened by the polymerase's 3'-5' exonuclease activity. Consequently, 3'-5' exonuclease editing activity, pyrophosphorylation, or any other similar editing activity can be sources of noise. In addition to the use of exonuclease-lacking polymerases and pyrophosphate removal by pyrophosphatase, the use of synthetic oligonucleotides with a non-hydrolyzable skeleton in the final and / or second-to-last bond may be beneficial in reducing reaction noise. Alternative skeletons can be selected from a considerable range of available chemistry, such as phosphorothioates, morpholinos, locked nucleic acids, or peptide nucleic acids.
[0345] Reagents for use in RPA reactions The reagents used in the RPA method, including those of the present invention, are outlined below.
[0346] dNTPs dNTPs, such as dATP, dGTP, dCTP, and dTTP, as well as their derivatives and analogues, can be added to the RPA reaction. The leading and lagging strands may also contain RPA, ATP, GTP, CTP, and UTP for RNA primer synthesis. Furthermore, ddNTPs (ddATP, ddTTP, ddGTP, and ddGTP, as well as their derivatives and analogues) can be used to generate a fragment ladder.
[0347] dNTPs can be used at concentrations of 1 mM to 200 mM for each NTP species.
[0348] A mixture of dNTPs and ddNTPs may be used at a ddNTP concentration (1 mM to 200 mM) that is 1 / 100 to 1 / 1000 of the dNTP concentration.
[0349] RPA can be carried out in the presence of ATP, a hydrolyzable ATP analog, or another nucleoside triphosphate. The ATP analog may be, for example, dATP, ddATP, or another nucleoside triphosphate analog such as UTP.
[0350] Reducing agent DTT is a reducing agent that can be used in the RPA reaction. The DTT concentration may be 1 mM to 10 mM, preferably 1 mM.
[0351] ATP ATP or ATP analogues can be used in RPA reactions.
[0352] ATP or ATP analogues may be ATP, ATP-γ-S, ATP-β-S, ddATP, or any combination thereof. A preferred concentration of ATP or ATP analogues is 1 mM to 10 mM, preferably 2.5 mM.
[0353] System for ATP regeneration Other components of the RPA reaction may include a system for ATP regeneration (i.e., a system for converting ADP to ATP). Such a system may be, for example, phosphocreatine and creatine kinase.
[0354] Since recombinases have an extremely high ATP hydrolysis rate when bound to nucleic acids, ATP regeneration systems enable sustained recombination reactions. In particular, the UvsX protein has a hydrolysis rate 10 to 20 times higher than RecA and can consume 200 molecules of ATP per minute per monomer. Numerous systems are available. The creatine kinase / phosphocreatine system is preferred. When UvsX is used, the produced AMP can be converted to ATP. Chicken myokinase may also be used, which converts one molecule of AMP and one molecule of ATP into two molecules of ADP. The ADP can then be converted to ATP using the creatine kinase / phosphocreatine system. Poor ATP regeneration can reduce the reaction rate.
[0355] In the RPA method described herein, phosphocreatine is preferably used at a concentration of 15-25 mM, more preferably 20 mM. Creatine kinase is preferably used at a concentration of about 0.25-5.0 μM, more preferably 1 μM.
[0356] Polyvalent metal cations The buffer in the RPA reaction preferably contains polyvalent metal cations. The buffer may contain functional equivalents of the polyvalent metal cations.
[0357] The buffer in the RPA reaction more preferably contains a divalent metal cation. The buffer may contain a functional equivalent of the divalent metal cation.
[0358] Any suitable polyvalent or divalent metal cation or its functional equivalent can be used as a single agent or in combination with other agents.
[0359] The specific polyvalent or divalent metal cation or its functional equivalent that achieves optimal results in promoting / enhancing IDR-mediated phase separation in RPA reactions, and the specific concentration of the polyvalent / divalent metal cation used, may depend on the specific IDR polypeptide used. The optimal polyvalent / divalent metal cation or its functional equivalent, and its optimal concentration, can be empirically established using routine tests, including the RPA reaction itself and / or phase separation assays further described herein.
[0360] Divalent metal cations include Mg 2+ Mn 2+ Ca 2+ Co 2+ Ni 2+ or Cu 2+ These cations may be used individually or in combination. Preferably, they are used individually. A preferred divalent metal cation is Mg 2+ Mn 2+ and Ca 2+A particularly preferred divalent metal cation is Mg 2+ That is the case.
[0361] The preferred concentration range is 30-40 mM, more preferably 33-39 mM.
[0362] The buffer is preferably Mg at the indicated concentration. 2+ It may contain ions. More preferably, the buffer contains MgOAc at the indicated concentration.
[0363] The buffer is preferably Ca at the indicated concentration. 2+ It may contain ions. More preferably, the buffer solution contains CaCl2 at the indicated concentration.
[0364] The buffer is preferably Mn at the indicated concentration. 2+ It may contain ions. More preferably, the buffer solution contains MnCl2 at the indicated concentration.
[0365] buffer solution The buffer in the RPA reaction may be Tris-HCl buffer, Tris-acetate buffer, or a combination thereof. The buffer may be present at a concentration of about 10 mM to about 100 mM. The preferred buffer is Tris-HCl buffer used at a concentration of about 20 mM to about 30 mM, most preferably 25 mM. The buffered pH may be between 6.5 and 9.0, preferably pH 8.3.
[0366] The buffer solution may contain approximately 5 mM to approximately 50 mM, preferably approximately 10 mM to approximately 40 mM, of potassium acetate.
[0367] Reacting components The following is a preferred but not limited set of reaction components for the RPA reaction. Tris-HCl pH 8.3 25 mM KOAc 7.5mM DTT 1mM ATP 2.5mM Phosphocreatine 20mM Creatine kinase 1 μM dNTPs 1mM Gp32 20μM UVSX 4.8μM UvsY 8.6μM Staphylococcus aureus (S. aureus) DNA polymerase 1 (Sau) 0.135 μM Or B. subtilis DNA polymerase 1 (Bsu) Exonuclease III 0.27 μM MgOAc 33mM Forward primer 0.4 μM Reverse primer 0.4 μM Exoprobe 0.12 μM
[0368] RPA reaction conditions The RPA reaction product containing the reactant of the present invention can be incubated for any appropriate length of time.
[0369] Any of the RPA reactants can be incubated for 5 minutes to 16 hours or longer, for example, 15 minutes to 3 hours or 30 minutes to 2 hours.
[0370] Incubation may continue until the desired amplification is achieved. The desired amplification may be 10x, 100x, 1000x, 10,000x, 100,000x, or 1,000,000x.
[0371] One advantage of RPA is that the reaction can be performed at low temperatures compared to techniques that require thermal cycling, such as PCR. Another advantage of RPA is that temperature is not critical; while precise control is desirable, it is not absolutely necessary. For example, in a field setting, it is sufficient to incubate the RPA reaction at room temperature or a temperature close to body temperature (35°C to 38°C), for example, by placing the sample in the crevices of the body. Furthermore, the RPA reaction may be performed without temperature-induced thawing of the template nucleic acid.
[0372] Therefore, any RPA reaction can be carried out at any suitable temperature.
[0373] The RPA reaction may be carried out at temperatures below 45°C. The RPA reaction may be carried out at temperatures below 40°C. The RPA reaction may be carried out at temperatures below 35°C. The RPA reaction may be carried out at temperatures below 30°C.
[0374] The RPA reaction can be carried out at temperatures ranging from 20°C to 50°C, 20°C to 40°C, or, for example, 20°C to 30°C.
[0375] Freeze-drying of RPA reaction components One advantage of the RPA reaction is that, with the exception of the crowding agent (if used) and buffer, the reagents can be lyophilized before use. Lyophilized reagents offer the advantage of not requiring refrigeration to maintain their activity. For example, tubes of RPA reagents can be stored at room temperature. This advantage is particularly useful in field conditions where access to refrigeration is limited.
[0376] The RPA reagent can be lyophilized at the bottom of a tube, or on beads or any other suitable type of solid support. To perform the RPA reaction, the lyophilized reagent is reconstituted in a buffered solution and a crowding agent (if used), or simply in buffer or water, depending on the composition of the lyophilized reagent. The target nucleic acid, or a sample suspected to contain the target nucleic acid, is then added. The reconstituted solution may contain the sample nucleic acid. The reconstituted reaction is incubated for a certain period of time, and the amplified nucleic acid (if present) is detected.
[0377] In any one of the RPA methods described herein, reagents that may be lyophilized before use include, at a minimum, a recombinase agent, a recombinase-loaded protein, a single-strand stabilizer, a DNA polymerase, dNTPs or a mixture of dNTPs and ddNTPs, a reducing agent, ATP or an ATP analog, primers, and probes.
[0378] The lyophilized mixture may contain stabilizers, such as trehalose sugar, in concentrations of 20 mM to 200 mM, optimally 40 mM to 80 mM, in the reconstitution reaction, for example, to improve lyophilization performance and shelf life. If necessary, the lyophilized reagent may be stored for 1 day, 1 week, 1 month, or more than 1 year before use.
[0379] Biochemical reaction reagents, such as RPA reagents, may be lyophilized together with a crowding agent. However, there may be complex and interrelated issues that justify the omission of the crowding agent in the lyophilized mixture. For example, users may experience difficulties in the effective rehydration of the lyophilized crowding agent, or users may experience other adverse effects, including the need for larger lyophilized pellets. Therefore, there may be advantages to excluding some or all of the crowding agent from the lyophilized material, including, among other things, reduced pellet size, shorter cycle times, and easier rehydration. However, this has the disadvantage that, when used, it results in the need to add fresh crowding agent before use after the biochemical reaction mixture has been rehydrated and prepared for use. This can be problematic in certain situations, such as point-of-care use or field use. The advantage of the IDR-based reagent of the present invention is that it is not expected to exhibit the same disadvantages as the crowding agent in the lyophilized setting, and therefore can be easily lyophilized with other biochemical reaction components, thus eliminating the need to add fresh additional reagent before use.
[0380] Detection of RPA reaction products The detection of RPA reaction products can be carried out using any suitable method.
[0381] For example, detection can be performed using electrophoresis on an agarose or PAGE gel followed by ethidium bromide staining.
[0382] Monitoring of the RPA reaction may include, for example, removal of the RPA fraction, the reaction, isolation of the non-integrated fraction, and detection of non-integrated primers. Since the size of non-integrated primers may be less than 50 bp, less than 40 bp, less than 30 bp, or less than 25 bp, and the size of the amplified product may be greater than 1 Kb, greater than 2 Kb, greater than 5 Kb, or greater than 10 Kb, there is a large size difference between integrated and non-integrated primers. Isolation of non-integrated primers can be performed rapidly using size exclusion chromatography, such as spin column chromatography. If the primers are labeled, the monitoring procedure, including spin column chromatography and measurement (e.g., fluorescence or radioactivity), can be completed in less than one minute.
[0383] Another alternative method for separating elongated primers from unelongated primers involves the use of PAGE. For example, elongated primers can be separated from unelongated primers by gel electrophoresis in less than 5 minutes.
[0384] Another alternative method for separating extended primers involves the use of immobilized oligonucleotides. For example, nucleic acids generated by primer extension can be specifically captured using oligonucleotides homologous to sequences uniquely found within the amplified DNA sequence. These capture oligonucleotides can be immobilized on a chip or other substrate. Capture of extended oligonucleotides by capture oligonucleotides can be performed by RecA protein-mediated methods or, if necessary, by conventional solution hybridization.
[0385] The use of fluorescent probes is the most commonly used and preferred method for detecting RPA amplification products, offering the advantage of providing real-time detection.
[0386] These probes are labeled with a fluorophore (e.g., fluorescein (FAM)) and a quencher (e.g., a black hole quencher), with the label positioned close to the fluorophore. The probe has a blocking group at its 3' end to prevent extension by polymerase. Once the probe is cleaved and the quencher and fluorophore are separated, a fluorescent signal is detected, enabling real-time detection. The probe contains a debasication site, typically tetrahydrofuran (THF) or a dR group, and cleavage occurs at the debasication site, typically by E. coli exonuclease III (cleaved with THF) or E. coli fpg (glycolase / lyase) (cleaved with a dR group).
[0387] kit containing RPA reaction components The present invention also provides a kit for performing RPA reactions.
[0388] The kit may contain any of the reagents described herein in any one of the above concentrations of RPA.
[0389] The kit may include any of the IDR-tagged macromolecules and / or IDR-tagged polypeptides described and defined herein. Preferably, the kit includes an RPA recombinase agent and / or an RPA recombinase-loaded protein and / or a polymerase and / or first and second nucleic acid primers and / or an exonuclease and / or a buffer and / or a polyvalent metal ion, preferably Mg 2+ Mn 2+ Ca 2+ Co 2+ or Ni 2+ It further includes additional RPA components selected from divalent metal cation sources such as the following.
[0390] The reagents in the kit may be lyophilized, in which case they may be provided in any appropriate amount such that the appropriate reagent concentration is achieved when reconstituted.
[0391] polymerase As described above, any of the IDR amino acid sequences described and defined herein can be tagged to any protein component necessary for carrying out a nucleic acid synthesis reaction.
[0392] Any of the IDR amino acid sequences described and defined herein may be tagged to any protein component required to carry out a nucleic acid synthesis reaction in which a polymerase is used to synthesize a new nucleic acid molecule by extending a primer nucleic acid molecule.
[0393] Therefore, any suitable polymerase may be tagged with the IDR amino acid sequence described and defined herein. The polymerase may be suitable for and usable in any reaction used to synthesize a new nucleic acid molecule by extending a primer nucleic acid molecule.
[0394] A polymerase may be compatible with and usable in any nucleic acid amplification reaction. A nucleic acid amplification reaction may be a reaction involving a thermal cycle. A nucleic acid amplification reaction may be an isothermal amplification reaction. Nucleic acid amplification reactions may include polymerase chain reaction (PCR), polymerase spiral reaction (PSR), loop-mediated isothermal amplification (LAMP), nucleic acid sequence-based amplification (NASBA), autologous sequence replication (3SR), rolling circle amplification (RCA), strand substitution amplification (SDA), multiple substitution amplification (MDA), ligase chain reaction (LCR), helicase-dependent amplification (HDA), branched amplification (RAM), recombinase polymerase amplification (RPA), transcription-mediated amplification (TMA), or nickel enzyme amplification (NEAR).
[0395] Array tags Any IDR macromolecule or IDR polypeptide involved in the biochemical reactions described herein, including those involved in RPA reactions, may contain one or more sequence tags. When used, any such sequence tag is preferably bound to the polypeptide as a fusion protein, as described herein. Sequence tags and means for attaching sequence tags to polypeptides are well known in the art.
[0396] Sequence tags can be short amino acid sequences or larger polypeptides containing proteins.
[0397] The sequence tag can be attached to any amino acid position along the length of the polypeptide, either at the C-terminus of the polypeptide, at the N-terminus of the polypeptide tag, at both the C-terminus and N-terminus of the polypeptide, or in any combination thereof.
[0398] Non-limiting examples of appropriate amino acid sequence tags include 6-histidine (6X-His, HHHHHH, SEQ ID NO: 89), c-myc epitope (EQKLISEEDL, SEQ ID NO: 90), FLAG® octapeptide (DYKDDDDK, SEQ ID NO: 91), protein C (EDQVDPRLIDGK, SEQ ID NO: 92), Tag-100 (EETARFQPGYRS, SEQ ID NO: 93), V5 epitope (GKPIPNPLLGLDST, SEQ ID NO: 94), VSV-G (YTDIEMNRLGK, SEQ ID NO: 95), Xpress (DLYDDDDK, SEQ ID NO: 96), and hemagglutinin (YPY-DVPDYA, SEQ ID NO: 97).
[0399] Non-limiting examples of appropriate protein tags include β-galactosidase, thioredoxin, His-patch thioredoxin, IgG-binding domain, intein chitin-binding domain, T7 gene 10, glutathione-S-transferase (GST), green fluorescent protein (GFP), and maltose-binding protein (MBP).
[0400] Those skilled in the art will understand that sequence tags and protein tags can be used interchangeably, for example, for purification and / or identification purposes.
[0401] Solid-phase chemical reactions The biochemical reactions carried out by the methods according to the present invention may be carried out using solid-phase or reversible solid-phase techniques. A solid-phase reaction system suitable for carrying out the processes, uses, and methods described herein may include a surface. Any suitable surface can be used.
[0402] The data described herein demonstrate that biochemical reactions can be carried out using IDR-based reagents according to the present invention using solid-phase techniques in the absence of crowding agents. One particular example is the recombinase polymerase amplification of nucleic acids with primers bound to a solid surface. Any suitable biochemical reaction suitable for implementation using solid-phase methods can be carried out using such methods according to the present invention, comprising any of the IDR-based reagents described and defined herein.
[0403] Various such solid-state technologies are known in the art and can be used.
[0404] Macromolecules such as polynucleotides, including nucleic acid amplification primers, peptides, haptens, hormones, and drugs, can be immobilized on the surface.
[0405] Any suitable macromolecular component of a biochemical reaction can be immobilized on the surface, including IDR-based reagents described and defined herein.
[0406] Macromolecules such as polynucleotides, for example primers used in amplification reactions, can be immobilized on a surface directly or indirectly. For instance, they may be directly bonded to the surface by chemical bonds, or they may be indirectly bonded to the surface via an intermediate surface.
[0407] The surface may be, for example, a flat surface such as glass, a gel-based material, or the surface of fine particles such as beads or functional quantum dots. The material containing the surface may itself be bonded to the substrate. The substrate may include any suitable material such as glass, plastic, or polymer material.
[0408] The macromolecules involved in the biochemical reaction by the method of the present invention may be immobilized on a gel-based material such as polyacrylamide or hydrogel, and the gel-based material itself is bound to a supporting substrate such as glass, plastic, or polymer material.
[0409] For example, pre-formed polynucleotides can be immobilized on a surface by methods commonly used to fabricate nucleic acid microarrays. For instance, polynucleotides can be synthesized and then spotted or printed onto a surface, typically a plane. Polynucleotides can also be deposited onto a surface using contact printing techniques. For example, a solid or hollow tip or pin can be immersed in a solution containing pre-formed polynucleotides and brought into contact with the surface. Alternatively, polynucleotides can be adsorbed onto a microstamp and then transferred to the surface by physical contact. Non-contact printing techniques include thermal or piezoelectric printing, which can eject microdroplets of sub-nanometer size containing pre-formed polynucleotides from a printing chip using methods similar to those used in inkjet and bubble jet printing.
[0410] Polynucleotides can be synthesized directly on a surface, for example, using so-called "on-chip" methods used to fabricate nucleic acid microarrays. On-chip techniques for polynucleotide fabrication include photolithography, which involves the use of UV light induced via a photolithography mask to selectively activate protected nucleotides and enable the subsequent uptake of new protected nucleotides. A cycle of UV-mediated deprotection and predetermined nucleotide coupling allows for the generation of insights of polynucleotides with the desired sequence. Instead of using a photolithography mask, polynucleotides can be fabricated on a surface by using inkjet printing techniques for sequential deposition of nucleic acid bases, and a cycle of coupling, oxidation, and deprotection to generate oligonucleotides with the desired sequence (see Kosuri and Church, Nature Methods, 2014, 11, 499-507 for a review).
[0411] Surfaces for binding macromolecules, including polynucleotides, peptides, haptens, hormones, and drugs, can be made from any suitable material. Typically, the surface may include any suitable polymer material such as silicon, glass, or polystyrene. The surface may include a gel surface, such as a polyacrylamide surface or a hydrogel surface. The gel surface may then be bonded to or attached to a solid support or substrate, the support or substrate may include any suitable material such as silicon, glass, or any suitable polymer material. The surface may include a hydrogel material bonded to a polystyrene material.
[0412] The surface may often be the surface of microspheres or microbeads, or simply beads—particles.
[0413] The surface may contain a hydrogel material bonded to a polystyrene material in the form of microbeads.
[0414] Various surface binding methods and chemistry are available for immobilizing macromolecules such as polynucleotides onto surfaces such as microbeads. The surface may be functionalized or derivatized to facilitate binding. Such functionalizations are known in the art. For example, the surface may be functionalized with polyhistidine tags (hexa-histidine tags, 6xHis-tags, His6 tags, or HisTag®), Ni-NTA, streptavidin, biotin, oligonucleotides, polynucleotides (e.g., DNA, RNA, PNA, GNA, TNA, or LNA), carboxyl groups, quaternary amine groups, thiol groups, azide groups, alkyne groups, DIBO, lipids, FLAG tags (FLAG octapeptides), polynucleotide-binding proteins, peptides, proteins, antibodies, or antibody fragments. The surface may also be functionalized with molecules or groups that specifically bind to the macromolecule to be immobilized or to another portion of the macromolecule to be immobilized. Covalent immobilization of macromolecules onto surfaces is commonly used. As a pure example, carboxylate-modified polystyrene latex surfaces are suitable for covalent bonding of, for example, amine-terminated proteins, DNA, or other molecules, such as by EDAC-mediated coupling. Other techniques are also available. Macromolecules will typically be chemically bonded, but they can also be bonded to the surface by indirect means such as affinity interactions. For example, the macromolecule to be immobilized may be functionalized with biotin and bonded to a surface coated with avidin or streptavidin, or vice versa.
[0415] In any of the processes, uses, and methods described herein, macromolecules may be bonded to a surface via one or more covalent bonds. One or more covalent bonds may be formed between a functional group on the surface and a functional group on the macromolecule. The functional group on the macromolecule may be, for example, an amine group, a thiol group, a thiophosphate group, or a thioamide group. The functional group on the surface may be, for example, a bromoacetyl group, which optionally is provided on a polyacrylamide surface derived using N-(5-bromoacetamidylpentyl)acrylamide (BRAPA).
[0416] In any of the processes, uses, and methods described and defined herein, macromolecules may be bonded to a surface directly or indirectly via a linker. Any suitable linker that is biocompatible in nature can be used.
[0417] The linker can be a straight-chain linker or a branched linker.
[0418] Linkers may contain hydrocarbon chains. Hydrocarbon chains may contain 2 to approximately 2000 or more carbon atoms. Hydrocarbon chains may contain alkylene groups, for example, C2 to approximately 2000 or more alkylene groups. Hydrocarbon chains have the general formula -(CH2) n -(wherein n is 2 to about 2000 or more) may be present. The hydrocarbon chain may optionally be interrupted by one or more ester groups (i.e., -C(O)-O-) or one or more amide groups (i.e., -C(O)-N(H)-).
[0419] Any linker may be selected from the group comprising polyacrylamide, poly(2-hydroxyethyl methacrylate), poly-2-methyl-2-oxazoline (PMOXA), zwitterionic polymers, such as poly(carboxybetaine methacrylate) (PCBMA), poly[N-(3-sulfopropyl)-N-methacryloxyethyl-N,N-dimethylammonium betaine] (PSBMA), glycopolymers, and polypeptides.
[0420] The linker is of the general formula -[(CH2-CH2-O) n -er2 - -O] m It may contain oligoethylene glycol-phosphate units having - (wherein n is 1 to about 600 or more, and m may be 1 to 200 or more).
[0421] Any of the linkers described above may be bonded at one end to a macromolecule described herein and at the other end to a first functional group, the first functional group may provide a covalent bond to the surface. The first functional group may be, for example, an amine group, a thiol group, a thiophosphate group, or a thioamide group, as further described herein. The surface may be functionalized with further functional groups to provide a covalent bond to the first functional group. The further functional group may be, for example, a 2-bromoacetamide group, as further described herein. Optionally, a bromoacetyl group is provided on a polyacrylamide surface derived using N-(5-bromoacetamidylpentyl)acrylamide (BRAPA). The further functional group on the surface may be a bromoacetyl group, and optionally, the bromoacetyl group is provided on a polyacrylamide surface derived using N-(5-bromoacetamidylpentyl)acrylamide (BRAPA), and the first functional group may be, for example, an amine group, a thiol group, a thiophosphate group, or a thioamide group, as needed. The surface to which the polynucleotides are bound may include a gel. The surface may also include a polyacrylamide surface, such as about 2% polyacrylamide, and preferably the polyacrylamide surface is bound to a solid support such as glass.
[0422] Microparticles and beads can be used to facilitate reversible immobilization. Solid-phase reversible immobilization (SPRI) methods or modified methods are known in the art and can be used (see, for example, DeAngelis MM et al. (1995) Solid-Phase Reversible Immobilization for the Isolation of PCR Products, Nucleic Acids Research, 23(22):4742-4743).
[0423] The surface may be provided, for example, in the form of paramagnetic beads. Paramagnetic beads may aggregate under the influence of a magnetic field. For example, a paramagnetic surface may provide chemical groups, such as carboxyl groups, that act as binding sites for macromolecules containing nucleic acids under appropriate binding conditions. Macromolecules can be eluted from such surfaces under appropriate elution conditions. The surfaces of the microparticles and beads may be provided as UV-sensitive polycarbonates. Nucleic acids can be bound to the activated surface, for example, in the presence of an appropriate immobilization buffer.
[0424] The microparticles and beads can be freely moved within the reaction solution and then reversibly immobilized, for example, by holding the beads in microwells or pits etched on the surface. The beads can be localized as part of an array, for example, by using a unique nucleic acid "barcode" bound to the bead, or by using color coding.
[0425] The surface may be part of an electrowetting-on-dielectric (EWOD) system. The EWOD system provides a dielectric-coated surface that facilitates microfluidic manipulation of very small liquid volumes in the form of microdroplets (see, e.g., Chou, WL. et al. (2015) Recent Advances in Applications of Droplet Microfluidics, Micromachines, 6:1249-1271). These droplet volumes can be programmably created, moved, distributed, and coupled on-chip by electrowetting techniques. Thus, the electrowetting system provides an alternative means for reversibly immobilizing macromolecules on a surface and / or manipulating macromolecules immobilized on a surface.
[0426] Therefore, in any one of the methods or uses of the present invention described or defined herein, the biochemical reaction may be carried out in a solid-phase reaction system including a surface.
[0427] In any one of the methods or uses of the present invention described herein or defined herein, in which the biochemical reaction is carried out in a solid-phase reaction system including a surface, any macromolecule necessary for carrying out the reaction may be bound to the surface. For example, in one such method in which the biochemical reaction is a method of amplifying a single-stranded or double-stranded target nucleic acid molecule in an in vitro reaction system described herein, at least one nucleic acid primer and / or reaction macromolecule, and / or IDR macromolecule and / or one or more polypeptide cofactors may be bound to the surface.
[0428] In any one of the methods or uses of the present invention described herein or defined herein, in which the biochemical reaction is carried out in a solid-phase reaction system including a surface, the IDR macromolecule required to carry out the reaction may be bound to the surface.
[0429] In any one of the methods or uses of the present invention described or defined herein, the biochemical reaction is a recombinase polymerase amplification process that amplifies a double-stranded target nucleic acid molecule in an in vitro reaction system, the reaction is carried out in a solid-phase reaction system including a surface, and a recombinase agent and / or a recombinase-loaded protein and / or a single-strand stabilizer and / or polymerase and / or exonuclease and / or a first nucleic acid primer and / or a second nucleic acid primer may be bound to the surface. In one such method or use, either the first nucleic acid primer or the second nucleic acid primer may be bound to the surface. Or, in other such methods or uses, both the first and second nucleic acid primers may be bound to the surface.
[0430] In any one of the methods or uses of the present invention described herein or defined herein, in which the biochemical reaction is carried out in a solid-phase reaction system, the surface to which the macromolecules are bound may be microbeads, preferably the microbeads include polymer materials such as silicon, glass, gel, or polystyrene, or any combination thereof.
[0431] In any of the methods or uses described herein, in which the biochemical reaction is carried out in a solid-phase reaction system comprising a surface and / or substrate, the surface and / or substrate may be provided as a flow cell. Any suitable flow cell that is appropriate for the biochemical reaction to be carried out may be used. A suitable flow cell may include multiple fluid channels through which the reagents used to carry out the biochemical reaction can flow. Any one or more macromolecules used to carry out the biochemical reaction may be bound to a surface lining the fluid channels. Using a suitable flow cell, biochemical reactions for the amplification of single-stranded or double-stranded target nucleic acid molecules can be carried out. Sequencer reactions carried out using the processes, uses and methods described herein may also be carried out using a suitable flow cell.
[0432] example The following examples are provided to illustrate the present invention, but are not intended to limit it.
[0433] Example 1. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with an IDR tag derived from human Otx1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with a histidine-rich amino acid domain sequence found in the intrinsically disordered region (IDR) of the human homeobox protein Otx1.
[0434] This example demonstrates recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly over a range of template concentrations using Gp32 tagged at the C-terminus with a histidine-rich intrinsically disordered region (IDR) domain (Otx1) in the absence of a crowding agent.
[0435] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS2. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 82 (Table 23).
[0436] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using a indicated copy of a DNA template derived from Listeria monocytogenes genomic DNA in PEG-free amplification, i.e., in the absence of a crowding agent. The test templates were titrated by copy number, as shown in Figure 1.
[0437] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding a template containing the given concentrations and 33 mM MgOAc.
[0438] The relevant primers and probes are listed below.
[0439] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0440] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0441] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0442] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0443] Results and Conclusions As shown in Figure 1, the test mold was easily detected with high sensitivity within 7 minutes of the start of the RPA reaction. The amplicon was detected with only 10 copies of the target.
[0444] Therefore, it was found that using this Gp32 IDR-tagged fusion protein allows for efficient amplification in the absence of crowding agents such as PEG.
[0445] Example 2. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with a human MafA-derived IDR tag. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with a histidine-rich domain sequence found in the intrinsically disordered region (IDR) of the human transcription factor MafA.
[0446] This example demonstrates recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly over a range of template concentrations using Gp32 tagged at the C-terminus with a histidine-rich intrinsically disordered region (IDR) domain (MafA) in the absence of a crowding agent.
[0447] Materials and methods The specific amino acid sequence of the IDR domain tag used was SGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHH (SEQ ID NO: 27). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which depends on the histidine naturally present in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS5. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 85 (Table 23).
[0448] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using a indicated copy of a DNA template derived from Listeria monocytogenes genomic DNA in PEG-free amplification, i.e., in the absence of a crowding agent. The test templates were titrated by copy number, as shown in Figure 2.
[0449] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding a template containing the given concentrations and 33 mM MgOAc.
[0450] The relevant primers and probes are listed below.
[0451] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0452] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0453] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0454] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0455] Results and Conclusions As shown in Figure 2, the test mold was easily detected with high sensitivity within 10 minutes of the start of the RPA reaction. The amplicon was detected with only 10 copies of the target.
[0456] Therefore, it was found that using this Gp32 IDR-tagged fusion protein allows for efficient amplification in the absence of crowding agents such as PEG.
[0457] Example 3. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with an IDR tag derived from Saccharomyces cerevisiae Hrp1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein.
[0458] This example demonstrates recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly over a range of template concentrations using Gp32 tagged at the C-terminus with a sequence containing the intrinsically disordered region (IDR) of the yeast Hrp1 protein in the absence of a crowding agent.
[0459] Materials and methods The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The fusion protein was named Gp32-HRP1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 79 (Table 23).
[0460] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using a indicated copy of a DNA template derived from Listeria monocytogenes genomic DNA in PEG-free amplification, i.e., in the absence of a crowding agent. The test templates were titrated by copy number, as shown in Figure 3.
[0461] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding a template containing the given concentrations and 33 mM MgOAc.
[0462] The relevant primers and probes are listed below.
[0463] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0464] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0465] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0466] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0467] Results and Conclusions As shown in Figure 3, the test mold was easily detected with high sensitivity within 7 minutes of the start of the RPA reaction. The amplicon was detected with only 10 copies of the target.
[0468] Therefore, it was found that using this Gp32 IDR-tagged fusion protein allows for efficient amplification in the absence of crowding agents such as PEG.
[0469] Example 4. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with an IDR tag derived from Saccharomyces cerevisiae Sup2. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) domain of the Saccharomyces cerevisiae Sup2 protein.
[0470] This example demonstrates recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly over a range of template concentrations using Gp32 tagged at the C-terminus with a sequence containing the intrinsically disordered region (IDR) domain of the yeast Sup2 protein in the absence of a crowding agent.
[0471] Materials and methods The specific amino acid sequence of the IDR domain tag used was YNPQGGYQQ (SEQ ID NO: 19). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The fusion protein was named Gp32-Sup1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 72 (Table 23).
[0472] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using a indicated copy of a DNA template derived from Listeria monocytogenes genomic DNA by PEG-free amplification, i.e., in the absence of a crowding agent. The test templates were titrated by copy number, as shown in Figure C.
[0473] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding a template containing the given concentrations and 33 mM MgOAc.
[0474] The relevant primers and probes are listed below.
[0475] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0476] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0477] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0478] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0479] Results and Conclusions As shown in Figure 4, the test mold was easily detected with high sensitivity within 7 minutes of the start of the RPA reaction. The amplicon was detected with only 10 copies of the target.
[0480] Therefore, it was found that using this Gp32 IDR-tagged fusion protein allows for efficient amplification in the absence of crowding agents such as PEG.
[0481] Example 5. Recombinase polymerase amplification of the human apoB gene using Gp32 with an IDR tag derived from Saccharomyces cerevisiae Sup2. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of numerous Gp32 fusion protein preparations containing tags with amino acid sequences from the intrinsically disordered region (IDR) domain of the Saccharomyces cerevisiae Sup2 protein. The variable number of IDR domain repeat units was evaluated, and the concentration range of the fusion proteins was investigated.
[0482] This example demonstrates recombinase polymerase amplification (RPA) of the human apolipoprotein B (apoB) gene using Gp32 tagged at the C-terminus with a sequence containing the intrinsically disordered region (IDR) domain of the yeast Sup2 protein in the absence of a crowding agent.
[0483] Materials and methods The specific amino acid sequence of the IDR domain tag used was YNPQGGYQQ (SEQ ID NO: 19). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. Either a single YNPQGGYQQ unit or two, three, or four repeats were ligated. The recombinant fusion proteins were purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The fusion proteins were named Gp32-Sup2 (two repeats, SEQ ID NO: 20), Gp32-Sup3 (three repeats, SEQ ID NO: 21), and Gp32-Sup4 (four repeats, SEQ ID NO: 22). The complete amino acid sequences of the fusion proteins are shown as SEQ ID NOs: 73, 74, and 75, respectively (Table 23).
[0484] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested together with Gp32-Sup1 in PEG-free amplification, i.e., in the absence of crowding agents, using a DNA template derived from human genomic DNA.
[0485] The reaction was set up by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, Gp32 fusion protein at concentrations shown in Figures 5A-5D, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding the template and 33 mM MgOAc. In each case, 10,000 test template copies were used.
[0486] The relevant primers and probes are listed below.
[0487] Forward primer: GCAGCTGTATAGCAAATTCCTGTTGAAAGCAG (Sequence ID 101).
[0488] Reverse primer: TCCTGGCTGTATTCATTGTTGTTAAATTGG (Sequence ID 102).
[0489] Probe: CACTGATGCT TTTCCTAGACACGAGATGA[FAM-dT]G[THF]C[BHQ1-dT]TGTGGAGCCTTTGT (Sequence ID 103), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0490] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0491] Results and Conclusions The results are shown in Figure 5. Figure 5A shows the results using a single IDR domain tag unit. Figures 5B to 5D show the results using two, three, and four IDR domain tag unit repeats, respectively. The test template was detected approximately 10 minutes after the start of the RPA reaction.
[0492] Amplification in the absence of crowding agents such as PEG was found to occur efficiently using these Gp32-IDR-tagged fusion proteins. Best performance was observed with a single IDR domain tag unit and two IDR domain tag units. Three IDR domain tag units also yielded good performance.
[0493] Example 6. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with a human MafA-derived IDR tag - comparison of magnesium ion concentrations. Objective of the experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with a histidine-rich domain sequence found in the intrinsically disordered region (IDR) of the human transcription factor MafA. The experiment evaluated performance over a range of magnesium concentrations.
[0494] This example demonstrates recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly across a range of magnesium concentrations using Gp32 tagged at the C-terminus with a histidine-rich intrinsically disordered region (IDR) domain (MafA) in the absence of a crowding agent.
[0495] Materials and methods The specific amino acid sequence of the IDR domain tag used was SGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHH (SEQ ID NO: 27). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which depends on the histidine naturally present in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS5. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 85 (Table 23).
[0496] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using a indicated copy of a DNA template derived from Listeria monocytogenes genomic DNA in PEG-free amplification, i.e., in the absence of a crowding agent. Test templates were provided at 10,000 copies per reaction, and the magnesium ion concentration was varied from 5.6 mM to 44.8 mM.
[0497] The reaction was set up by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding the template and adjusting the indicated concentration of MgOAc from 5.6 mM to 44.8 mM.
[0498] The relevant primers and probes are listed below.
[0499] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0500] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0501] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0502] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0503] Results and Conclusions Amplification in the absence of crowding agents such as PEG was found to occur efficiently using this Gp32 IDR-tagged fusion protein.
[0504] As shown in Figure 6, good amplification was found using this Gp32 IDR-tagged fusion protein when magnesium concentrations of 28 mM or higher were present. The optimal concentration in this experiment appeared to be 33.6 mM, and similar detection times were obtained when further increased to 44.8 mM.
[0505] Example 7. Effect of phosphocreatine levels on recombinase polymerase amplification of human ApoB gene fragments. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of variations in phosphocreatine levels on the performance of Gp32 fusion protein preparations containing a tag with a histidine-rich domain sequence found in the intrinsically disordered region (IDR) of the human homeobox protein Otx1.
[0506] This example demonstrates recombinase polymerase amplification (RPA) of a human apolipoprotein (apoB) gene fragment using Gp32 tagged at the C-terminus of a histidine-rich intrinsically disordered region (IDR) domain (Otx1) in the absence of a crowding agent.
[0507] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS2. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 82 (Table 23).
[0508] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested in PEG-free amplification, i.e., in the absence of crowding agents. Phosphocreatine titration was performed using the human apoB assay. The test template was 10 4 It was provided in the same density as a copy.
[0509] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, phosphocreatine levels as shown in the figure, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. 10 per reaction. 4 A copy of the template was added, and the reaction was started using 33 mM MgOAc.
[0510] Forward primer: GCAGCTGTATAGCAAATTCCTGTTGAAAGCAG (Sequence ID 101).
[0511] Reverse primer: TCCTGGCTGTATTCATTGTTGTTAAATTGG (Sequence ID 102).
[0512] Probe: CACTGATGCT TTTCCTAGACACGAGATGA[FAM-dT]G[THF]C[BHQ1-dT]TGTGGAGCCTTTGT (Sequence ID 103), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0513] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0514] Results and Conclusions Amplification was found to occur using this Gp32 IDR-tagged fusion protein in the absence of crowding agents such as PEG. As shown in Figures 7A, 7B, and 7C, at standard phosphocreatine concentrations used in PEG-based RPA (50 mM), little amplification activity was observed within 20 minutes. Optimal performance was obtained by reducing phosphocreatine to 20 mM, but good performance was also observed between 15 and 25 mM, and even lower levels of amplification within 20 minutes were observed at 30 and 35 mM.
[0515] Example 8. Recombinase polymerase amplification of the Listeria monocytogenes gene hly using Gp32 with an IDR tag derived from Saccharomyces cerevisiae Hrp1 - comparison of salt concentrations. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein. In this experiment, potassium acetate was used to evaluate performance across a range of salt concentrations.
[0516] This example demonstrates that recombinase polymerase amplification (RPA) of the Listeria monocytogenes gene hly can be optimized over a range of salt concentrations using Gp32 tagged at the C-terminus of the intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein in the absence of a crowding agent.
[0517] Materials and methods The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The fusion protein was named Gp32-HRP1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 79 (Table 23).
[0518] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested using 100 copies of DNA template derived from Listeria monocytogenes genomic DNA in PEG-free amplification, i.e., in the absence of crowding agents. The potassium acetate concentration was varied from 10 mM to 100 mM.
[0519] The reaction was prepared by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding the template and 33 mM MgOAc.
[0520] The relevant primers and probes are listed below.
[0521] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0522] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0523] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0524] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0525] Results and Conclusions Amplification in the absence of crowding agents such as PEG was found to occur efficiently using this Gp32 IDR-tagged fusion protein.
[0526] Furthermore, it was found that amplification using this Gp32 IDR-tagged fusion protein in the absence of crowding agents can be optimized over a range of salt concentrations, with potassium acetate being a representative example.
[0527] As shown in Figure 8, it was found that good amplification occurred when using this Gp32 IDR-tagged fusion protein in the presence of potassium acetate at concentrations of 10 mM or higher. The optimal concentration range in this experiment appeared to be between 10 and 40 mM. Lower amplification efficiency was observed at concentrations above 40 mM.
[0528] Example 9. Synergistic effect of recombinase polymerase amplification of human ApoB gene fragments using Gp32 with an IDR tag derived from Saccharomyces cerevisiae Sup2, and crowding agent. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of a low concentration of a crowding agent, in this case PEG, on the reaction efficiency of a Gp32 fusion protein preparation containing a histidine-rich sequence, specifically the Sup1 sequence YNPQGGYQQ (SEQ ID NO: 19), found in the intrinsically disordered region of the yeast SUP2 gene bound to the C-terminus of phage vB EcoM NBG1 Gp32. The performance of this fusion protein was compared to that of a Gp32 protein lacking the Sup1 IDR tag in recombinase polymerase amplification of a fragment of the human apolipoprotein (apoB) gene.
[0529] It was found that low concentrations of the crowing agent can increase the reaction efficiency of Sup1 IDR-tagged Gp32, and conditions can be achieved under which a synergistic effect can be observed.
[0530] Materials and methods Gp32-Sup1 The specific amino acid sequence of the IDR domain tag used was YNPQGGYQQ (SEQ ID NO: 19). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The fusion protein was named Gp32-Sup1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 72 (Table 23).
[0531] Gp32 (7His) The phage vB EcoM NBG1 Gp32 was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on a heptahistidine tag located precisely at the C-terminus of the protein under test. The fusion protein was named Gp32(7His). The complete amino acid sequence of the fusion protein is shown as Sequence ID No. 65 (Table 23).
[0532] Recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested by RPA reaction using a DNA template containing a fragment of the human apolipoprotein (apoB) gene, either in the presence or absence of a crowding agent.
[0533] The reaction was set up by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 50 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM Gp32 fusion protein, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.27 μM exonuclease III. The reaction was initiated by adding the template and 33 mM MgOAc. The number of test template copies used in each case was 10,000. PEG was added to the final concentration shown in the relevant figure. The PEG species used had a molecular weight of 35,000.
[0534] The relevant primers and probes are listed below.
[0535] Forward primer: GCAGCTGTATAGCAAATTCCTGTTGAAAGCAG (Sequence ID 101).
[0536] Reverse primer: TCCTGGCTGTATTCATTGTTGTTAAATTGG (Sequence ID 102).
[0537] Probe: CACTGATGCT TTTCCTAGACACGAGATGA[FAM-dT]G[THF]C[BHQ1-dT]TGTGGAGCCTTTGT (Sequence ID 103), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0538] Next, the reaction mixture was incubated at 39°C and then placed into a fluorometer while being magnetically mixed using bearing balls.
[0539] Results and Conclusions The results are shown in Figure 9. Figure 9 shows that when the Gp32-Sup1 IDR-tagged fusion protein was tested in the absence of the crowding agent PEG, the test template was efficiently detected.
[0540] When Gp32-7His fusion proteins without the Sup1 IDR tag were tested in the presence of the crowding agent PEG at concentrations between 0.5% and 2%, small but detectable amounts of amplification products were observed.
[0541] When the Gp32-Sup1 IDR-tagged fusion protein was tested in the presence of the crowding agent PEG, the test template was efficiently detected. In this case, when comparing the amounts observed for (i) the Gp32-Sup1 IDR-tagged fusion protein in the absence of PEG and (ii) the Gp32-7His fusion protein without the Sup1 IDR tag in the absence of PEG, a synergistic effect was observed in which the amount of amplified product exceeded the sum of the two (see, for example, Figure 9, comparing Sup1 1% PEG with Sup1 0% PEG + normal GP32 1% PEG).
[0542] These results demonstrate that combining the IDR-tagged macromolecular component of a reaction with a low concentration of a crowding agent can enhance the efficiency of the biochemical reaction, and that combining the IDR-tagged macromolecular component of a reaction with a low concentration of a crowding agent can create conditions that promote a synergistic effect on reaction efficiency.
[0543] Example 10. Enhancement of phase separation by IDR tagging in the presence of polyvalent metal cations. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of polyvalent metal cations on the promotion of phase separation driven / induced by several Gp32 fusion proteins, each containing a tag with an intrinsically disordered region (IDR) domain amino acid sequence, in an aqueous in vitro biochemical system.
[0544] The example demonstrates that a tag containing an IDR domain amino acid sequence can surprisingly promote phase separation, and even more surprisingly, this effect is enhanced by the presence of a polyvalent metal cation.
[0545] Materials and methods Gp32-HIS2 fusion protein The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The complete amino acid sequence of the Gp32-HIS2 fusion protein is provided as SEQ ID NO: 82 (Table 23).
[0546] Gp32-HRP1 fusion protein The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The complete amino acid sequence of the Gp32-HRP1 fusion protein is provided as SEQ ID NO: 79 (Table 23).
[0547] Gp32-Sup1 fusion protein The specific amino acid sequence of the IDR domain tag used was YNPQGGYQQ (SEQ ID NO: 19). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The complete amino acid sequence of the Gp32-Sup1 fusion protein is provided as SEQ ID NO: 72 (Table 23).
[0548] Gp32-Fib fusion protein The specific amino acid sequence of the IDR domain tag used was PGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGR (Sequence ID 1). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The complete amino acid sequence of the Gp32-Fib fusion protein is provided as Sequence ID 69 (Table 23).
[0549] Phase separation assay The method outlined below applies to all fusion proteins tested. The volume of fusion protein solution used depended on the protein concentration after purification.
[0550] In each case, a 50 μl solution was prepared containing a tagged fusion protein at a final concentration of 1000 ng / μl and a metal ion in either acetate or chloride form at the target concentrations shown below and in the relevant figures presented herein.
[0551] For the Gp32-HIS2 fusion, the purified protein concentration was 48 mg / ml. 1.04 μl of this fusion protein was used in each 50 μl reaction to achieve a final concentration of 1000 ng / μl in solution. For the Gp32-HRP1 fusion, the purified protein concentration was 39 mg / ml. 1.28 μl of this fusion protein was used in each 50 μl reaction to achieve a final concentration of 1000 ng / μl in solution. For the Gp32-Sup1 fusion, the purified protein concentration was 36 mg / ml. 1.4 μl of this fusion protein was used in each 50 μl reaction to achieve a final concentration of 1000 ng / μl in solution. For the Gp32-Fib fusion, the purified protein concentration was 20.2 mg / ml. 2.48 μl of this fusion protein was used in each 50 μl reaction to achieve a final concentration of 1000 ng / μl in solution.
[0552] In these experiments, the divalent metal cation concentrations required for detectable phase separation enhancement were tested for representative divalent metal cations: magnesium (MgOAc), manganese (MgCl2), and calcium (CaCl2). The acetate forms of manganese and calcium were not used simply because their instability in solution is known. Manganese oxidizes over time in acetate solutions, calcium acetate appears to support the growth of some bacteria in solution, but calcium chloride does not.
[0553] After preparing a mixture containing water, IDR-tagged protein, and divalent metal cations, the mixture was vortexed, spun down, and a 10 μl sample of the mixture was transferred to a DHC-B01 C-Chip hemocytometer slide. The slide was then imaged under a microscope at 400x magnification. Detection phase separation was assessed by the formation of globular-like spherical foci / particles, which could be visually identified through magnification and counted using a hemocytometer. A spherical focus count per unit volume could then be performed. Spherical focus counting was performed by counting the number of spherical foci formed in a 218 μm × 175 μm magnified area at 400x magnification. This was done by dividing the magnified image into 20 square segments (4 × 5 of the image), counting the spherical foci in one of these segments, and then multiplying this number by 20.
[0554] Results and Conclusions In this assay, the transition between just below and just above the minimum detectable phase separation concentration (MPSC) was observed to occur very abruptly in all reactions performed. Just below the MPSC, no detectable phase-separated aqueous particles were observed, and the solution was found to be empty of visually detectable particles (spherical foci). Above the MPSC, the transition was very pronounced, with hundreds of visually detectable particles (spherical foci) suddenly forming.
[0555] The size of the spherical focus varied and was found to be correlated with the IDR tag and the divalent metal cation used. The specific size of the spherical focus was deemed insignificant.
[0556] Spherical foci existed as broadly spherical particulate structures. For any given IDR tag and any given divalent metal ion combination, the average diameter of the spherical foci population can be easily determined using standard methods.
[0557] The results obtained using individual fusion proteins are outlined below.
[0558] Gp32-HIS2 fusion protein Under these conditions, the minimum magnesium concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 10 mM, and approximately 600 particles (spherical focus) were counted within the field of view.
[0559] Under these conditions, the minimum concentration of calcium ions required to enhance the formation of detectable phase-separated aqueous particles was determined to be 12 mM, and approximately 500 particles (spherical focus) were counted within the field of view.
[0560] Under these conditions, the minimum manganese ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 2 mM, and approximately 180 particles (spherical focus) were counted within the field of view.
[0561] A representative enlarged image is shown in Figure 10A.
[0562] Gp32-HRP1 fusion protein Under these conditions, the minimum magnesium ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 16 mM. At this concentration, approximately 580 particles (spherical focus) were counted within the field of view.
[0563] Under these conditions, the minimum concentration of calcium ions required to enhance the formation of detectable phase-separated aqueous particles was determined to be 24 mM. At this concentration, approximately 240 particles (spherical focus) were counted within the field of view.
[0564] Under these conditions, the minimum manganese ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 6 mM. At this concentration, approximately 260 particles (spherical focus) were counted within the field of view.
[0565] A representative enlarged image is shown in Figure 10B.
[0566] Gp32-Sup1 fusion protein Under these conditions, the minimum magnesium ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 24 mM. At this concentration, approximately 280 particles (spherical focus) were counted within the field of view.
[0567] Under these conditions, the minimum concentration of calcium ions required to enhance the formation of detectable phase-separated aqueous particles was determined to be 32 mM. At this concentration, approximately 460 particles (spherical focus) were counted within the field of view.
[0568] Under these conditions, the minimum manganese ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 4 mM. At this concentration, approximately 220 particles (spherical focus) were counted within the field of view.
[0569] A representative enlarged image is shown in Figure 10C.
[0570] Gp32-Fib fusion protein Under these conditions, the minimum concentration of magnesium ions required to enhance the formation of detectable phase-separated aqueous particles was determined to be 500 μM. At this concentration, approximately 340 particles (spherical focus) were counted within the field of view.
[0571] Under these conditions, the minimum concentration of calcium ions required to enhance the formation of detectable phase-separated aqueous particles was determined to be 1 mM. At this concentration, approximately 500 particles (spherical focus) were counted within the field of view.
[0572] Under these conditions, the minimum manganese ion concentration required to enhance the formation of detectable phase-separated aqueous particles was determined to be 500 μM. At this concentration, approximately 360 particles (spherical focus) were counted within the field of view.
[0573] A representative enlarged image is shown in Figure 10D.
[0574] Using these assays, it was determined that the functional ability of IDR or IDR domains to enhance the formation of detectable phase-separated aqueous particles in an in vitro biochemical environment when tagged with a protein can be demonstrated when 10 or more particles (spherical focus) are formed at a magnification of 400x in a 218 μm × 175 μm magnified area. The functional ability of IDR or IDR domains to induce phase separation in an in vitro biochemical environment when tagged with a protein can be demonstrated preferably when 50 or more particles (spherical focus) are formed at a magnification of 400x in a 218 μm × 175 μm magnified area, and more preferably when 100 or more particles (spherical focus) are formed.
[0575] As used herein, the term “spherical focus” is synonymous with “sphere,” “particle,” or “spherical particle,” and these terms can be used interchangeably.
[0576] Example 11. Formation of spherical focus by IDR tagging in the presence of polyvalent metal cations. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of polyvalent metal cations on promoting phase separation driven / induced by several Gp32 fusion proteins, each having a tag containing an intrinsically disordered region (IDR) domain amino acid sequence, in an in vitro biochemical reaction system.
[0577] The example demonstrates that tags containing IDR domain amino acid sequences can promote / enhance phase separation, and that this effect occurs in the presence of various polyvalent metal cations.
[0578] Materials and methods Gp32-Fib fusion protein The specific amino acid sequence of the IDR domain tag used was PGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGR (Sequence ID 1). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The complete amino acid sequence of the Gp32-Fib fusion protein is provided as Sequence ID 69 (Table 23).
[0579] Gp32-Sup1 fusion protein The specific amino acid sequence of the IDR domain tag used was YNPQGGYQQ (SEQ ID NO: 19). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR domain tag of the fusion protein. The complete amino acid sequence of the Gp32-Sup1 fusion protein is provided as SEQ ID NO: 72 (Table 23).
[0580] Gp32-HIS2 fusion protein The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The complete amino acid sequence of the Gp32-HIS2 fusion protein is provided as SEQ ID NO: 82 (Table 23).
[0581] Gp32-HRP1 fusion protein The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The complete amino acid sequence of the Gp32-HRP1 fusion protein is provided as SEQ ID NO: 79 (Table 23).
[0582] Gp32-HIS5 fusion protein The specific amino acid sequence of the IDR domain tag used was SGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHH (SEQ ID NO: 27). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The complete amino acid sequence of the Gp32-HIS5 fusion protein is shown as SEQ ID NO: 85.
[0583] Phase separation assay The method outlined below applies to all fusion proteins tested. The volume of fusion protein solution used depended on the protein concentration after purification.
[0584] In each case, a 50 μl solution containing a tagged fusion protein and a divalent metal cation at a final concentration of 1000 ng / μl (29.4 μM) was prepared. The metal ion tested was Mg 2+ (MgOAc), Mn 2+ (MnCl2) and Ca 2+(CaCl2) was used in all cases at a final concentration of 20 mM.
[0585] After preparing a mixture containing water, IDR-tagged protein, and polyvalent metal cations, the mixture was vortexed and spun down, and a 10 μl sample of the mixture was transferred to a DHC-B01 C-Chip hemocytometer slide. The slide was then imaged at 400x magnification using a bright-field microscope. Phase separation was evaluated by the formation of spherical-like spherical foci (particles) that could be visually identified by magnification and counted using a hemocytometer.
[0586] Results and Conclusions Representative enlarged images are shown in Figures 11A to 11E.
[0587] For each of the IDR-tagged Gp32 fusion proteins tested, detectable phase separation was observed, as determined by the formation of detectable spherical phase-separated particles (spherical foci). In all cases, Mg 2+ Mn 2+ and Ca 2+ The effect was observed in the presence of divalent metal ions.
[0588] Therefore, the ability of polyvalent metal ions to induce / enhance phase separation appears to be a general property applicable to a wide range of different IDR tags with entirely different amino acid sequences.
[0589] Example 12. Formation of a spherical focus by Gp32 with an IDR tag derived from Saccharomyces cerevisiae Hrp1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the ability of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein to form spherical foci in an exemplary in vitro biochemical reaction environment in the absence of crowding agents.
[0590] The example demonstrates that a tag containing an IDR domain amino acid sequence could promote / enhance phase separation, as determined by the formation of detectable phase-separated aqueous particles in an exemplary in vitro biochemical reaction environment and in the absence of a crowding agent.
[0591] Materials and methods The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The fusion protein was named Gp32-HRP1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 79 (Table 23).
[0592] To test the effect of IDR domain sequence tagging, an exemplary in vitro biochemical reaction environment was constructed. In this case, the environment was characterized by a recombinase polymerase amplification reaction.
[0593] The reaction was set up according to the following protocol. The reaction mixture was prepared using the following components: 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.2 μM forward primer, 0.2 μM reverse primer, 0.516 μM probe, 22.6 μM Gp32-HRP fusion, 8.4 μM UvsX, 15.3 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase (large subunit), and 0.27 μM exonuclease III. Gp32, UvsX, UvsY, polymerase, and exonuclease III were prepared as a premix and then added in one step to a mixture of primers, buffer, nucleotides, and creatine kinase. The total volume was 44 μl. After combining the ingredients, 6 μl of 280 mM MgOAc was added to the mixture to achieve a final concentration of 33 mM. Next, 10 μl of the reaction mixture was transferred to a C-tip hemocytometer slide placed on a heating stage set to 39°C, and observed under a microscope, with images taken under bright-field and fluorescence conditions.
[0594] The relevant primers and probes are listed below.
[0595] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0596] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0597] Probe: CCGCAATGGTGCACTCTCAGTACAATCTGCTCTGATG (SEQ ID NO: 104) labeled with FAM (fluorescein).
[0598] Results and Conclusions As shown in Figure 12, the HRP tag bound to Gp32 promoted the formation of many detectable phase-separated aqueous particles (spherical foci) that appeared to be densely packed within the oligonucleotide (detectable by a fluorescently labeled probe).
[0599] Separate experiments were conducted using the same materials and conditions, except that the Gp32 protein was tagged only with the heptahistidine sequence and not with the HRP IDR tag. In these experiments, no spherical focus was formed (data not shown), indicating that the formation of the spherical focus was specifically driven by the IDR tag, and consequently, that the heptahistidine sequence is not a functional IDR as described herein.
[0600] The results demonstrate the functional ability of the IDR domain tag, in this case represented by the Saccharomyces cerevisiae HRP1 amino acid sequence tag, to promote detectable phase separation in an in vitro biochemical reaction environment, in this case a reaction mixture environment characterized by a recombinase polymerase amplification reaction, and in the absence of a crowding agent.
[0601] Example 13. Formation of spherical focus by Gp32 with an IDR tag derived from human Otx1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the ability of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the human Otx1 protein to form a spherical focus in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent.
[0602] The example demonstrates that tags containing IDR domain amino acid sequences were able to facilitate detectable phase separation in exemplary in vitro biochemical reaction environments and in the absence of crowding agents.
[0603] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS2. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 82 (Table 23).
[0604] To test the effect of IDR domain sequence tagging, an exemplary in vitro biochemical reaction environment was constructed. In this case, the environment was characterized by a recombinase polymerase amplification reaction.
[0605] The reaction was set up according to the following protocol. The reaction mixture was prepared using the following components: 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.2 μM forward primer, 0.2 μM reverse primer, 0.516 μM probe, 22.6 μM Gp32-HIS2 fusion, 8.4 μM UvsX, 15.3 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase (large subunit), and 0.27 μM exonuclease III. Gp32-His2, UvsX, UvsY, polymerase, and exonuclease III were prepared as a premix and then added in one step to a mixture of primers, buffer, nucleotides, and creatine kinase. The total volume was 44 μl. After combining the ingredients, 6 μl of 280 mM MgOAc was added to the mixture to achieve a final concentration of 33 mM. Next, 10 μl of the reaction mixture was transferred to a C-tip hemocytometer slide placed on a heating stage set to 39°C, and observed under a microscope, with images taken under bright-field and fluorescence conditions.
[0606] The relevant primers and probes are listed below.
[0607] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0608] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0609] Probe: CCGCAATGGTGCACTCTCAGTACAATCTGCTCTGATG (SEQ ID NO: 104) labeled with FAM (fluorescein).
[0610] Results and Conclusions As shown in Figure 13, the HIS2 IDR tag bound to Gp32 promoted the formation of numerous detectable phase-separated aqueous particles (spherical foci) that appeared to be densely packed within the oligonucleotide (detectable by a fluorescently labeled probe). Note that the size of these spheres appears smaller compared to those formed when the HRP IDR tag is bound to Gp32, as will be further described herein.
[0611] The results demonstrate the functional ability of the IDR domain tag, represented in this case by the HIS2 amino acid sequence tag, to promote detectable phase separation in an in vitro biochemical reaction environment, in this case a reaction mixture environment characterized by a recombinase polymerase amplification reaction, and in the absence of a crowding agent.
[0612] Example 14. Effect of polyvalent metal cations on the formation of spherical foci by Gp32 with an IDR tag derived from Saccharomyces cerevisiae Hrp1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of polyvalent metal cations on the ability of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein to form spherical foci in an exemplary in vitro biochemical reaction environment in the absence of crowding agents.
[0613] The example demonstrates that a tag containing an IDR domain amino acid sequence can promote / enhance phase separation in the absence of a crowding agent, as determined by the formation of detectable phase-separated aqueous particles, and that phase separation is enhanced in the presence of polyvalent metal cations, allowing for the determination of an optimized concentration for promoting phase separation.
[0614] Materials and methods The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The fusion protein was named Gp32-HRP1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 79 (Table 23).
[0615] To test the effects of IDR domain sequence tagging in the presence of various concentrations of divalent metal cations, exemplary in vitro biochemical reaction environments were constructed. In this case, the environment was characterized by recombinase polymerase amplification reactions.
[0616] The reaction was set up according to the following protocol. The reaction mixture was prepared using the following components: 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.26 μM forward primer, 0.26 μM reverse primer, 0.4 μM probe, 22.6 μM Gp32-HRP fusion, 8.4 μM UvsX, and 15.3 μM UvsY. Gp32, UvsX, and UvsY were prepared as a premix and then added in one step to the mixture of primers, buffer, nucleotides, and creatine kinase. MgOAc was added to the mixture to achieve the final concentration shown in the relevant figure. Subsequently, 10 μl of the reaction mixture was transferred to a C-tip hemocytometer slide placed on a heating stage set to 39°C, observed under a microscope, and images were taken under bright-field and fluorescence conditions.
[0617] The relevant primers and probes are listed below.
[0618] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0619] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0620] Probe: CCGCAATGGTGCACTCTCAGTACAATCTGCTCTGATG (SEQ ID NO: 104) labeled with FAM (fluorescein).
[0621] Results and Conclusions As shown in Figures 14A and 14B, the HRP IDR tag bound to Gp32 promoted the formation of many detectable phase-separated aqueous particles (spherical foci) that appeared to be densely packed within the oligonucleotide (detectable by a fluorescently labeled probe).
[0622] Spherical foci were clearly visible at 22.4 mM MgOAc. Optimal formation of spherical foci occurred at 33 mM MgOAc. At concentrations above 33 mM, some aggregates of small spheres began to be observed.
[0623] Notably, 33 mM MgOAc is the magnesium concentration at which optimal amplification efficiency is observed in recombinase polymerase amplification (RPA) reactions using IDR-tagged Gp32 in the absence of a crowding agent, as described herein. Therefore, the efficiency of IDR-tagged formation of spherical foci surprisingly correlates with the amplification efficiency in exemplary biochemical reactions in in vitro systems in the absence of crowding agents, in this case, in RPA reactions using IDR-tagged proteins as an example of a test biochemical system.
[0624] The results support the surprising conclusion that the performance of IDR domain sequence tags in driving / enhancing the efficiency of biochemical reactions in the absence of crowding agents can correlate with the efficiency of phase separation, which then appears to be enhanced by the concentration of polyvalent metal cations or their functional equivalents present in the system that affect the function of the intrinsically altered region or domain.
[0625] Example 15. Effect of polyvalent metal cations on the formation of spherical foci by Gp32 with an IDR tag derived from human Otx1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of polyvalent metal cations on the ability of a Gp32 fusion protein containing a tag with an intrinsically disordered region (IDR) of the human Otx1 protein to form particle / spherical foci in an exemplary in vitro biochemical reaction environment in the absence of crowding agents.
[0626] The example demonstrates that a tag containing an IDR domain amino acid sequence can facilitate detectable phase separation in a typical in vitro biochemical reaction environment and in the absence of a crowding agent, that the detectable phase separation is enhanced by the presence of polyvalent metal cations, and that an optimized concentration for facilitating detectable phase separation can be determined.
[0627] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS2. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 82 (Table 23).
[0628] To test the effects of IDR domain sequence tagging in the presence of various concentrations of divalent metal cations, exemplary in vitro biochemical reaction environments were constructed. In this case, the environment was characterized by recombinase polymerase amplification reactions.
[0629] The reaction was set up according to the following protocol. The reaction mixture was prepared using the following components: 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.26 μM forward primer, 0.26 μM reverse primer, 0.4 μM probe, 20 μM Gp32-HIS2 fusion, 8.4 μM UvsX, and 8.6 μM UvsY. Gp32, UvsX, and UvsY were prepared as a premix and then added in one step to the mixture of primers, buffer, nucleotides, and creatine kinase. MgOAc was added to the mixture to achieve the final concentration shown in the relevant figure. Subsequently, 10 μl of the reaction mixture was transferred to a C-tip hemocytometer slide placed on a heating stage set to 39°C, observed under a microscope, and images were taken under bright-field and fluorescence conditions.
[0630] The relevant primers and probes are listed below.
[0631] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0632] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0633] Probe: CCGCAATGGTGCACTCTCAGTACAATCTGCTCTGATG (SEQ ID NO: 104) labeled with FAM (fluorescein).
[0634] Results and Conclusions As shown in Figures 15A and 15B, the HIS2 tag bound to Gp32 promoted the formation of numerous spherical foci, which appeared to be densely packed in the oligonucleotide (as detected by the fluorescently labeled probe).
[0635] Spherical foci were clearly visible at 22.4 mM MgOAc. Optimal formation of spherical foci occurred between 33 and 39 mM MgOAc. At concentrations above 39 mM, some aggregates of small spheres began to be observed.
[0636] Notably, 33 mM–39 mM MgOAc is the magnesium concentration at which optimal amplification efficiency is observed in recombinase polymerase amplification (RPA) reactions using IDR-tagged Gp32 in the absence of a crowding agent, as described herein. Therefore, the efficiency of IDR-tagged formation of spherical foci surprisingly correlates with the amplification efficiency in exemplary biochemical reactions in in vitro systems in the absence of crowding agents, in this case, in RPA reactions using IDR-tagged proteins as an example of a test biochemical system.
[0637] The results support the surprising conclusion that the performance of IDR domain sequence tags in driving / enhancing the efficiency of biochemical reactions in the absence of crowding agents can correlate with the efficiency of phase separation, which then appears to be enhanced by the concentration of polyvalent metal cations or their functional equivalents present in the system that affect the function of the intrinsically altered region or domain.
[0638] Example 16. Effect of magnesium concentration on the formation of spherical foci by Gp32 with an IDR tag derived from Saccharomyces cerevisiae Hrp1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the effect of magnesium ions on the ability of Gp32 fusion protein preparations containing a tag with an intrinsically disordered region (IDR) of the Saccharomyces cerevisiae Hrp1 protein to form spherical foci in an exemplary in vitro biochemical reaction environment in the absence of a crowding agent.
[0639] The example demonstrates that tags containing IDR domain amino acid sequences could promote / enhance phase separation in an exemplary in vitro biochemical reaction environment and in the absence of crowding agents, as determined by the formation of detectable phase-separated aqueous particles; that the phase separation was dependent on the presence of magnesium ions; and that all protein components of the reaction mixture associated with the phase-separated particles rather than the bulk phase.
[0640] Materials and methods The specific amino acid sequence of the IDR domain tag used was GGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQ (SEQ ID NO: 9). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on an additional heptahistidine tag located precisely at the C-terminus of the fusion protein, i.e., after the C-terminal IDR tag of the fusion protein. The fusion protein was named Gp32-HRP1. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 79 (Table 23).
[0641] Exemplary in vitro biochemical reaction environments were created to test the effect of IDR domain sequence tags in or out of the presence of magnesium ions.
[0642] The reaction was set up according to the following protocol. A 1 ml reaction mixture was prepared containing the following components: 25 mM Tris HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 0.4 μM forward primer, 0.4 μM reverse primer, 0.4 μM probe, 20.26 μM Gp32-HRP fusion, 5 μM UvsX, 8.67 μM UvsY, 0.127 μM Staphylococcus aureus (S. aureus) DNA polymerase (large subunit), and either 0 mM or 33.6 mM MgOAc.
[0643] The relevant primers and probes are listed below.
[0644] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0645] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0646] Probe: CCGCAATGGTGCACTCTCAGTACAATCTGCTCTGATG (SEQ ID NO: 104) labeled with FAM (fluorescein).
[0647] I took a picture of the finished mixture.
[0648] The mixture was rotated at 2,000 rcf for 1 minute. The supernatant was removed from the MgOAc mixture. The mixture with 33.6 mM MgOAc contained small pellets, which appeared to consist of phase-separated spheres / particles. No similar pellets were observed in the mixture without MgOAc. 10 μl of 1% SDS solution was added to the pellets for solubilization. The volume of the pellets was estimated to be 4.5 μl, and the estimated total volume was 14.5 μl. 1 μl of each sample was analyzed by SDS-PAGE.
[0649] Results and Conclusions As shown in Figure 16A, the addition of magnesium acetate to 1 ml of the RPA mixture caused the mixture to become opaque. This was not observed in the absence of magnesium acetate. This opacity effect is the same effect seen in comparable smaller reactions, where microscopy revealed the formation of spherical focus / phase-separated particles with a typical diameter estimated to be in the range of 2–3 microns, typically about 200–400 particles per nanoliter. Upon centrifugation, these opaque mixtures were clarified, and a pellet or subphase was observed to form at the bottom of the tube, which was assumed to be a mass of particles that had come together into a single volume (Figure 16B). The estimated volume of this pellet fraction was about 4 μl, which is the predicted total volume of particles expected to form assuming an average particle size of 3 μm (and thus a volume of about 13 femtoliters) and an abundance of about 400 particles per nanoliter, which, based on hemocytometer / microscope field calculations, is 400,000 particles / microliter, producing an estimated volume of about 5 nl of particles per microliter of mixture, and therefore about 5 microliters per ml of mixture.
[0650] Analysis of 1 microliter bulk mixture (or clarified phase) before and after the addition of magnesium acetate shows that various proteins can be identified in the clarified liquid as expected before addition, with Gp32 being the most prominent protein by mass. After condensation and clarification, only trace amounts of protein can be found in the supernatant, but the pellet is very rich in all the proteins added to the RPA mixture (Figure 16C). It can be estimated that a reactant concentration of approximately 200 times was achieved, and that the total protein concentration was approximately 200 μg / μl.
[0651] The results demonstrate that all protein components of the RPA reaction mixture, namely creatine kinase, Gp32-HRP fusion, UvsX, UvsY, and polymerase, associate with phase-separated particles rather than the bulk phase.
[0652] Example 17. Demonstration of the essential properties of amino acid sequences containing intrinsically disordered regions in improving the efficiency of biochemical reactions. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of tag-less Gp32 proteins containing an amino acid sequence with an intrinsically disordered region (IDR) in exemplary in vitro biochemical reaction environments, either in the presence or absence of a crowding agent.
[0653] This example demonstrates that, in the absence of a tag containing the IDR domain amino acid sequence, Gp32 could not efficiently mediate recombinase polymerase amplification in the absence of a crowding agent, and could not reach the point of detection in this assay system within the analysis period. Compared with other examples above, such as Examples 1-5, these data demonstrate that a tag containing the IDR domain amino acid sequence is essential for enhancing the efficiency of the biochemical reaction in the absence of a crowding agent.
[0654] Materials and methods The phage vB EcoM NBG1 Gp32 protein was purified in its native form, lacking either an exogenous IDR tag or a histidine tag. The protein was purified using heparin resin and eluted using a NaCl step gradient. The native Gp32 protein from the 400 mM NaCl fraction was used for testing.
[0655] Exemplary in vitro biochemical reaction environments were created to test the effects of native Gp32 protein, either in the presence or absence of crowding agents.
[0656] The reaction was set up according to the following protocol.
[0657] A PEG-free reaction mixture was prepared containing the following components: 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM natural Gp32 protein, 4.8 μM UvsX, 8.6 μM UvsY, 0.135 μM Staphylococcus aureus (S. aureus) DNA polymerase (large subunit), and 0.27 μM exonuclease III.
[0658] The PEG-based reaction mixture was prepared using the following components: 50 mM Tris-HCl pH 8.3, 100 mM KOAc, 1 mM DTT, 2.5 mM ATP, 50 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 0.4 μM forward primer, 0.4 μM reverse primer, 0.12 μM probe, 20 μM native Gp32 protein, 4.8 μM UvsX, 8.6 μM UvsY, 0.27 μM Staphylococcus aureus (S. aureus) DNA polymerase (large subunit), 0.27 μM exonuclease III, and PEG at the final concentrations shown in the related figures. The PEG species used had a molecular weight of 35,000.
[0659] The relevant primers and probes for all reactions are listed below.
[0660] Forward primer: CGCCTGCAAGTCCTAAGACGCCAATCGAAAAGAAAC (Sequence ID 98).
[0661] Reverse primer: CTGCATCTCCGTGGTATACTAATACATTGTTTTTA (SEQ ID NO: 99).
[0662] Probe: CGAAAAGAAACACGCGGATGAAATCGATAAG[FAM] [THF][BHQ-1]ATACAAGGATTGGA (SEQ ID NO: 100), where FAM is fluorescein, THF is tetrahydrofuran, and BHQ is black hole quencher.
[0663] All reactions were initiated by adding 33 mM MgOAc and a DNA template derived from 100 copies of Listeria genomic DNA. The reaction mixture was then incubated at 39°C and placed in a fluorometer while being magnetically mixed using a bearing ball.
[0664] Results and Conclusions As shown in Figure 17, rapid amplification by the native Gp32 protein was observed in the presence of 5.5% PEG. However, no amplification was observed with the native Gp32 protein in the absence of PEG.
[0665] In the other examples above, e.g., Examples 1-5, Gp32-mediated amplification was observed in the absence of PEG only when the Gp32 protein was tagged with an amino acid sequence containing an intrinsically disordered region (IDR).
[0666] Therefore, together with the data presented in other examples described herein, these data demonstrate that tags containing amino acid sequences with intrinsically disordered regions (IDRs) applied to protein components essential to the function of in vitro biochemical reactions can avoid the need for crowding agents in the reaction and increase the efficiency of the biochemical reaction compared to the efficiency observed in the absence of the IDR tag sequence.
[0667] Example 18: Recombinase polymerase amplification on solid surfaces using Gp32 with an IDR tag derived from human Otx1. Objectives and Overview of the Experiment This experiment was conducted to evaluate the performance of Gp32 fusion protein preparations containing a tag with a histidine-rich amino acid domain sequence found in the intrinsically disordered region (IDR) of the human homeobox protein Otx1.
[0668] This example demonstrates recombinase polymerase amplification (RPA) of an artificial nucleic acid template on a solid surface using Gp32 C-terminus tagged with a histidine-rich intrinsically disordered region (IDR) domain (Otx1) in the absence of a crowding agent, in both real-time and endpoint assays.
[0669] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24). This was ligated to the C-terminus of phage vB EcoM NBG1 Gp32. The recombinant fusion protein was purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test. The fusion protein was named Gp32-HIS2. The complete amino acid sequence of the fusion protein is shown as SEQ ID NO: 82 (Table 23).
[0670] Next, recombinant phage vB EcoM NBG1 Gp32 fusion protein was tested on a solid surface in PEG-free amplification, i.e., in the absence of a crowding agent. The test was performed using two oligonucleotide primers bound to the surface of the beads in different proportions. Amplification was detected by fluorescence, either in real time using a cleavable quenched fluorescent probe or by endpoint detection of an annealed fluorescent probe. The beads were identical in both real-time and endpoint RPA reactions. The beads were supplied by Bangs Laboratories, Inc. (https: / / www.bangslabs.com / ) and had a carboxylated polystyrene core on which a hydrogel was grown, with the oligonucleotides covalently bound.
[0671] Real-time RPA response The reaction was set up by mixing 25 mM Tris-HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 120 nM probe, 20 μM Gp32 fusion, 4.9 μM UvsX, 7.6 μM UvsY, 0.146 μM Staphylococcus aureus (S. aureus) DNA polymerase, and 0.34 μM exonuclease III. The reaction mixture also contained 800,000 beads / μl, with each bead having approximately 750,000 oligonucleotide primers per bead, consisting of a mixture of PA30 forward primers and PB30 reverse primers.
[0672] The reaction was initiated by adding 33.6 mM MgOAc and an artificial DNA template called TF1L at a final concentration of 800,000 template copies per μl of the reaction mixture.
[0673] The relevant primers, probes, and templates are shown below.
[0674] PA30 forward primer: CCATCTCATCCCTGCGTGTCTCCGACTCAG (SEQ ID NO: 105).
[0675] PB30 reverse primer: CCTATCCCCTGTGTGCCTTGGCAGTCTCAG (Sequence ID 106).
[0676] Probe: AGCAGAAGCAATACCGCCAGCAATAGCA[dT-FAM]G[THF]G[dT-Quencher]AGAGCGAGCTGCC (Sequence ID 107), where FAM is fluorescein, THF is tetrahydrofuran, and Quencher is black hole quencher.
[0677] TF1L template sequence: CCATCTCATCCCTGCGTGTCTCCGACTCAGTGTTTTAGGGTCCCCGGGGTTAAAAGGTTTCGAACTCAACAGCTGTCTGGCAGCTCGCTCTACGCATGCTATTGCTGGCGGTATTGCTTCTGCTCTTGCTGGTGGCGCCATGTCTAAATTGTTTGGAGCTGAGACTGCCAAGGCACACAGGGGATAGG (Sequence ID 108).
[0678] Next, the reaction mixture was incubated in a T8 fluorometer at 39°C for 30 minutes, and fluorescence in the FAM channel was recorded.
[0679] Figure 18A is a schematic diagram of the reaction mixture set up for real-time amplification using dual-primer beads. Figure 18B is a schematic diagram of the amplified product in the real-time reaction.
[0680] Final RPA response The reaction was set up by mixing 25 mM Tris HCl pH 8.3, 7.5 mM KOAc, 1 mM DTT, 2.5 mM ATP, 20 mM phosphocreatine, 1 μM creatine kinase, 1 mM dNTP, 20 μM Gp32 fusion, 4.9 μM UvsX, 7.6 μM UvsY, and 0.146 μM Staphylococcus aureus (S. aureus) DNA polymerase. The reaction mixture also contained 800,000 beads / μl, with each bead having approximately 750,000 oligonucleotide primers per bead, consisting of a mixture of PA30 forward primers and PB30 reverse primers.
[0681] The reaction was initiated by adding 33.6 mM MgOAc and an artificial DNA template called TF1L at a final concentration of 800,000 template copies per μl of the reaction mixture.
[0682] The relevant primers and molds are shown below.
[0683] PA30 forward primer: CCATCTCATCCCTGCGTGTCTCCGACTCAG (SEQ ID NO: 105).
[0684] PB30 reverse primer: CCTATCCCCTGTGTGCCTTGGCAGTCTCAG (Sequence ID 106).
[0685] TF1L template sequence: CCATCTCATCCCTGCGTGTCTCCGACTCAGTGTTTTAGGGTCCCCGGGGTTAAAAGGTTTCGAACTCAACAGCTGTCTGGCAGCTCGCTCTACGCATGCTATTGCTGGCGGTATTGCTTCTGCTCTTGCTGGTGGCGCCATGTCTAAATTGTTTGGAGCTGAGACTGCCAAGGCACACAGGGGATAGG (Sequence ID 108).
[0686] Next, the reaction mixture was incubated at 39°C for 30 minutes, and then sodium dodecyl sulfate (SDS) was added to a final concentration of 1%, followed by heating at 65°C for 10 minutes to denaturate the protein and stop the reaction.
[0687] The SDS was removed by diluting it 10-fold with water, vortexing, centrifuging at approximately 18,000 g for 15 minutes, and then removing the supernatant. The beads were resuspended in TE pH 8.0, 0.05% Triton X-100 buffer to obtain approximately 800,000 beads / μl.
[0688] Two fluorescent oligonucleotide probes (PB30' probe (ROX-5'-CTGAGACTGCCAAGGCACACAGGGGATAGG; SEQ ID NO: 109) and TF1L probe (FAM-5'-GGTTTCGAACTCAACAGCTG; SEQ ID NO: 110), where ROX is carboxyrhodamine and FAM is fluorescein) were hybridized to beads at final concentrations of 1 μM and 80,000 beads / μl in TE pH 8.0, 0.05% Triton X-100, and 100 mM NaCl buffer. Hybridization was performed by heating to 95°C for 2 minutes and then cooling to 25°C at a rate of 0.1°C / second. Positive controls were performed using beads already bound to the TF1L amplicon. Next, the beads were washed, and the hybridization mixture was diluted sixfold with TE pH 8.0, 0.05% Triton X-100 buffer. Unhybridized probes were removed by centrifugation at approximately 18,000 g for 15 minutes, and then as much of the supernatant as possible was removed. The beads were resuspended in TE pH 8.0, 0.05% Triton X-100 buffer. The reaction mixture was then incubated in a T8 fluorometer (FAM level set to 17%, ROX level set to 8%) at 39°C for 5 minutes, and fluorescence in the FAM and ROX channels was recorded.
[0689] Figure 18C is a schematic diagram illustrating the evaluation of amplification characteristics in the endpoint reaction.
[0690] result Real-time RPA response Figure 18D shows real-time fluorescence detection of the TF1L amplicon using a specific exonuclease cleavage probe. The percentage of PA30 primers identified in the figure represents the percentage of bead-bound oligonucleotides that are PA30 oligonucleotides, with the remainder being PB30 oligonucleotides. Amplification is detected when all PA30 and PB30 oligonucleotide primers are bound to the beads, as well as when both PA30 and PB30 oligonucleotide primers are in the liquid phase, or when PB30 is bound to the beads and PA30 is in the liquid phase. No amplification was detected when only PB30 was present on the beads, or when PA30 was absent.
[0691] Final RPA response Endpoint fluorescence detection of TF1L amplicons was observed using PB30 oligonucleotide primers (ROX-labeled, Figure 18E) and probes specific to TF1L amplicons (FAM-labeled, Figure 18F). The percentages indicated in the figures represent the percentage of bead-bound oligonucleotides that are PA30 oligonucleotides, with the remainder being PB30 oligonucleotides. The following table shows the fluorescence levels for each bead type, the ratio of TF1L probe fluorescence to PB30' probe fluorescence, and the same normalized ratio against unamplified control beads directly bound to TF1L amplicons to account for background fluorescence caused by incomplete washing. [Table 25]
[0692] conclusion In both real-time and endpoint assays, it was found that nucleic acid amplification can be efficiently performed using the Gp32-HIS2 fusion protein in the absence of crowding agents such as PEG.
[0693] Example 19. Identification of amino acid sequences containing intrinsically disordered regions. The amino acid sequences of phage vB EcoM NBG1 Gp32, T4 UvsY, and T4 UvsX were examined using the MetaDisorder software program (MetaDisorder: a meta-server for predicting intrinsic dysregulation of proteins; Kozlowshi, LP et al., BMC Bioinformatics, 2012, 13(1):111).
[0694] As shown in Figures 19A, 19B, and 19C, respectively, the full-length amino acid sequences of phage vB EcoM NBG1 Gp32, T4 UvsY, and T4 UvsX contain amino acid sequence stretches that score greater than 0.5 when analyzed by the algorithm, and therefore contain intrinsically disordered region sequences.
[0695] This example demonstrates that intrinsically disordered region sequences or their domains can be easily identified using standard analytical methods.
[0696] Example 20. Comparison of phase separation promoting activity between RB69 ligase with a human Otx1-derived IDR tag and RB69 ligase. Objectives and Overview of the Experiment This experiment was conducted to evaluate the phase separation-promoting activity of ligase enzyme fusion protein preparations containing a tag that includes a histidine-rich amino acid domain sequence found in the intrinsically disordered region (IDR) of the human homeobox protein Otx1 (His2 tag).
[0697] The experiment showed that the formation of phase-separated aqueous particles (spherical foci) by RB69 ligase-His2 in the absence of a crowding agent was due to Mg 2+ Although enhanced by concentration, the formation of spherical focus by RB69 ligase was Mg 2+ We demonstrated that there was little or no correlation with concentration.
[0698] Materials and methods The specific amino acid sequence of the IDR domain tag used was AGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSG (SEQ ID NO: 24, Table 1). This was ligated to the C-terminus of RB69 DNA ligase. The recombinant fusion protein and the IDR-free protein were purified using standard one-step immobilized metal (nickel) affinity chromatography, which relies on the naturally occurring histidine in the IDR domain tag of the fusion protein under test and the polyhistidine tag at the C-terminus of the IDR-free protein. The fusion protein was named RB69 ligase-His2, and the IDR-free protein was named RB69 ligase. The complete amino acid sequences of the proteins are shown in Table 24 below as SEQ ID NO: 111 and SEQ ID NO: 112, respec...
Claims
1. A method for performing nucleic acid amplification reactions in vitro, including the following: A recombinase polymerase amplification (RPA) reaction is carried out in the presence of at least one fusion protein; wherein the at least one fusion protein comprises at least one RPA component, the RPA component being fused to a polypeptide containing a functionally intrinsically disordered region (IDR). Here, the at least one fusion protein causes liquid-liquid demixing and the formation of multiple phase-separated aqueous compartments. However, the RPA component is Gp32, and the IDR contains an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 19, 24, and 27.
2. The method according to claim 1, wherein the RPA reaction is carried out in the presence of at least one further fusion protein, the at least one further fusion protein comprising a different RPA component fused to a polypeptide containing at least one functional IDR, the different RPA component being selected from the group consisting of recombinase agents, single-chain stabilizers, polymerases, and recombinase-loading proteins.
3. The method according to claim 1, wherein the IDR comprises the amino acid sequence of SEQ ID NO: 9, and the at least one fusion protein comprises the amino acid sequence of SEQ ID NO:
120.
4. A method according to claim 1, wherein the at least one functional IDR increases the efficiency of the RPA reaction by at least 5% compared to an RPA reaction performed under the same conditions without using the at least one functional IDR.
5. The method according to claim 1, wherein the RPA reaction is carried out in the presence of at least one polyvalent metal ion.
6. The method according to claim 5, wherein at least one polyvalent metal ion is present at a concentration of at least 22 mM.
7. At least one polyvalent metal ion is Mg 2 + , Mn 2 + , Ca 2 + , Co 2 + or Ni 2 + The method according to claim 5, comprising any of these.
8. The method according to claim 1, wherein the RPA reaction is carried out in the presence of ATP.
9. ATP is provided in concentrations ranging from 1 mM to 3.5 mM. The method according to claim 8.
10. Methods for performing nucleic acid amplification reactions, including the following: The first and second nucleoprotein primers, each containing a recombinase agent, a single-strand stabilizer, a nucleic acid primer, and a recombinase-loaded protein, are brought into contact with a double-stranded target nucleic acid molecule under conditions that the first and second nucleoprotein primers bind to the first and second strands of the double-stranded target nucleic acid, and the 3' ends of the first and second nucleoprotein primers are extended with polymerase and dNTPs to generate the first and second amplified nucleic acid chains. Here, the single-chain stabilizer is fused to a polypeptide containing at least one functional intrinsically modified region (IDR), thereby causing liquid-liquid separation and the formation of multiple phase-separated aqueous compartments. However, the single-chain stabilizer is Gp32, and the IDR contains an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 19, 24, and 27.
11. The method according to claim 10, wherein the IDR comprises the amino acid sequence of SEQ ID NO: 9 and the fusion protein comprises the amino acid sequence of SEQ ID NO:
120.
12. A fusion protein comprising an RPA component fused to a polypeptide containing at least one functionally intrinsically disordered region (IDR), The RPA component is Gp32, and the IDR contains an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 19, 24, and 27. Fusion protein.
13. The fusion protein according to claim 12, wherein the IDR comprises the amino acid sequence of SEQ ID NO: 9 and the fusion protein comprises the amino acid sequence of SEQ ID NO:
120.
14. An isolated nucleic acid molecule comprising a first nucleic acid sequence encoding a fusion protein according to claim 12 or 13, and optionally comprising a second nucleic acid sequence encoding a promoter, wherein the first nucleic acid sequence is operably linked to the second nucleic acid sequence.
15. A recombinant polynucleotide expression vector comprising the nucleic acid molecule described in claim 14.
16. A host cell comprising the nucleic acid molecule described in claim 14 or the recombinant polynucleotide expression vector described in claim 15.
17. A cell culture comprising a growth medium and a population of host cells, wherein the population comprises the host cells described in claim 16.
18. A kit comprising the fusion protein according to claim 12 or 13.
19. The present invention further comprises additional RPA components including an RPA recombinase agent and / or an RPA recombinase-loaded protein and / or a polymerase and / or first and second nucleic acid primers and / or an exonuclease and / or a buffer and / or a polyvalent metal ion source; and / or The kit according to claim 18, wherein all components are provided in a freeze-dried form.
Citation Information
Patent Citations
ssb-polymerase fusion protein
JP2009520461A
Fusion polypeptide and its use
JP2013505016A
Synthetic nucleic acids for polymerization reactions
JP2015512651A
Optogenetic tool for rapid and reversible clustering of proteins
US20170355977A1
System and method for inducing clusters of gene regulatory proteins targeted to specific genomic loci
WO2019147611A2